RPS-BLAST 2.2.26 [Sep-21-2011]
Database: CDD.v3.10
44,354 sequences; 10,937,602 total letters
Searching..................................................done
Query= psy2316
(69 letters)
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
domain. Phosphotransferases. Serine or
threonine-specific kinase subfamily.
Length = 254
Score = 92.2 bits (230), Expect = 6e-25
Identities = 30/65 (46%), Positives = 47/65 (72%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ ++HPNI+ +Y+VFE+ +K+ LVMEY GG+L+D L ++ L+E+EAR RQI +A+
Sbjct: 51 LKKLKHPNIVRLYDVFEDEDKLYLVMEYCEGGDLFDLLKKRGRLSEDEARFYLRQILSAL 110
Query: 61 YYCHK 65
Y H
Sbjct: 111 EYLHS 115
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain.
Length = 260
Score = 85.8 bits (213), Expect = 2e-22
Identities = 25/64 (39%), Positives = 43/64 (67%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ + HPNI+ + + FE+++ + LVMEY GG+L+D+L + L+E+EA++I QI +
Sbjct: 52 LRRLSHPNIVRLIDAFEDKDHLYLVMEYCEGGDLFDYLSRGGPLSEDEAKKIALQILRGL 111
Query: 61 YYCH 64
Y H
Sbjct: 112 EYLH 115
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases. Protein Kinases
(PKs), catalytic (c) domain. PKs catalyze the transfer
of the gamma-phosphoryl group from ATP to
serine/threonine or tyrosine residues on protein
substrates. The PK family is part of a larger
superfamily that includes the catalytic domains of RIO
kinases, aminoglycoside phosphotransferase, choline
kinase, phosphoinositide 3-kinase (PI3K), and
actin-fragmin kinase. PKs make up a large family of
serine/threonine kinases, protein tyrosine kinases
(PTKs), and dual-specificity PKs that phosphorylate both
serine/threonine and tyrosine residues of target
proteins. Majority of protein phosphorylation, about
95%, occurs on serine residues while only 1% occurs on
tyrosine residues. Protein phosphorylation is a
mechanism by which a wide variety of cellular proteins,
such as enzymes and membrane channels, are reversibly
regulated in response to certain stimuli. PKs often
function as components of signal transduction pathways
in which one kinase activates a second kinase, which in
turn, may act on other kinases; this sequential action
transmits a signal from the cell surface to target
proteins, which results in cellular responses. The PK
family is one of the largest known protein families with
more than 100 homologous yeast enzymes and 550 human
proteins. A fraction of PK family members are
pseudokinases that lack crucial residues for catalytic
activity. The mutiplicity of kinases allows for specific
regulation according to substrate, tissue distribution,
and cellular localization. PKs regulate many cellular
processes including proliferation, division,
differentiation, motility, survival, metabolism,
cell-cycle progression, cytoskeletal rearrangement,
immunity, and neuronal functions. Many kinases are
implicated in the development of various human diseases
including different types of cancer.
Length = 215
Score = 80.0 bits (198), Expect = 1e-20
Identities = 27/66 (40%), Positives = 37/66 (56%), Gaps = 1/66 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQK-KVLTEEEARRIFRQIATA 59
+ + HPNI+ +Y VFE+ + LVMEY GG L D L + L+E+E RI QI
Sbjct: 45 LKKLNHPNIVKLYGVFEDENHLYLVMEYCEGGSLKDLLKENEGKLSEDEILRILLQILEG 104
Query: 60 VYYCHK 65
+ Y H
Sbjct: 105 LEYLHS 110
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine
Kinase, Never In Mitosis gene A-related kinase.
Serine/Threonine Kinases (STKs), Never In Mitosis gene A
(NIMA)-related kinase (Nek) family, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. The Nek family is
composed of 11 different mammalian members (Nek1-11)
with similarity to the catalytic domain of Aspergillus
nidulans NIMA kinase, the founding member of the Nek
family which was identified in a screen for cell cycle
mutants that were prevented from entering mitosis. Neks
contain a conserved N-terminal catalytic domain and a
more divergent C-terminal regulatory region of various
sizes and structures. They are involved in the
regulation of downstream processes following the
activation of Cdc2, and many of their functions are cell
cycle-related. They play critical roles in microtubule
dynamics during ciliogenesis and mitosis.
Length = 258
Score = 72.1 bits (178), Expect = 2e-17
Identities = 26/69 (37%), Positives = 38/69 (55%), Gaps = 4/69 (5%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKV----LTEEEARRIFRQI 56
+ + HPNII YE FE + K+ +VMEYA GG+L + ++K EE+ F Q+
Sbjct: 53 LKKLNHPNIIKYYESFEEKGKLCIVMEYADGGDLSQKIKKQKKEGKPFPEEQILDWFVQL 112
Query: 57 ATAVYYCHK 65
A+ Y H
Sbjct: 113 CLALKYLHS 121
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein
Serine/Threonine Kinases. Serine/Threonine Kinases
(STKs), AGC (Protein Kinases A, G and C) family,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The AGC family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and Phosphoinositide 3-Kinase (PI3K). Members of
this family include cAMP-dependent Protein Kinase (PKA),
cGMP-dependent Protein Kinase (PKG), Protein Kinase C
(PKC), Protein Kinase B (PKB), G protein-coupled
Receptor Kinase (GRK), Serum- and Glucocorticoid-induced
Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase
(p70S6K or S6K), among others. AGC kinases share an
activation mechanism based on the phosphorylation of up
to three sites: the activation loop (A-loop), the
hydrophobic motif (HM) and the turn motif.
Phosphorylation at the A-loop is required of most AGC
kinases, which results in a disorder-to-order transition
of the A-loop. The ordered conformation results in the
access of substrates and ATP to the active site. A
subset of AGC kinases with C-terminal extensions
containing the HM also requires phosphorylation at this
site. Phosphorylation at the HM allows the C-terminal
extension to form an ordered structure that packs into
the hydrophobic pocket of the catalytic domain, which
then reconfigures the kinase into an active bi-lobed
state. In addition, growth factor-activated AGC kinases
such as PKB, p70S6K, RSK, MSK, PKC, and SGK, require
phosphorylation at the turn motif (also called tail or
zipper site), located N-terminal to the HM at the
C-terminal extension. AGC kinases regulate many cellular
processes including division, growth, survival,
metabolism, motility, and differentiation. Many are
implicated in the development of various human diseases.
Length = 250
Score = 62.9 bits (154), Expect = 7e-14
Identities = 25/65 (38%), Positives = 39/65 (60%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+S + HP I+ ++ F+ EK+ LV+EYA GGEL+ L ++ +EE AR +I A+
Sbjct: 47 LSRINHPFIVKLHYAFQTEEKLYLVLEYAPGGELFSHLSKEGRFSEERARFYAAEIVLAL 106
Query: 61 YYCHK 65
Y H
Sbjct: 107 EYLHS 111
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated
serine/threonine kinase-like proteins. Serine/Threonine
Kinases (STKs), Microtubule-associated serine/threonine
(MAST) kinase subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The MAST kinase subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. The MAST kinase subfamily
includes MAST kinases, MAST-like (MASTL) kinases, and
fungal kinases with similarity to Saccharomyces
cerevisiae Rim15 and Schizosaccharomyces pombe cek1.
MAST kinases contain an N-terminal domain of unknown
function, a central catalytic domain, and a C-terminal
PDZ domain that mediates protein-protein interactions.
MASTL kinases carry only a catalytic domain which
contains a long insert relative to other kinases. The
fungal kinases in this subfamily harbor other domains in
addition to a central catalytic domain, which also
contains an insert relative to MAST kinases like MASTL.
Rim15 contains a C-terminal signal receiver (REC) domain
while cek1 contains an N-terminal PAS domain. MAST
kinases are cytoskeletal associated kinases of unknown
function that are also expressed at neuromuscular
junctions and postsynaptic densities. The fungal
proteins Rim15 and cek1 are involved in the regulation
of meiosis and mitosis, respectively.
Length = 265
Score = 57.3 bits (139), Expect = 1e-11
Identities = 21/65 (32%), Positives = 35/65 (53%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+S + P ++ +Y F+ ++ + LVMEY GG+L L+ L E+ AR +I A+
Sbjct: 47 LSQAQSPYVVKLYYSFQGKKNLYLVMEYLPGGDLASLLENVGSLDEDVARIYIAEIVLAL 106
Query: 61 YYCHK 65
Y H
Sbjct: 107 EYLHS 111
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
Serine/Threonine Kinase, Mitogen-Activated Protein
Kinase Kinase Kinase. Serine/threonine kinases (STKs),
mitogen-activated protein kinase (MAPK) kinase kinase
(MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MAPKKK subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called
MAP/ERK kinase kinases (MEKKs) in some cases. They
phosphorylate and activate MAPK kinases (MAPKKs or MKKs
or MAP2Ks), which in turn phosphorylate and activate
MAPKs during signaling cascades that are important in
mediating cellular responses to extracellular signals.
This subfamily is composed of the Apoptosis
Signal-regulating Kinases ASK1 (or MAPKKK5) and ASK2 (or
MAPKKK6), MEKK1, MEKK2, MEKK3, MEKK4, as well as plant
and fungal MAPKKKs. Also included in this subfamily are
the cell division control proteins Schizosaccharomyces
pombe Cdc7 and Saccharomyces cerevisiae Cdc15.
Length = 260
Score = 56.4 bits (137), Expect = 2e-11
Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 2/66 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVL--VMEYAAGGELYDFLDQKKVLTEEEARRIFRQIAT 58
+SS++HPNI+ Y + EK L +EY +GG L L + L E R+ RQI
Sbjct: 53 LSSLQHPNIVRYYGSERDEEKNTLNIFLEYVSGGSLSSLLKKFGKLPEPVIRKYTRQILE 112
Query: 59 AVYYCH 64
+ Y H
Sbjct: 113 GLAYLH 118
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function
prediction only / Signal transduction mechanisms /
Transcription / DNA replication, recombination, and
repair].
Length = 384
Score = 56.3 bits (134), Expect = 3e-11
Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 3/63 (4%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYAAGGELYDFLD---QKKVLTEEEARRIFRQIATAVYY 62
PNI+ +Y+ F++ + LVMEY GG L D L +K L+E EA I QI +A+ Y
Sbjct: 57 PPNIVKLYDFFQDEGSLYLVMEYVDGGSLEDLLKKIGRKGPLSESEALFILAQILSALEY 116
Query: 63 CHK 65
H
Sbjct: 117 LHS 119
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine
Kinase, Cell Cycle-Related Kinase. Serine/Threonine
Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
CCRK subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CCRK was previously called p42. It is a
Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK)
which is essential for the activation of CDK2. It is
indispensable for cell growth and has been implicated in
the progression of glioblastoma multiforme. In the
heart, a splice variant of CCRK with a different
C-terminal half is expressed, this variant promotes
cardiac cell growth and survival and is significantly
down-regulated during the development of heart failure.
Length = 286
Score = 55.8 bits (135), Expect = 4e-11
Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 2/66 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL-DQKKVLTEEEARRIFRQIATA 59
+ + +HP ++ + +VF + VLVMEY L + L D+++ L E + + R +
Sbjct: 53 LQACQHPYVVKLLDVFPHGSGFVLVMEYMPSD-LSEVLRDEERPLPEAQVKSYMRMLLKG 111
Query: 60 VYYCHK 65
V Y H
Sbjct: 112 VAYMHA 117
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 2. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek2 subfamily is
one of a family of 11 different Neks (Nek1-11) that are
involved in cell cycle control. The Nek family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. The Nek2
subfamily includes Aspergillus nidulans NIMA kinase, the
founding member of the Nek family, which was identified
in a screen for cell cycle mutants prevented from
entering mitosis. NIMA is essential for mitotic entry
and progression through mitosis, and its degradation is
essential for mitotic exit. NIMA is involved in nuclear
membrane fission. Vertebrate Nek2 is a cell
cycle-regulated STK, localized in centrosomes and
kinetochores, that regulates centrosome splitting at the
G2/M phase. It also interacts with other mitotic kinases
such as Polo-like kinase 1 and may play a role in
spindle checkpoint. An increase in the expression of the
human NEK2 gene is strongly associated with the
progression of non-Hodgkin lymphoma.
Length = 265
Score = 55.3 bits (134), Expect = 4e-11
Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 6/75 (8%)
Query: 1 MSSVRHPNIIHIYEVFENREK--MVLVMEYAAGGELYDFL----DQKKVLTEEEARRIFR 54
+ ++HPNI+ Y+ +R + +VMEY GG+L + ++K + EE RI
Sbjct: 53 LRELKHPNIVRYYDRIIDRSNQTLYIVMEYCEGGDLAQLIQKCKKERKYIEEEFIWRILT 112
Query: 55 QIATAVYYCHKVQDN 69
Q+ A+Y CH D
Sbjct: 113 QLLLALYECHNRSDP 127
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent
protein Kinase-like Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase (CDK)-like subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. CDKs are partly
regulated by their subcellular localization, which
defines substrate phosphorylation and the resulting
specific function. CDK1, CDK2, CDK4, and CDK6 have
well-defined functions in the cell cycle, such as the
regulation of the early G1 phase by CDK4 or CDK6, the
G1/S phase transition by CDK2, or the entry of mitosis
by CDK1. They also exhibit overlapping cyclin
specificity and functions in certain conditions.
Knockout mice with a single CDK deleted remain viable
with specific phenotypes, showing that some CDKs can
compensate for each other. For example, CDK4 can
compensate for the loss of CDK6, however, double
knockout mice with both CDK4 and CDK6 deleted die in
utero. CDK8 and CDK9 are mainly involved in
transcription while CDK5 is implicated in neuronal
function. CDK7 plays essential roles in both the cell
cycle as a CDK-Activating Kinase (CAK) and in
transcription as a component of the general
transcription factor TFIIH.
Length = 282
Score = 55.6 bits (135), Expect = 5e-11
Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 2/61 (3%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKV-LTEEEARRIFRQIATAVYYC 63
+HPNI+ + +V K+ LV EY +L +LD++ L+ + I Q+ + YC
Sbjct: 56 KHPNIVKLLDVIHTERKLYLVFEYCD-MDLKKYLDKRPGPLSPNLIKSIMYQLLRGLAYC 114
Query: 64 H 64
H
Sbjct: 115 H 115
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional.
Length = 267
Score = 52.9 bits (128), Expect = 3e-10
Identities = 21/60 (35%), Positives = 35/60 (58%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCHK 65
+PN I +Y + VL+M+Y G+L+D L ++ L+E E ++I RQ+ A+ HK
Sbjct: 68 NPNFIKLYYSVTTLKGHVLIMDYIKDGDLFDLLKKEGKLSEAEVKKIIRQLVEALNDLHK 127
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein
Serine/Threonine Kinase, Protein Kinase B beta.
Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
or Akt subfamily, beta (or Akt2) isoform, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The PKB subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. There are three
PKB isoforms from different genes, PKB-alpha (or Akt1),
PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
contains an N-terminal pleckstrin homology (PH) domain
and a C-terminal catalytic domain. PKB-beta is the
predominant PKB isoform expressed in insulin-responsive
tissues. It plays a critical role in the regulation of
glucose homeostasis. It is also implicated in muscle
cell differentiation. Mice deficient in PKB-beta display
normal growth weights but exhibit severe insulin
resistance and diabetes, accompanied by lipoatrophy and
B-cell failure.
Length = 323
Score = 52.7 bits (126), Expect = 6e-10
Identities = 24/64 (37%), Positives = 39/64 (60%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ + RHP + + F+ +++ VMEYA GGEL+ L +++V TEE AR +I +A+
Sbjct: 49 LQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSAL 108
Query: 61 YYCH 64
Y H
Sbjct: 109 EYLH 112
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein
Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,
and similar domains. Serine/Threonine Kinases (STKs),
Chlamydomonas reinhardtii Never In Mitosis gene A
(NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Chlamydomonas
reinhardtii CNK2-like subfamily belongs to the
(NIMA)-related kinase (Nek) family. The Nek family
includes seven different Chlamydomonas Neks (CNKs 1-6
and Fa2). This subfamily includes CNK1, and -2. The Nek
family is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Chlamydomonas reinhardtii CNK2 has both
cilliary and cell cycle functions. It influences
flagellar length through promoting flagellar
disassembly, and it regulates cell size, through
influencing the size threshold at which cells commit to
mitosis.
Length = 256
Score = 52.1 bits (125), Expect = 7e-10
Identities = 24/61 (39%), Positives = 37/61 (60%), Gaps = 4/61 (6%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQ----KKVLTEEEARRIFRQI 56
++SV HPNII E F + K+ +VMEYA G+L + + +K++ E+E RIF Q+
Sbjct: 53 LASVNHPNIISYKEAFLDGNKLCIVMEYAPFGDLSKAISKRKKKRKLIPEQEIWRIFIQL 112
Query: 57 A 57
Sbjct: 113 L 113
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase.
Length = 258
Score = 51.0 bits (123), Expect = 2e-09
Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL-DQKKVLTEEEARRIFRQIATA 59
M + HPNI+ + V E + +V EY GG+L DFL + LT ++ ++ QIA
Sbjct: 55 MKKLSHPNIVRLLGVCTQGEPLYIVTEYMPGGDLLDFLRKHGEKLTLKDLLQMALQIAKG 114
Query: 60 VYY 62
+ Y
Sbjct: 115 MEY 117
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine
Kinase, p21-activated kinase. Serine/threonine kinases
(STKs), p21-activated kinase (PAK) subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The PAK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PAKs are Rho
family GTPase-regulated kinases that serve as important
mediators in the function of Cdc42 (cell division cycle
42) and Rac. PAKs are implicated in the regulation of
many cellular processes including growth factor
receptor-mediated proliferation, cell polarity, cell
motility, cell death and survival, and actin
cytoskeleton organization. PAK deregulation is
associated with tumor development. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
Group I PAKs contain a PBD (p21-binding domain)
overlapping with an AID (autoinhibitory domain), a
C-terminal catalytic domain, SH3 binding sites and a
non-classical SH3 binding site for PIX (PAK-interacting
exchange factor). Group II PAKs contain a PBD and a
catalytic domain, but lack other motifs found in group I
PAKs. Since group II PAKs do not contain an obvious AID,
they may be regulated differently from group I PAKs.
Group I PAKs interact with the SH3 containing proteins
Nck, Grb2 and PIX; no such binding has been demonstrated
for group II PAKs.
Length = 286
Score = 51.1 bits (123), Expect = 2e-09
Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 1/66 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKV-LTEEEARRIFRQIATA 59
M +HPNI+ Y+ + +++ +VMEY GG L D + Q V + E + + R++
Sbjct: 69 MKDCKHPNIVDYYDSYLVGDELWVVMEYMDGGSLTDIITQNFVRMNEPQIAYVCREVLQG 128
Query: 60 VYYCHK 65
+ Y H
Sbjct: 129 LEYLHS 134
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 8. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek8 subfamily is
one of a family of 11 different Neks (Nek1-11) that are
involved in cell cycle control. The Nek family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Nek8 contains an
N-terminal kinase catalytic domain and a C-terminal RCC1
(regulator of chromosome condensation) domain. A double
point mutation in Nek8 causes cystic kidney disease in
mice that genetically resembles human autosomal
recessive polycystic kidney disease (ARPKD). Nek8 is
also associated with a rare form of juvenile renal
cystic disease, nephronophthisis type 9. It has been
suggested that a defect in the ciliary localization of
Nek8 contributes to the development of cysts manifested
by these diseases.
Length = 256
Score = 51.0 bits (122), Expect = 2e-09
Identities = 23/66 (34%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQK--KVLTEEEARRIFRQIAT 58
+ + HPNII YE F + +++VMEYA GG L +++ ++ +L E+ F QI
Sbjct: 53 LKLLSHPNIIEYYENFLEDKALMIVMEYAPGGTLAEYIQKRCNSLLDEDTILHFFVQILL 112
Query: 59 AVYYCH 64
A+++ H
Sbjct: 113 ALHHVH 118
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 9. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek9 subfamily is
one of a family of 11 different Neks (Nek1-11) that are
involved in cell cycle control. The Nek family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Nek9, also called
Nercc1, is primarily a cytoplasmic protein but can also
localize in the nucleus. It is involved in modulating
chromosome alignment and splitting during mitosis. It
interacts with the gamma-tubulin ring complex and the
Ran GTPase, and is implicated in microtubule
organization. Nek9 associates with FACT (FAcilitates
Chromatin Transcription) and modulates interphase
progression. It also interacts with Nek6, and Nek7,
during mitosis, resulting in their activation.
Length = 256
Score = 50.9 bits (122), Expect = 2e-09
Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 2/67 (2%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL--DQKKVLTEEEARRIFRQIAT 58
+S ++HPNII Y F + +++ MEYA GG LYD + + ++ EE QI +
Sbjct: 53 LSLLQHPNIIAYYNHFMDDNTLLIEMEYANGGTLYDKIVRQKGQLFEEEMVLWYLFQIVS 112
Query: 59 AVYYCHK 65
AV Y HK
Sbjct: 113 AVSYIHK 119
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ
cell-Associated Kinase-like Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Male germ
cell-Associated Kinase (MAK)-like subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MAK-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. This subfamily is composed of human MAK and
MAK-related kinase (MRK), Saccharomyces cerevisiae
Ime2p, Schizosaccharomyces pombe Mei4-dependent protein
3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5,
Arabidopsis thaliana MHK, and similar proteins. These
proteins play important roles during meiosis. MAK is
highly expressed in testicular cells specifically in the
meiotic phase, but is not essential for spermatogenesis
and fertility. It functions as a coactivator of the
androgen receptor in prostate cells. MRK, also called
Intestinal Cell Kinase (ICK), is expressed ubiquitously,
with highest expression in the ovary and uterus. A
missense mutation in MRK causes
endocrine-cerebro-osteodysplasia (ECO), suggesting that
this protein plays an important role in the development
of many organs. MAK and MRK may be involved in
regulating cell cycle and cell fate. Ime2p is a
meiosis-specific kinase that is important during meiotic
initiation and during the later stages of meiosis. Mde3
functions downstream of the transcription factor Mei-4
which is essential for meiotic prophase I.
Length = 283
Score = 50.6 bits (122), Expect = 2e-09
Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 3/63 (4%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL--DQKKVLTEEEARRIFRQIATAVYY 62
HPNI+ + EVF +++ V EY G LY + + K +E R I QI + +
Sbjct: 56 EHPNIVKLKEVFRENDELYFVFEYME-GNLYQLMKDRKGKPFSESVIRSIIYQILQGLAH 114
Query: 63 CHK 65
HK
Sbjct: 115 IHK 117
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of
Phototropin-like Protein Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Phototropin-like
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
phototropin-like subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. Included in this subfamily
are plant phototropins and predominantly uncharacterized
fungal STKs whose catalytic domains resemble the
phototropin kinase domain. One protein from Neurospora
crassa is called nrc-2. Phototropins are blue-light
receptors that control responses such as phototropism,
stromatal opening, and chloroplast movement in order to
optimize the photosynthetic efficiency of plants. They
are light-activated STKs that contain an N-terminal
photosensory domain and a C-terminal catalytic domain.
The N-terminal domain contains two LOV (Light, Oxygen or
Voltage) domains that binds FMN. Photoexcitation of the
LOV domains results in autophosphorylation at multiple
sites and activation of the catalytic domain. Neurospora
crassa nrc-2 plays a role in growth and development by
controlling entry into the conidiation program.
Length = 316
Score = 50.7 bits (122), Expect = 2e-09
Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQ--KKVLTEEEARRIFRQIAT 58
++++ HP + +Y F+ + LVM+Y GGEL+ L + K L+EE AR ++
Sbjct: 55 LATLDHPFLPTLYASFQTETYLCLVMDYCPGGELFRLLQRQPGKCLSEEVARFYAAEVLL 114
Query: 59 AVYYCH 64
A+ Y H
Sbjct: 115 ALEYLH 120
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase
3-like Protein Serine/Threonine Kinases.
Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
(MEKK3)-like subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The MEKK3-like subfamily is part of a larger superfamily
that includes the catalytic domains of other protein
STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. This subfamily is composed of
MEKK3, MEKK2, and related proteins, all containing an
N-terminal PB1 domain, which mediates oligomerization,
and a C-terminal catalytic domain. MEKK2 and MEKK3 are
mitogen-activated protein kinase (MAPK) kinase kinases
(MAPKKKs or MKKKs or MAP3Ks), proteins that
phosphorylate and activate MAPK kinases (MAPKKs or MKKs
or MAP2Ks), which in turn phosphorylate and activate
MAPKs during signaling cascades that are important in
mediating cellular responses to extracellular signals.
MEKK2 and MEKK3 activate MEK5 (also called MKK5), which
activates extracellular signal-regulated kinase 5
(ERK5). The ERK5 cascade plays roles in promoting cell
proliferation, differentiation, neuronal survival, and
neuroprotection. MEKK3 plays an essential role in
embryonic angiogenesis and early heart development.
MEKK2 and MEKK3 can also activate the MAPKs, c-Jun
N-terminal kinase (JNK) and p38, through their
respective MAPKKs.
Length = 263
Score = 49.4 bits (118), Expect = 8e-09
Identities = 21/64 (32%), Positives = 31/64 (48%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ +++H I+ Y + E + + MEY GG + D L LTE R+ RQI V
Sbjct: 58 LKNLQHERIVQYYGCLRDDETLSIFMEYMPGGSVKDQLKAYGALTETVTRKYTRQILEGV 117
Query: 61 YYCH 64
Y H
Sbjct: 118 EYLH 121
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain.
Phosphotransferases. Tyrosine-specific kinase subfamily.
Length = 257
Score = 49.1 bits (118), Expect = 9e-09
Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL-DQKKVLTEEEARRIFRQIA 57
M + HPN++ + V E + +VMEY GG+L +L + L+ + QIA
Sbjct: 55 MRKLDHPNVVKLLGVCTEEEPLYIVMEYMEGGDLLSYLRKNRPKLSLSDLLSFALQIA 112
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein
Serine/Threonine Kinase, MAP/ERK kinase kinase 4.
Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4
(MEKK4) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MEKK4 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MEKK4 is a mitogen-activated protein kinase
(MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
phosphorylates and activates MAPK kinases (MAPKKs or
MKKs or MAP2Ks), which in turn phosphorylate and
activate MAPKs during signaling cascades that are
important in mediating cellular responses to
extracellular signals. MEKK4 activates the c-Jun
N-terminal kinase (JNK) and p38 MAPK signaling pathways
by directly activating their respective MAPKKs,
MKK4/MKK7 and MKK3/MKK6. JNK and p38 are collectively
known as stress-activated MAPKs, as they are activated
in response to a variety of environmental stresses and
pro-inflammatory cytokines. MEKK4 also plays roles in
the re-polarization of the actin cytoskeleton in
response to osmotic stress, in the proper closure of the
neural tube, in cardiovascular development, and in
immune responses.
Length = 264
Score = 48.5 bits (116), Expect = 1e-08
Identities = 21/65 (32%), Positives = 36/65 (55%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ ++HPN++ Y V +REK+ + MEY +GG L + L+ ++L E R Q+ +
Sbjct: 53 LELLKHPNLVKYYGVEVHREKVYIFMEYCSGGTLEELLEHGRILDEHVIRVYTLQLLEGL 112
Query: 61 YYCHK 65
Y H
Sbjct: 113 AYLHS 117
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein
Kinase Like Serine/Threonine Kinases. Serine/Threonine
Kinases (STKs), Cyclin-dependent protein kinase like
(CDKL) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
CDKL subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. This subfamily is
composed of CDKL1-5 and similar proteins. Some CDKLs,
like CDKL1 and CDKL3, may be implicated in
transformation and others, like CDKL3 and CDKL5, are
associated with mental retardation when impaired. CDKL2
plays a role in learning and memory.
Length = 288
Score = 48.5 bits (116), Expect = 2e-08
Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 2/64 (3%)
Query: 3 SVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLD-QKKVLTEEEARRIFRQIATAVY 61
+RH NI+++ E F + ++ LV EY L + L+ L + R Q+ A+
Sbjct: 56 QLRHENIVNLKEAFRRKGRLYLVFEY-VERTLLELLEASPGGLPPDAVRSYIWQLLQAIA 114
Query: 62 YCHK 65
YCH
Sbjct: 115 YCHS 118
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein
Serine/Threonine Kinase, Yank1. Serine/Threonine
Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Yank1 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. This subfamily
contains uncharacterized STKs with similarity to the
human protein designated Yank1 or STK32A.
Length = 258
Score = 48.1 bits (115), Expect = 2e-08
Identities = 19/64 (29%), Positives = 36/64 (56%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ + HP +++++ F++ E M LV++ GG+L L QK +EE+ + +I A+
Sbjct: 54 LQELNHPFLVNLWYSFQDEENMYLVVDLLLGGDLRYHLSQKVKFSEEQVKFWICEIVLAL 113
Query: 61 YYCH 64
Y H
Sbjct: 114 EYLH 117
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein
Serine/Threonine Kinase, Protein Kinase B alpha.
Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
or Akt subfamily, alpha (or Akt1) isoform, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The PKB subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. There are three
PKB isoforms from different genes, PKB-alpha (or Akt1),
PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
contains an N-terminal pleckstrin homology (PH) domain
and a C-terminal catalytic domain. PKB-alpha is
predominantly expressed in endothelial cells. It is
critical for the regulation of angiogenesis and the
maintenance of vascular integrity. It also plays a role
in adipocyte differentiation. Mice deficient in
PKB-alpha exhibit perinatal morbidity, growth
retardation, reduction in body weight accompanied by
reduced sizes of multiple organs, and enhanced apoptosis
in some cell types. PKB-alpha activity has been reported
to be frequently elevated in breast and prostate
cancers. In some cancer cells, PKB-alpha may act as a
suppressor of metastasis.
Length = 325
Score = 48.5 bits (115), Expect = 2e-08
Identities = 22/64 (34%), Positives = 39/64 (60%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ + RHP + + F+ +++ VMEYA GGEL+ L +++V +E+ AR +I +A+
Sbjct: 49 LQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSAL 108
Query: 61 YYCH 64
Y H
Sbjct: 109 DYLH 112
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases.
Protein Tyrosine Kinase (PTK) family, catalytic domain.
This PTKc family is part of a larger superfamily that
includes the catalytic domains of protein
serine/threonine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase (PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. They can be classified
into receptor and non-receptor tyr kinases. PTKs play
important roles in many cellular processes including,
lymphocyte activation, epithelium growth and
maintenance, metabolism control, organogenesis
regulation, survival, proliferation, differentiation,
migration, adhesion, motility, and morphogenesis.
Receptor tyr kinases (RTKs) are integral membrane
proteins which contain an extracellular ligand-binding
region, a transmembrane segment, and an intracellular
tyr kinase domain. RTKs are usually activated through
ligand binding, which causes dimerization and
autophosphorylation of the intracellular tyr kinase
catalytic domain, leading to intracellular signaling.
Some RTKs are orphan receptors with no known ligands.
Non-receptor (or cytoplasmic) tyr kinases are
distributed in different intracellular compartments and
are usually multi-domain proteins containing a catalytic
tyr kinase domain as well as various regulatory domains
such as SH3 and SH2. PTKs are usually autoinhibited and
require a mechanism for activation. In many PTKs, the
phosphorylation of tyr residues in the activation loop
is essential for optimal activity. Aberrant expression
of PTKs is associated with many development
abnormalities and cancers.
Length = 262
Score = 47.9 bits (115), Expect = 2e-08
Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 9/76 (11%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL---------DQKKVLTEEEARR 51
M + HPN++ + V E + LV+EY GG+L D+L +K L+ ++
Sbjct: 50 MKKLGHPNVVRLLGVCTEEEPLYLVLEYMEGGDLLDYLRKSRPVFPSPEKSTLSLKDLLS 109
Query: 52 IFRQIATAVYYCHKVQ 67
QIA + Y +
Sbjct: 110 FAIQIAKGMEYLASKK 125
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein
Serine/Threonine Kinase, Phosphoinositide-dependent
kinase 1. Serine/Threonine Kinases (STKs),
Phosphoinositide-dependent kinase 1 (PDK1) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The PDK1 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase (PI3K). PDK1
carries an N-terminal catalytic domain and a C-terminal
pleckstrin homology (PH) domain that binds
phosphoinositides. It phosphorylates the activation loop
of AGC kinases that are regulated by PI3K such as PKB,
SGK, and PKC, among others, and is crucial for their
activation. Thus, it contributes in regulating many
processes including metabolism, growth, proliferation,
and survival. PDK1 also has the ability to
autophosphorylate and is constitutively active in
mammalian cells. PDK1 is essential for normal embryo
development and is important in regulating cell volume.
Length = 280
Score = 48.0 bits (115), Expect = 2e-08
Identities = 21/60 (35%), Positives = 32/60 (53%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCH 64
HP II +Y F++ E + V+EYA GEL ++ + L E+ R +I A+ Y H
Sbjct: 60 GHPGIIKLYYTFQDEENLYFVLEYAPNGELLQYIRKYGSLDEKCTRFYAAEILLALEYLH 119
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine
Kinase, Protein Kinase B. Serine/Threonine Kinases
(STKs), Protein Kinase B (PKB) or Akt subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The PKB subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase (PI3K). There are
three PKB isoforms from different genes, PKB-alpha (or
Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
contains an N-terminal pleckstrin homology (PH) domain
and a C-terminal catalytic domain. It is activated
downstream of PI3K and plays important roles in diverse
cellular functions including cell survival, growth,
proliferation, angiogenesis, motility, and migration.
PKB also has a central role in a variety of human
cancers, having been implicated in tumor initiation,
progression, and metastasis.
Length = 323
Score = 47.9 bits (114), Expect = 2e-08
Identities = 22/65 (33%), Positives = 39/65 (60%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ + RHP + + F+ +++ VMEYA GGEL+ L +++V +E+ AR +I +A+
Sbjct: 49 LQNTRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSAL 108
Query: 61 YYCHK 65
Y H
Sbjct: 109 GYLHS 113
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein
Serine/Threonine Kinase, Serum- and
Glucocorticoid-induced Kinase 2. Serine/Threonine
Kinases (STKs), Serum- and Glucocorticoid-induced Kinase
(SGK) subfamily, SGK2 isoform, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The SGK subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. There are three isoforms of
SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more
restricted distribution that SGK1 and is most abundantly
expressed in epithelial tissues including kidney, liver,
pancreas, and the choroid plexus of the brain. In vitro
cellular assays show that SGK2 can stimulate the
activity of ion channels, the glutamate transporter
EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Length = 321
Score = 48.0 bits (114), Expect = 2e-08
Identities = 19/64 (29%), Positives = 39/64 (60%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ +++HP ++ ++ F+ EK+ V++Y GGEL+ L +++ E AR ++A+A+
Sbjct: 50 LKNLKHPFLVGLHYSFQTAEKLYFVLDYVNGGELFFHLQRERCFLEPRARFYAAEVASAI 109
Query: 61 YYCH 64
Y H
Sbjct: 110 GYLH 113
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine
Kinase, Serum- and Glucocorticoid-induced Kinase.
Serine/Threonine Kinases (STKs), Serum- and
Glucocorticoid-induced Kinase (SGK) subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The SGK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. There are three
isoforms of SGK, named SGK1, SGK2, and SGK3 (also called
cytokine-independent survival kinase CISK). SGKs are
activated by insulin and growth factors via
phosphoinositide 3-kinase and PDK1. They activate ion
channels, ion carriers, and the Na-K-ATPase, as well as
regulate the activity of enzymes and transcription
factors. SGKs play important roles in transport, hormone
release, neuroexcitability, cell proliferation, and
apoptosis.
Length = 323
Score = 47.5 bits (113), Expect = 4e-08
Identities = 20/67 (29%), Positives = 40/67 (59%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ +V+HP ++ ++ F+ +K+ V++Y GGEL+ L +++ E AR +IA+A+
Sbjct: 50 LKNVKHPFLVGLHYSFQTADKLYFVLDYVNGGELFFHLQRERSFPEPRARFYAAEIASAL 109
Query: 61 YYCHKVQ 67
Y H +
Sbjct: 110 GYLHSLN 116
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like
Protein Serine/Threonine Kinases. Serine/threonine
kinases (STKs), Ste20-like kinase (SLK)-like subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The SLK-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Members of the subfamily include SLK, STK10
(also called LOK for lymphocyte-oriented kinase), SmSLK
(Schistosoma mansoni SLK), and related proteins. SLK
promotes apoptosis through apoptosis signal-regulating
kinase 1 (ASK1) and the mitogen-activated protein kinase
(MAPK) p38. It also plays a role in mediating actin
reorganization. STK10 is responsible in regulating the
CD28 responsive element in T cells, as well as leukocyte
function associated antigen (LFA-1)-mediated lymphocyte
adhesion. SmSLK is capable of activating the MAPK Jun
N-terminal kinase (JNK) pathway in human embryonic
kidney (HEK) cells as well as in Xenopus oocytes. It may
participate in regulating MAPK cascades during
host-parasite interactions.
Length = 280
Score = 47.4 bits (113), Expect = 4e-08
Identities = 20/65 (30%), Positives = 39/65 (60%), Gaps = 1/65 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQ-KKVLTEEEARRIFRQIATA 59
+S +HPNI+ +YE + K+ +++E+ GG L + + ++ LTE + R + RQ+ A
Sbjct: 56 LSECKHPNIVGLYEAYFYENKLWILIEFCDGGALDSIMLELERGLTEPQIRYVCRQMLEA 115
Query: 60 VYYCH 64
+ + H
Sbjct: 116 LNFLH 120
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity.
Phosphotransferases. The specificity of this class of
kinases can not be predicted. Possible dual-specificity
Ser/Thr/Tyr kinase.
Length = 258
Score = 47.2 bits (113), Expect = 4e-08
Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 2/59 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL--DQKKVLTEEEARRIFRQIA 57
M + HPNI+ + V E +++VMEY GG+L D+L ++ K L+ + QIA
Sbjct: 55 MRKLDHPNIVKLLGVCTEEEPLMIVMEYMPGGDLLDYLRKNRPKELSLSDLLSFALQIA 113
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein
Serine/Threonine Kinase, Protein Kinase B gamma.
Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
or Akt subfamily, gamma (or Akt3) isoform, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The PKB subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. There are three
PKB isoforms from different genes, PKB-alpha (or Akt1),
PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
contains an N-terminal pleckstrin homology (PH) domain
and a C-terminal catalytic domain. PKB-gamma is
predominantly expressed in neuronal tissues. Mice
deficient in PKB-gamma show a reduction in brain weight
due to the decreases in cell size and cell number.
PKB-gamma has also been shown to be upregulated in
estrogen-deficient breast cancer cells,
androgen-independent prostate cancer cells, and primary
ovarian tumors. It acts as a key mediator in the genesis
of ovarian cancer.
Length = 328
Score = 47.4 bits (112), Expect = 5e-08
Identities = 20/64 (31%), Positives = 38/64 (59%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ + RHP + + F+ ++++ VMEY GGEL+ L +++V +E+ R +I +A+
Sbjct: 49 LKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSAL 108
Query: 61 YYCH 64
Y H
Sbjct: 109 DYLH 112
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein
Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2
and similar domains. Serine/Threonine Kinases (STKs),
Chlamydomonas reinhardtii FA2-like subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Chlamydomonas
reinhardtii FA2-like subfamily belongs to the
(NIMA)-related kinase (Nek) family. The Nek family
includes seven different Chlamydomonas Neks (CNKs 1-6
and Fa2). This subfamily includes FA2 and CNK4. The Nek
family is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Chlamydomonas reinhardtii FA2 was discovered
in a genetic screen for deflagellation-defective
mutants. It is essential for
basal-body/centriole-associated microtubule severing,
and plays a role in cell cycle progression. No cellular
function has yet been ascribed to CNK4.
Length = 256
Score = 46.7 bits (111), Expect = 6e-08
Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 2/67 (2%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLD--QKKVLTEEEARRIFRQIAT 58
++ + II YE F ++ K+ +VMEYA G+L+ L + + L E++ R F QI
Sbjct: 53 LAKLDSSYIIRYYESFLDKGKLNIVMEYAENGDLHKLLKMQRGRPLPEDQVWRFFIQILL 112
Query: 59 AVYYCHK 65
+ + H
Sbjct: 113 GLAHLHS 119
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases.
Protein Kinases (PKs), STE family, catalytic (c) domain.
PKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine or tyrosine residues on
protein substrates. The STE family is part of a larger
superfamily that includes the catalytic domains of other
protein serine/threonine kinases (STKs), protein
tyrosine kinases (PTKs), RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase (PI3K). This family is composed of STKs, and
some dual-specificity PKs that phosphorylate both
threonine and tyrosine residues of target proteins. Most
members are kinases involved in mitogen-activated
protein kinase (MAPK) signaling cascades, acting as MAPK
kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK
kinase kinase kinases (MAP4Ks). The MAPK signaling
pathways are important mediators of cellular responses
to extracellular signals. The pathways involve a triple
kinase core cascade comprising of the MAPK, which is
phosphorylated and activated by a MAPKK, which itself is
phosphorylated and activated by a MAPKKK. Each MAPK
cascade is activated either by a small GTP-binding
protein or by an adaptor protein, which transmits the
signal either directly to a MAPKKK to start the triple
kinase core cascade or indirectly through a mediator
kinase, a MAP4K. Other STE family members include
p21-activated kinases (PAKs) and class III myosins,
among others. PAKs are Rho family GTPase-regulated
kinases that serve as important mediators in the
function of Cdc42 (cell division cycle 42) and Rac.
Class III myosins are motor proteins containing an
N-terminal kinase catalytic domain and a C-terminal
actin-binding domain, which can phosphorylate several
cytoskeletal proteins, conventional myosin regulatory
light chains, as well as autophosphorylate the
C-terminal motor domain. They play an important role in
maintaining the structural integrity of photoreceptor
cell microvilli.
Length = 253
Score = 46.4 bits (111), Expect = 8e-08
Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQK-KVLTEEEARRIFRQIATA 59
+ +HPNI+ Y + ++++ +VME+ +GG L D L + LTE + + +++
Sbjct: 51 LKKCKHPNIVKYYGSYLKKDELWIVMEFCSGGSLKDLLKSTNQTLTESQIAYVCKELLKG 110
Query: 60 VYYCHK 65
+ Y H
Sbjct: 111 LEYLHS 116
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine
Kinase, cAMP-dependent protein kinase. Serine/Threonine
Kinases (STKs), cAMP-dependent protein kinase (PKA)
subfamily, catalytic (c) subunit. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The PKA
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase (PI3K). This subfamily is composed of the
cAMP-dependent proteins kinases, PKA and PRKX. The
inactive PKA holoenzyme is a heterotetramer composed of
two phosphorylated and active catalytic (C) subunits
with a dimer of regulatory (R) subunits. Activation is
achieved through the binding of the important second
messenger cAMP to the R subunits, which leads to the
dissociation of PKA into the R dimer and two active C
subunits. PKA is present ubiquitously in cells and
interacts with many different downstream targets. It
plays a role in the regulation of diverse processes such
as growth, development, memory, metabolism, gene
expression, immunity, and lipolysis.
Length = 290
Score = 46.4 bits (111), Expect = 8e-08
Identities = 23/64 (35%), Positives = 36/64 (56%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ S+RHP ++++Y F++ + LVMEY GGEL+ L + E AR Q+ A+
Sbjct: 55 LQSIRHPFLVNLYGSFQDDSNLYLVMEYVPGGELFSHLRKSGRFPEPVARFYAAQVVLAL 114
Query: 61 YYCH 64
Y H
Sbjct: 115 EYLH 118
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein
Serine/Threonine Kinases, Oxidative stress response
kinase and Ste20-related proline alanine-rich kinase.
Serine/threonine kinases (STKs), oxidative stress
response kinase (OSR1) and Ste20-related proline
alanine-rich kinase (SPAK) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The OSR1 and SPAK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. SPAK is also referred to as STK39 or PASK
(proline-alanine-rich STE20-related kinase). OSR1 and
SPAK regulate the activity of cation-chloride
cotransporters through direct interaction and
phosphorylation. They are also implicated in
cytoskeletal rearrangement, cell differentiation,
transformation and proliferation. OSR1 and SPAK contain
a conserved C-terminal (CCT) domain, which recognizes a
unique motif ([RK]FX[VI]) present in their activating
kinases (WNK1/WNK4) and their substrates.
Length = 267
Score = 45.8 bits (109), Expect = 1e-07
Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQK---KVLTEEEARRIFRQIA 57
MS HPN++ Y F +++ LVM Y +GG L D + L E + +++
Sbjct: 53 MSQCNHPNVVKYYTSFVVGDELWLVMPYLSGGSLLDIMKSSYPRGGLDEAIIATVLKEVL 112
Query: 58 TAVYYCHK 65
+ Y H
Sbjct: 113 KGLEYLHS 120
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein
Serine/Threonine Kinase, Serum- and
Glucocorticoid-induced Kinase 3. Serine/Threonine
Kinases (STKs), Serum- and Glucocorticoid-induced Kinase
(SGK) subfamily, SGK3 isoform, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The SGK subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. There are three isoforms of
SGK, named SGK1, SGK2, and SGK3 (also called
cytokine-independent survival kinase CISK). SGK3 is
expressed in most tissues and is most abundant in the
embryo and adult heart and spleen. It was originally
discovered in a screen for antiapoptotic genes. It
phosphorylates and inhibits the proapoptotic proteins,
Bad and FKHRL1. SGK3 also regulates many transporters,
ion channels, and receptors. It plays a critical role in
hair follicle morphogenesis and hair cycling.
Length = 325
Score = 45.8 bits (108), Expect = 1e-07
Identities = 20/67 (29%), Positives = 40/67 (59%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ +V+HP ++ ++ F+ EK+ V+++ GGEL+ L +++ E AR +IA+A+
Sbjct: 50 LKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEPRARFYAAEIASAL 109
Query: 61 YYCHKVQ 67
Y H +
Sbjct: 110 GYLHSIN 116
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 1. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek1 subfamily is
one of a family of 11 different Neks (Nek1-11) that are
involved in cell cycle control. The Nek family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Nek1 is
associated with centrosomes throughout the cell cycle.
It is involved in the formation of primary cilium and in
the maintenance of centrosomes. It cycles through the
nucleus and may be capable of relaying signals between
the cilium and the nucleus. Nek1 is implicated in the
development of polycystic kidney disease, which is
characterized by benign polycystic tumors formed by
abnormal overgrowth of renal epithelial cells. It
appears also to be involved in DNA damage response, and
may be important for both correct DNA damage checkpoint
activation and DNA repair.
Length = 256
Score = 45.2 bits (107), Expect = 2e-07
Identities = 21/66 (31%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKK--VLTEEEARRIFRQIAT 58
+S+++HPNI+ E FE + +VM+Y GG+LY ++ ++ + E++ F QI
Sbjct: 53 LSNMKHPNIVQYQESFEENGNLYIVMDYCEGGDLYKKINAQRGVLFPEDQILDWFVQICL 112
Query: 59 AVYYCH 64
A+ + H
Sbjct: 113 ALKHVH 118
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein
Serine/Threonine Kinase, Serum- and
Glucocorticoid-induced Kinase 1. Serine/Threonine
Kinases (STKs), Serum- and Glucocorticoid-induced Kinase
(SGK) subfamily, SGK1 isoform, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The SGK subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. There are three isoforms of
SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously
expressed and is under transcriptional control of
numerous stimuli including cell stress (cell shrinkage),
serum, hormones (gluco- and mineralocorticoids),
gonadotropins, growth factors, interleukin-6, and other
cytokines. It plays roles in sodium retention and
potassium elimination in the kidney, nutrient transport,
salt sensitivity, memory consolidation, and cardiac
repolarization. A common SGK1 variant is associated with
increased blood pressure and body weight. SGK1 may also
contribute to tumor growth, neurodegeneration, fibrosing
disease, and ischemia.
Length = 325
Score = 45.4 bits (107), Expect = 2e-07
Identities = 20/66 (30%), Positives = 40/66 (60%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ +V+HP ++ ++ F+ +K+ V++Y GGEL+ L +++ E AR +IA+A+
Sbjct: 50 LKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASAL 109
Query: 61 YYCHKV 66
Y H +
Sbjct: 110 GYLHSL 115
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine
Kinases, Cyclin-Dependent protein Kinase Like 1 and 4.
Serine/Threonine Kinases (STKs), Cyclin-dependent
protein kinase like 1 (CDKL1) and CDKL4 subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDKL1 and CDKL4
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. CDKL1, also called
p42 KKIALRE, is a glial protein that is upregulated in
gliosis. It is present in neuroblastoma and A431 human
carcinoma cells, and may be implicated in neoplastic
transformation. The function of CDKL4 is unknown.
Length = 286
Score = 44.7 bits (106), Expect = 4e-07
Identities = 20/63 (31%), Positives = 34/63 (53%)
Query: 3 SVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYY 62
++HPN++++ EVF + K+ LV EY L + + + E ++I Q AV +
Sbjct: 56 QLKHPNLVNLIEVFRRKRKLHLVFEYCDHTVLNELEKNPRGVPEHLIKKIIWQTLQAVNF 115
Query: 63 CHK 65
CHK
Sbjct: 116 CHK 118
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein
Serine/Threonine Kinase, Mitogen-activated protein
kinase kinase kinase kinase 3. Serine/threonine kinases
(STKs), mitogen-activated protein kinase (MAPK) kinase
kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MAP4K3 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Members of this
subfamily contain an N-terminal catalytic domain and a
C-terminal citron homology (CNH) regulatory domain,
similar to MAP4K4/6. MAP4Ks are involved in some MAPK
signaling pathways that are important in mediating
cellular responses to extracellular signals by
activating a MAPK kinase kinase (MAPKKK or MAP3K or
MKKK). Each MAPK cascade is activated either by a small
GTP-binding protein or by an adaptor protein, which
transmits the signal either directly to a MAP3K to start
the triple kinase core cascade or indirectly through a
mediator kinase, a MAP4K. MAP4K3 plays a role in the
nutrient-responsive pathway of mTOR (mammalian target of
rapamycin) signaling. MAP4K3 is required in the
activation of S6 kinase by amino acids and for the
phosphorylation of the mTOR-regulated inhibitor of
eukaryotic initiation factor 4E. mTOR regulates ribosome
biogenesis and protein translation, and is frequently
deregulated in cancer.
Length = 267
Score = 44.3 bits (104), Expect = 4e-07
Identities = 18/64 (28%), Positives = 31/64 (48%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
M +H NI+ + + R+K+ + ME+ GG L D L+E + + R+ +
Sbjct: 60 MKDCKHSNIVAYFGSYLRRDKLWICMEFCGGGSLQDIYHVTGPLSESQIAYVSRETLQGL 119
Query: 61 YYCH 64
YY H
Sbjct: 120 YYLH 123
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family
Serine/Threonine Kinases. Serine/Threonine Kinases
(STKs), CMGC family, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
CMGC family is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. The CMGC family consists of Cyclin-Dependent
protein Kinases (CDKs), Mitogen-activated protein
kinases (MAPKs) such as Extracellular signal-regulated
kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38,
and similar proteins. CDKs belong to a large subfamily
of STKs that are regulated by their cognate cyclins.
Together, they are involved in the control of cell-cycle
progression, transcription, and neuronal function. MAPKs
serve as important mediators of cellular responses to
extracellular signals. They control critical cellular
functions including differentiation, proliferation,
migration, and apoptosis. They are also implicated in
the pathogenesis of many diseases including multiple
types of cancer, stroke, diabetes, and chronic
inflammation.
Length = 283
Score = 44.2 bits (105), Expect = 5e-07
Identities = 17/66 (25%), Positives = 34/66 (51%), Gaps = 2/66 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLD-QKKVLTEEEARRIFRQIATA 59
+ + HPNII + +VF ++ + LV E+ +LY + +++ L E + Q+
Sbjct: 52 LKELNHPNIIKLLDVFRHKGDLYLVFEFMD-TDLYKLIKDRQRGLPESLIKSYLYQLLQG 110
Query: 60 VYYCHK 65
+ +CH
Sbjct: 111 LAFCHS 116
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent
protein Kinase 9-like Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase 9 (CDK9)-like subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK9-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. This subfamily is
composed of CDK9 and CDK12 from higher eukaryotes, yeast
BUR1, C-type plant CDKs (CdkC), and similar proteins.
CDK9, BUR1, and CdkC are functionally equivalent. They
act as a kinase for the C-terminal domain of RNA
polymerase II and participate in regulating mutliple
steps of gene expression including transcription
elongation and RNA processing. CDK9 and CdkC associate
with T-type cyclins while BUR1 associates with the
cyclin BUR2. CDK12 is a unique CDK that contains an
arginine/serine-rich (RS) domain, which is predominantly
found in splicing factors. CDK12 interacts with cyclins
L1 and L2, and participates in regulating transcription
and alternative splicing.
Length = 287
Score = 44.1 bits (105), Expect = 6e-07
Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 10/68 (14%)
Query: 3 SVRHPNIIHIYEVFENREK--MVLVMEYAAGGELYDF---LDQKKV-LTEEEARRIFRQI 56
+RHPNI+ + E+ ++ K + +V EY +D LD +V TE + + +Q+
Sbjct: 54 KLRHPNIVRLKEIVTSKGKGSIYMVFEYMD----HDLTGLLDSPEVKFTESQIKCYMKQL 109
Query: 57 ATAVYYCH 64
+ Y H
Sbjct: 110 LEGLQYLH 117
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 10. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 10 (Nek10)
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
Nek10 subfamily is one of a family of 11 different Neks
(Nek1-11) that are involved in cell cycle control. The
Nek family is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. No function has yet been ascribed to Nek10.
The gene encoding Nek10 is a putative causative gene for
breast cancer; it is located within a breast cancer
susceptibility loci on chromosome 3p24.
Length = 269
Score = 44.0 bits (104), Expect = 7e-07
Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 4/66 (6%)
Query: 4 VRHPNIIHIYEVFENREKMVLVMEYAAG---GELYDFLDQKK-VLTEEEARRIFRQIATA 59
+RHPNI+ Y+ F +++ +VM+ G GE ++ L +KK TEE IF Q+ A
Sbjct: 66 LRHPNIVRYYKTFLENDRLYIVMDLIEGAPLGEHFNSLKEKKQRFTEERIWNIFVQMVLA 125
Query: 60 VYYCHK 65
+ Y HK
Sbjct: 126 LRYLHK 131
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 3. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek3 subfamily is
one of a family of 11 different Neks (Nek1-11) that are
involved in cell cycle control. The Nek family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Nek3 is primarily
localized in the cytoplasm and shows no cell
cycle-dependent changes in its activity. It is present
in the axons of neurons and affects morphogenesis and
polarity through its regulation of microtubule
acetylation. Nek3 modulates the signaling of the
prolactin receptor through its activation of Vav2 and
contributes to prolactin-mediated motility of breast
cancer cells.
Length = 255
Score = 43.8 bits (103), Expect = 7e-07
Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 2/67 (2%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQK--KVLTEEEARRIFRQIAT 58
++ ++HPNI+ E FE + +VMEY GG+L + + K+ E+ + F Q+
Sbjct: 52 LAKMKHPNIVAFKESFEADGHLYIVMEYCDGGDLMQKIKLQRGKLFPEDTILQWFVQMCL 111
Query: 59 AVYYCHK 65
V + H+
Sbjct: 112 GVQHIHE 118
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 4. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek4 subfamily is
one of a family of 11 different Neks (Nek1-11). The Nek
family is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Neks are involved in the regulation of
downstream processes following the activation of Cdc2,
and many of their functions are cell cycle-related. They
play critical roles in microtubule dynamics during
ciliogenesis and mitosis. Nek4 is highly abundant in the
testis. Its specific function is unknown.
Length = 257
Score = 43.4 bits (102), Expect = 1e-06
Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
Query: 1 MSSVRHPNIIHIYEVFENREKMV-LVMEYAAGGELYDFLDQKK--VLTEEEARRIFRQIA 57
+S ++HPNI+ E +E + ++ +VM + GG+LY L ++K +L E + F QIA
Sbjct: 53 LSQLKHPNIVAYRESWEGEDGLLYIVMGFCEGGDLYHKLKEQKGKLLPENQVVEWFVQIA 112
Query: 58 TAVYYCHK 65
A+ Y H+
Sbjct: 113 MALQYLHE 120
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine
Kinase, Protein Kinase C. Serine/Threonine Kinases
(STKs), Protein Kinase C (PKC) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The PKC subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PKCs are
classified into three groups (classical, atypical, and
novel) depending on their mode of activation and the
structural characteristics of their regulatory domain.
PKCs undergo three phosphorylations in order to take
mature forms. In addition, classical PKCs depend on
calcium, DAG (1,2-diacylglycerol), and in most cases,
phosphatidylserine (PS) for activation. Novel PKCs are
calcium-independent, but require DAG and PS for
activity, while atypical PKCs only require PS. PKCs
phosphorylate and modify the activities of a wide
variety of cellular proteins including receptors,
enzymes, cytoskeletal proteins, transcription factors,
and other kinases. They play a central role in signal
transduction pathways that regulate cell migration and
polarity, proliferation, differentiation, and apoptosis.
Also included in this subfamily are the PKC-like
proteins, called PKNs.
Length = 318
Score = 43.1 bits (102), Expect = 1e-06
Identities = 15/61 (24%), Positives = 31/61 (50%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCH 64
+HP + ++ F+ ++++ VMEY GG+L + + E AR +I + + H
Sbjct: 54 KHPFLTQLHSCFQTKDRLFFVMEYVNGGDLMFHIQRSGRFDEPRARFYAAEIVLGLQFLH 113
Query: 65 K 65
+
Sbjct: 114 E 114
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein
Serine/Threonine Kinase, cGMP-dependent protein kinase.
Serine/Threonine Kinases (STKs), cGMP-dependent protein
kinase (cGK or PKG) subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The cGK subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. Mammals have two cGK isoforms
from different genes, cGKI and cGKII. cGKI exists as two
splice variants, cGKI-alpha and cGKI-beta. cGK consists
of an N-terminal regulatory domain containing a
dimerization and an autoinhibitory pseudosubstrate
region, two cGMP-binding domains, and a C-terminal
catalytic domain. Binding of cGMP to both binding sites
releases the inhibition of the catalytic center by the
pseudosubstrate region, allowing autophosphorylation and
activation of the kinase. cGKI is a soluble protein
expressed in all smooth muscles, platelets, cerebellum,
and kidney. It is also expressed at lower concentrations
in other tissues. cGKII is a membrane-bound protein that
is most abundantly expressed in the intestine. It is
also present in the brain nuclei, adrenal cortex,
kidney, lung, and prostate. cGKI is involved in the
regulation of smooth muscle tone, smooth cell
proliferation, and platelet activation. cGKII plays a
role in the regulation of secretion, such as renin
secretion by the kidney and aldosterone secretion by the
adrenal. It also regulates bone growth and the circadian
rhythm.
Length = 262
Score = 42.6 bits (101), Expect = 2e-06
Identities = 19/64 (29%), Positives = 33/64 (51%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ HP I+ +Y F++++ + ++MEY GGEL+ L + + E AR + A
Sbjct: 47 LEECNHPFIVKLYRTFKDKKYIYMLMEYCLGGELWTILRDRGLFDEYTARFYIACVVLAF 106
Query: 61 YYCH 64
Y H
Sbjct: 107 EYLH 110
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant
dual-specificity MAP kinase kinases and similar
proteins. Protein kinases (PKs), MAP kinase kinase
(MAPKK) subfamily, Plant MAPKKs and similar proteins,
catalytic (c) domain. PKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine or
tyrosine residues on protein substrates. The MAPKK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein serine/threonine
kinases, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. The mitogen-activated protein
(MAP) kinase signaling pathways are important mediators
of cellular responses to extracellular signals. The
pathways involve a triple kinase core cascade comprising
of the MAP kinase (MAPK), which is phosphorylated and
activated by a MAPK kinase (MAPKK or MKK), which itself
is phosphorylated and activated by a MAPK kinase kinase
(MAPKKK or MKKK). Members of this group include MAPKKs
from plants, kinetoplastids, alveolates, and mycetozoa.
The MAPKK, LmxPK4, from Leishmania mexicana, is
important in differentiation and virulence.
Dictyostelium discoideum MEK1 is required for proper
chemotaxis. MEK1 null mutants display severe defects in
cell polarization and directional movement. Plants
contain multiple MAPKKs like other eukaryotes. The
Arabidopsis genome encodes for 10 MAPKKs while poplar
and rice contain 13 MAPKKs each. The functions of these
proteins have not been fully elucidated. There is
evidence to suggest that MAPK cascades are involved in
plant stress responses. In Arabidopsis, MKK3 plays a
role in pathogen signaling, MKK2 is involved in cold and
salt stress signaling, MKK4/MKK5 participates in innate
immunity, and MKK7 regulates basal and systemic acquired
resistance.
Length = 264
Score = 42.2 bits (100), Expect = 2e-06
Identities = 19/64 (29%), Positives = 28/64 (43%)
Query: 3 SVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYY 62
S P ++ Y F ++ +V+EY GG L D L + + E I RQI + Y
Sbjct: 55 SCESPYVVKCYGAFYKEGEISIVLEYMDGGSLADLLKKVGKIPEPVLAYIARQILKGLDY 114
Query: 63 CHKV 66
H
Sbjct: 115 LHTK 118
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein
Serine/Threonine Kinase, 70 kDa ribosomal protein S6
kinase. Serine/Threonine Kinases (STKs), 70 kDa
ribosomal protein S6 kinase (p70S6K) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The p70S6K subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. p70S6K (or S6K)
contains only one catalytic kinase domain, unlike p90
ribosomal S6 kinases (RSKs). It acts as a downstream
effector of the STK mTOR (mammalian Target of Rapamycin)
and plays a role in the regulation of the translation
machinery during protein synthesis. p70S6K also plays a
pivotal role in regulating cell size and glucose
homeostasis. Its targets include S6, the translation
initiation factor eIF3, and the insulin receptor
substrate IRS-1, among others. Mammals contain two
isoforms of p70S6K, named S6K1 and S6K2 (or S6K-beta).
Length = 323
Score = 42.1 bits (99), Expect = 2e-06
Identities = 19/65 (29%), Positives = 40/65 (61%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ +V+HP I+ + F+ K+ L++EY +GGEL+ L+++ + E+ A +I+ A+
Sbjct: 54 LEAVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMHLEREGIFMEDTACFYLSEISLAL 113
Query: 61 YYCHK 65
+ H+
Sbjct: 114 EHLHQ 118
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated
protein kinase kinase kinase kinase-like Protein
Serine/Threonine Kinases. Serine/threonine kinases
(STKs), mitogen-activated protein kinase (MAPK) kinase
kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MAP4K3-like
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. This subfamily includes MAP4K3, MAP4K1,
MAP4K2, MAP4K5, and related proteins. Vertebrate members
contain an N-terminal catalytic domain and a C-terminal
citron homology (CNH) regulatory domain, similar to
MAP4K4/6. MAP4Ks are involved in some MAPK signaling
pathways that are important in mediating cellular
responses to extracellular signals by activating a MAPK
kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK
cascade is activated either by a small GTP-binding
protein or by an adaptor protein, which transmits the
signal either directly to a MAP3K to start the triple
kinase core cascade or indirectly through a mediator
kinase, a MAP4K. MAP4K1, also called haematopoietic
progenitor kinase 1 (HPK1), is a hematopoietic-specific
STK involved in many cellular signaling cascades
including MAPK, antigen receptor, apoptosis, growth
factor, and cytokine signaling. It participates in the
regulation of T cell receptor signaling and T
cell-mediated immune responses. MAP4K2 was referred to
as germinal center (GC) kinase because of its preferred
location in GC B cells. MAP4K3 plays a role in the
nutrient-responsive pathway of mTOR (mammalian target of
rapamycin) signaling. It is required in the activation
of S6 kinase by amino acids and for the phosphorylation
of the mTOR-regulated inhibitor of eukaryotic initiation
factor 4E. MAP4K5, also called germinal center
kinase-related enzyme (GCKR), has been shown to activate
the MAPK c-Jun N-terminal kinase (JNK).
Length = 262
Score = 41.9 bits (99), Expect = 3e-06
Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQ-KKVLTEEEARRIFRQIATA 59
+ RHPNI+ + + R+K+ +VMEY GG L D + L+E + + R+
Sbjct: 54 LKECRHPNIVAYFGSYLRRDKLWIVMEYCGGGSLQDIYQVTRGPLSELQIAYVCRETLKG 113
Query: 60 VYYCH 64
+ Y H
Sbjct: 114 LAYLH 118
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein
Serine/Threonine Kinase, Mitogen and stress-activated
kinase. Serine/Threonine Kinases (STKs), Mitogen and
stress-activated kinase (MSK) subfamily, N-terminal
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MSK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. MSKs contain an
N-terminal kinase domain (NTD) from the AGC family and a
C-terminal kinase domain (CTD) from the CAMK family,
similar to 90 kDa ribosomal protein S6 kinases (RSKs).
MSKs are activated by two major signaling cascades, the
Ras-MAPK and p38 stress kinase pathways, in response to
various stimuli such as growth factors, hormones,
neurotransmitters, cellular stress, and pro-inflammatory
cytokines. This triggers phosphorylation in the
activation loop (A-loop) of the CTD of MSK. The active
CTD phosphorylates the hydrophobic motif (HM) in the
C-terminal extension of NTD, which facilitates the
phosphorylation of the A-loop and activates the NTD,
which in turn phosphorylates downstream targets. MSKs
are predominantly nuclear proteins. They are widely
expressed in many tissues including heart, brain, lung,
liver, kidney, and pancreas. There are two isoforms of
MSK, called MSK1 and MSK2.
Length = 288
Score = 41.7 bits (98), Expect = 3e-06
Identities = 19/61 (31%), Positives = 35/61 (57%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCH 64
R P ++ ++ F+ K+ L+++Y GGEL+ L Q++ TE E R +I A+ + H
Sbjct: 63 RCPFLVTLHYAFQTDTKLHLILDYVNGGELFTHLYQREHFTESEVRVYIAEIVLALDHLH 122
Query: 65 K 65
+
Sbjct: 123 Q 123
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase
kinase 3-like Protein Serine/Threonine Kinases.
Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
(MEKK3)-like subfamily, catalytic (c) domain,
functionally uncharacterized subgroup 1. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MEKK3-like subfamily is part of a larger superfamily
that includes the catalytic domains of other protein
STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. The MEKK3-like subfamily is
composed of MEKK3, MEKK2, and related proteins, all
containing an N-terminal PB1 domain, which mediates
oligomerization, and a C-terminal catalytic domain.
MEKK2 and MEKK3 are mitogen-activated protein kinase
(MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks),
proteins that phosphorylate and activate MAPK kinases
(MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
and activate MAPKs during signaling cascades that are
important in mediating cellular responses to
extracellular signals. MEKK2 and MEKK3 activate MEK5
(also called MKK5), which activates extracellular
signal-regulated kinase 5 (ERK5). The ERK5 cascade plays
roles in promoting cell proliferation, differentiation,
neuronal survival, and neuroprotection. MEKK3 plays an
essential role in embryonic angiogenesis and early heart
development. MEKK2 and MEKK3 can also activate the
MAPKs, c-Jun N-terminal kinase (JNK) and p38, through
their respective MAPKKs.
Length = 264
Score = 41.9 bits (98), Expect = 3e-06
Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 2/66 (3%)
Query: 1 MSSVRHPNIIHIYEVFENRE--KMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIAT 58
+ ++RH I+ Y + E K+ + +EY GG + D L LTE RR RQI
Sbjct: 58 LKNLRHDRIVQYYGCLRDPEEKKLSIFVEYMPGGSIKDQLKAYGALTENVTRRYTRQILQ 117
Query: 59 AVYYCH 64
V Y H
Sbjct: 118 GVSYLH 123
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein
Serine/Threonine Kinase, Atypical Protein Kinase C iota.
Serine/Threonine Kinases (STKs), Atypical Protein
Kinase C (aPKC) subfamily, iota isoform, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The aPKC subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PKCs are
classified into three groups (classical, atypical, and
novel) depending on their mode of activation and the
structural characteristics of their regulatory domain.
aPKCs only require phosphatidylserine (PS) for
activation. There are two aPKC isoforms, zeta and iota.
PKC-iota is directly implicated in carcinogenesis. It is
critical to oncogenic signaling mediated by Ras and
Bcr-Abl. The PKC-iota gene is the target of
tumor-specific gene amplification in many human cancers,
and has been identified as a human oncogene. In addition
to its role in transformed growth, PKC-iota also
promotes invasion, chemoresistance, and tumor cell
survival. Expression profiling of PKC-iota is a
prognostic marker of poor clinical outcome in several
human cancers. PKC-iota also plays a role in
establishing cell polarity, and has critical embryonic
functions.
Length = 329
Score = 42.0 bits (98), Expect = 3e-06
Identities = 18/60 (30%), Positives = 35/60 (58%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCHK 65
HP ++ ++ F+ ++ V+EY GG+L + +++ L EE AR +I+ A+ Y H+
Sbjct: 55 HPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHE 114
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like
protein kinase 3-like Protein Serine/Threonine Kinases.
Serine/threonine kinases (STKs), mammalian Ste20-like
protein kinase 3 (MST3)-like subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MST3-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. This subfamily is composed of MST3, MST4,
STK25, Schizosaccharomyces pombe Nak1 and Sid1,
Saccharomyces cerevisiae sporulation-specific protein 1
(SPS1), and related proteins. Nak1 is required by
fission yeast for polarizing the tips of actin
cytoskeleton and is involved in cell growth, cell
separation, cell morphology and cell-cycle progression.
Sid1 is a component in the septation initiation network
(SIN) signaling pathway, and plays a role in
cytokinesis. SPS1 plays a role in regulating proteins
required for spore wall formation. MST4 plays a role in
mitogen-activated protein kinase (MAPK) signaling during
cytoskeletal rearrangement, morphogenesis, and
apoptosis. MST3 phosphorylates the STK NDR and may play
a role in cell cycle progression and cell morphology.
STK25 may play a role in the regulation of cell
migration and polarization.
Length = 274
Score = 41.8 bits (99), Expect = 4e-06
Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 1/65 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+S R P I Y F K+ ++MEY GG D L K L E I R++ +
Sbjct: 53 LSQCRSPYITKYYGSFLKGSKLWIIMEYCGGGSCLDLLKPGK-LDETYIAFILREVLLGL 111
Query: 61 YYCHK 65
Y H+
Sbjct: 112 EYLHE 116
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine
Kinase, Tie2. Protein Tyrosine Kinase (PTK) family;
Tie2; catalytic (c) domain. The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. Tie2 is a receptor tyr
kinase (RTK) containing an extracellular region, a
transmembrane segment, and an intracellular catalytic
domain. The extracellular region contains an
immunoglobulin (Ig)-like domain, three epidermal growth
factor (EGF)-like domains, a second Ig-like domain, and
three fibronectin type III repeats. Tie2 is expressed
mainly in endothelial cells and hematopoietic stem
cells. It is also found in a subset of tumor-associated
monocytes and eosinophils. The angiopoietins (Ang-1 to
Ang-4) serve as ligands for Tie2. The binding of Ang-1
to Tie2 leads to receptor autophosphorylation and
activation, promoting cell migration and survival. In
contrast, Ang-2 binding to Tie2 does not result in the
same response, suggesting that Ang-2 may function as an
antagonist. Tie2 signaling plays key regulatory roles in
vascular integrity and quiescence, and in inflammation.
Length = 303
Score = 41.5 bits (97), Expect = 5e-06
Identities = 21/55 (38%), Positives = 31/55 (56%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
HPNII++ E+R + L +EYA G L DFL + +VL + A I A+ +
Sbjct: 67 HPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTL 121
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein
Serine/Threonine Kinase, Group II p21-activated kinase.
Serine/threonine kinases (STKs), p21-activated kinase
(PAK) subfamily, Group II, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The PAK subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PAKs are Rho family GTPase-regulated kinases
that serve as important mediators in the function of
Cdc42 (cell division cycle 42) and Rac. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
Group II PAKs, also called non-conventional PAKs,
include PAK4, PAK5, and PAK6. Group II PAKs contain PBD
(p21-binding domain) and catalytic domains, but lack
other motifs found in group I PAKs, such as an AID
(autoinhibitory domain) and SH3 binding sites. Since
group II PAKs do not contain an obvious AID, they may be
regulated differently from group I PAKs. While group I
PAKs interact with the SH3 containing proteins Nck, Grb2
and PIX, no such binding has been demonstrated for group
II PAKs. Some known substrates of group II PAKs are also
substrates of group I PAKs such as Raf, BAD, LIMK and
GEFH1. Unique group II substrates include MARK/Par-1 and
PDZ-RhoGEF. Group II PAKs play important roles in
filopodia formation, neuron extension, cytoskeletal
organization, and cell survival.
Length = 285
Score = 41.3 bits (97), Expect = 6e-06
Identities = 17/64 (26%), Positives = 34/64 (53%), Gaps = 1/64 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
M +HPNI+ +Y + +++ +VME+ GG L D + + + EE+ + + A+
Sbjct: 70 MRDYQHPNIVEMYSSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIATVCLAVLKAL 128
Query: 61 YYCH 64
+ H
Sbjct: 129 SFLH 132
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and
Dbf2p-like Protein Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), ROCK- and NDR-like
subfamily, fungal Sid2p- and Dbf2p-like proteins,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Sid2p- and
Dbf2p-like group is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. This group contains fungal kinases including
Schizosaccharomyces pombe Sid2p and Saccharomyces
cerevisiae Dbf2p. Group members show similarity to NDR
kinases in that they contain an N-terminal regulatory
(NTR) domain and an insert within the catalytic domain
that contains an auto-inhibitory sequence. Sid2p plays a
crucial role in the septum initiation network (SIN) and
in the initiation of cytokinesis. Dbf2p is important in
regulating the mitotic exit network (MEN) and in
cytokinesis.
Length = 333
Score = 40.9 bits (96), Expect = 8e-06
Identities = 17/65 (26%), Positives = 34/65 (52%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+++ + ++ + F++ E + L MEY GG+ L+ VL+E+ AR ++ AV
Sbjct: 55 LTTTKSEWLVKLLYAFQDDEYLYLAMEYVPGGDFRTLLNNLGVLSEDHARFYMAEMFEAV 114
Query: 61 YYCHK 65
H+
Sbjct: 115 DALHE 119
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein
Serine/Threonine Kinase, Large Tumor Suppressor.
Serine/Threonine Kinases (STKs), Large Tumor Suppressor
(LATS) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
LATS subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. LATS was originally identified in Drosophila
using a screen for genes whose inactivation led to
overproliferation of cells. In tetrapods, there are two
LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in
mice results in the development of various tumors,
including sarcomas and ovarian cancer. LATS functions as
a tumor suppressor and is implicated in cell cycle
regulation.
Length = 376
Score = 40.6 bits (95), Expect = 9e-06
Identities = 14/58 (24%), Positives = 32/58 (55%)
Query: 9 IIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCHKV 66
++ +Y F++++ + VM+Y GG++ L + + E+ AR ++ A+ HK+
Sbjct: 63 VVKLYYSFQDKDNLYFVMDYIPGGDMMSLLIRLGIFEEDLARFYIAELTCAIESVHKM 120
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III
myosin-like Protein Serine/Threonine Kinases.
Serine/threonine kinases (STKs), Class III myosin-like
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
class III myosin-like subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. Class III myosins are motor
proteins with an N-terminal kinase catalytic domain and
a C-terminal actin-binding motor domain. Class III
myosins are present in the photoreceptors of
invertebrates and vertebrates and in the auditory hair
cells of mammals. The kinase domain of myosin III can
phosphorylate several cytoskeletal proteins,
conventional myosin regulatory light chains, and can
autophosphorylate the C-terminal motor domain. Myosin
III may play an important role in maintaining the
structural integrity of photoreceptor cell microvilli.
It may also function as a cargo carrier during
light-dependent translocation, in photoreceptor cells,
of proteins such as transducin and arrestin. The
Drosophila class III myosin, called NinaC (Neither
inactivation nor afterpotential protein C), is critical
in normal adaptation and termination of photoresponse.
Vertebrates contain two isoforms of class III myosin,
IIIA and IIIB. This subfamily also includes mammalian
NIK-like embryo-specific kinase (NESK), Traf2- and
Nck-interacting kinase (TNIK), mitogen-activated protein
kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or
MAP4K4) and MAPKKKK6 (or MAP4K6). MAP4Ks are involved in
some MAPK signaling pathways by activating a MAPK kinase
kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
activated either by a small GTP-binding protein or by an
adaptor protein, which transmits the signal either
directly to a MAP3K to start the triple kinase core
cascade or indirectly through a mediator kinase, a
MAP4K. MAPK signaling cascades are important in
mediating cellular responses to extracellular signals.
Length = 275
Score = 40.3 bits (95), Expect = 1e-05
Identities = 21/70 (30%), Positives = 27/70 (38%), Gaps = 10/70 (14%)
Query: 6 HPNIIHIYEVFENREKMV------LVMEYAAGGELYD----FLDQKKVLTEEEARRIFRQ 55
HPNI Y F + LVME GG + D + K L EE I R+
Sbjct: 62 HPNIATFYGAFIKKNPPGNDDQLWLVMELCGGGSVTDLVKGLRKKGKRLKEEWIAYILRE 121
Query: 56 IATAVYYCHK 65
+ Y H+
Sbjct: 122 TLRGLAYLHE 131
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein
Serine/Threonine Kinases. Serine/Threonine Kinases
(STKs), cAMP-dependent protein kinase (PKA) subfamily,
PRKX-like kinases, catalytic (c) subunit. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The PKA
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Members of this group include human PRKX (X
chromosome-encoded protein kinase), Drosophila DC2, and
similar proteins. PRKX is present in many tissues
including fetal and adult brain, kidney, and lung. The
PRKX gene is located in the Xp22.3 subregion and has a
homolog called PRKY on the Y chromosome. An abnormal
interchange between PRKX aand PRKY leads to the sex
reversal disorder of XX males and XY females. PRKX is
implicated in granulocyte/macrophage lineage
differentiation, renal cell epithelial migration, and
tubular morphogenesis in the developing kidney.
Length = 291
Score = 40.5 bits (95), Expect = 1e-05
Identities = 17/64 (26%), Positives = 30/64 (46%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ V HP II ++ ++ + ++MEY GGEL+ +L + +I A+
Sbjct: 55 LKEVSHPFIIRLFWTEHDQRFLYMLMEYVPGGELFSYLRNSGRFSNSTGLFYASEIVCAL 114
Query: 61 YYCH 64
Y H
Sbjct: 115 EYLH 118
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein
Serine/Threonine Kinases, Novel Protein Kinase C theta
and delta. Serine/Threonine Kinases (STKs), Novel
Protein Kinase C (nPKC), theta and delta-like isoforms,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The nPKC subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PKCs are
classified into three groups (classical, atypical, and
novel) depending on their mode of activation and the
structural characteristics of their regulatory domain.
nPKCs are calcium-independent, but require DAG
(1,2-diacylglycerol) and phosphatidylserine (PS) for
activity. There are four nPKC isoforms, delta, epsilon,
eta, and theta. PKC-theta is selectively expressed in
T-cells and plays an important and non-redundant role in
several aspects of T-cell biology. PKC-delta plays a
role in cell cycle regulation and programmed cell death
in many cell types.
Length = 316
Score = 40.2 bits (94), Expect = 1e-05
Identities = 18/61 (29%), Positives = 29/61 (47%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCH 64
HP + H++ F+ +E + VMEY GG+L + E AR +I + + H
Sbjct: 54 EHPFLTHLFCTFQTKEHLFFVMEYLNGGDLMFHIQSSGRFDEARARFYAAEIICGLQFLH 113
Query: 65 K 65
K
Sbjct: 114 K 114
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine
Kinase, Tie1. Protein Tyrosine Kinase (PTK) family;
Tie1; catalytic (c) domain. The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. Tie1 is a receptor tyr
kinase (RTK) containing an extracellular region, a
transmembrane segment, and an intracellular catalytic
domain. The extracellular region contains an
immunoglobulin (Ig)-like domain, three epidermal growth
factor (EGF)-like domains, a second Ig-like domain, and
three fibronectin type III repeats. Tie receptors are
specifically expressed in endothelial cells and
hematopoietic stem cells. No specific ligand has been
identified for Tie1, although the angiopoietin, Ang-1,
binds to Tie1 through integrins at high concentrations.
In vivo studies of Tie1 show that it is critical in
vascular development.
Length = 297
Score = 40.0 bits (93), Expect = 2e-05
Identities = 19/45 (42%), Positives = 27/45 (60%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEA 49
HPNII++ ENR + + +EYA G L DFL + +VL + A
Sbjct: 61 HHPNIINLLGACENRGYLYIAIEYAPYGNLLDFLRKSRVLETDPA 105
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 5. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek5 subfamily is
one of a family of 11 different Neks (Nek1-11). The Nek
family is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Neks are involved in the regulation of
downstream processes following the activation of Cdc2,
and many of their functions are cell cycle-related. They
play critical roles in microtubule dynamics during
ciliogenesis and mitosis. The specific function of Nek5
is unknown.
Length = 257
Score = 39.9 bits (93), Expect = 2e-05
Identities = 17/66 (25%), Positives = 40/66 (60%), Gaps = 2/66 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKK--VLTEEEARRIFRQIAT 58
++ ++HPNI+ + F+ ++ +VMEY GG+L +++++ + +E++ F QI+
Sbjct: 53 LAKMKHPNIVTFFASFQENGRLFIVMEYCDGGDLMKRINRQRGVLFSEDQILSWFVQISL 112
Query: 59 AVYYCH 64
+ + H
Sbjct: 113 GLKHIH 118
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine
Kinases. Protein Tyrosine Kinase (PTK) family; Tie
subfamily; catalytic (c) domain. The Tie subfamily
consists of Tie1 and Tie2. The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. Tie proteins are
receptor tyr kinases (RTKs) containing an extracellular
region, a transmembrane segment, and an intracellular
catalytic domain. The extracellular region contains an
immunoglobulin (Ig)-like domain, three epidermal growth
factor (EGF)-like domains, a second Ig-like domain, and
three fibronectin type III repeats. Tie receptors are
specifically expressed in endothelial cells and
hematopoietic stem cells. The angiopoietins (Ang-1 to
Ang-4) serve as ligands for Tie2, while no specific
ligand has been identified for Tie1. The binding of
Ang-1 to Tie2 leads to receptor autophosphorylation and
activation, promoting cell migration and survival. In
contrast, Ang-2 binding to Tie2 does not result in the
same response, suggesting that Ang-2 may function as an
antagonist. In vivo studies of Tie1 show that it is
critical in vascular development.
Length = 270
Score = 39.7 bits (92), Expect = 2e-05
Identities = 19/44 (43%), Positives = 27/44 (61%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEA 49
HPNII++ E+R + L +EYA G L DFL + +VL + A
Sbjct: 55 HPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPA 98
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR
kinase-like Protein Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Rho-associated
coiled-coil containing protein kinase (ROCK) and Nuclear
Dbf2-Related (NDR)-like kinase subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The ROCK- and NDR-like
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Members of this subfamily include ROCK and
ROCK-like proteins such as DMPK, MRCK, and CRIK, as well
as NDR and NDR-like proteins such as LATS, CBK1 and
Sid2p. ROCK and CRIK are effectors of the small GTPase
Rho, while MRCK is an effector of the small GTPase
Cdc42. NDR and NDR-like kinases contain an N-terminal
regulatory (NTR) domain and an insert within the
catalytic domain that contains an auto-inhibitory
sequence. Proteins in this subfamily are involved in
regulating many cellular functions including
contraction, motility, division, proliferation,
apoptosis, morphogenesis, and cytokinesis.
Length = 350
Score = 39.6 bits (93), Expect = 2e-05
Identities = 23/65 (35%), Positives = 36/65 (55%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
++ P I+ +Y F++ E + LVMEY GG+L + L +K V EE AR ++ A+
Sbjct: 55 LADADSPWIVKLYYSFQDEEHLYLVMEYMPGGDLMNLLIRKDVFPEETARFYIAELVLAL 114
Query: 61 YYCHK 65
HK
Sbjct: 115 DSVHK 119
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein
Serine/Threonine Kinase, Microtubule-associated
serine/threonine-like kinase. Serine/Threonine Kinases
(STKs), Microtubule-associated serine/threonine (MAST)
kinase subfamily, MAST-like (MASTL) kinases, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MAST kinase
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MAST kinases contain an N-terminal domain of
unknown function, a central catalytic domain, and a
C-terminal PDZ domain that mediates protein-protein
interactions. The MASTL kinases in this group carry only
a catalytic domain, which contains a long insertion
relative to MAST kinases. The human MASTL gene has also
been labelled FLJ14813. A missense mutation in FLJ14813
is associated with autosomal dominant thrombocytopenia.
To date, the function of MASTL is unknown.
Length = 669
Score = 39.5 bits (92), Expect = 2e-05
Identities = 19/61 (31%), Positives = 32/61 (52%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCH 64
+ P I+H+Y ++ + LVMEY GG++ L EE A + ++A A+ Y H
Sbjct: 62 KSPFIVHLYYSLQSANNVYLVMEYLIGGDVKSLLHIYGYFDEEMAVKYISEVALALDYLH 121
Query: 65 K 65
+
Sbjct: 122 R 122
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein
Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family;
Ephrin Receptor (EphR) subfamily; catalytic (c) domain.
The PTKc family is part of a larger superfamily that
includes the catalytic domains of other kinases such as
protein serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. EphRs
comprise the largest subfamily of receptor tyr kinases
(RTKs). They can be classified into two classes (EphA
and EphB), according to their extracellular sequences,
which largely correspond to binding preferences for
either GPI-anchored ephrin-A ligands or transmembrane
ephrin-B ligands. Vertebrates have ten EphA and six EhpB
receptors, which display promiscuous ligand interactions
within each class. EphRs contain an ephrin binding
domain and two fibronectin repeats extracellularly, a
transmembrane segment, and a cytoplasmic tyr kinase
domain. Binding of the ephrin ligand to EphR requires
cell-cell contact since both are anchored to the plasma
membrane. This allows ephrin/EphR dimers to form,
leading to the activation of the intracellular tyr
kinase domain. The resulting downstream signals occur
bidirectionally in both EphR-expressing cells (forward
signaling) and ephrin-expressing cells (reverse
signaling). The main effect of ephrin/EphR interaction
is cell-cell repulsion or adhesion. Ephrin/EphR
signaling is important in neural development and
plasticity, cell morphogenesis and proliferation,
cell-fate determination, embryonic development, tissue
patterning, and angiogenesis.
Length = 266
Score = 39.6 bits (93), Expect = 2e-05
Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 5/65 (7%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL---DQKKVLTEEEARRIFRQIA 57
M HPNII + V ++++ EY G L FL D K T + + R IA
Sbjct: 59 MGQFDHPNIIRLEGVVTKSRPVMIITEYMENGSLDKFLRENDGK--FTVGQLVGMLRGIA 116
Query: 58 TAVYY 62
+ + Y
Sbjct: 117 SGMKY 121
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related
kinase-like Protein Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related
(NDR) kinase subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The NDR subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. NDR kinase contains an N-terminal regulatory
(NTR) domain and an insert within the catalytic domain
that contains an auto-inhibitory sequence. Like many
other AGC kinases, NDR kinase requires phosphorylation
at two sites, the activation loop (A-loop) and the
hydrophobic motif (HM), for activity. NDR kinases
regulate mitosis, cell growth, embryonic development,
and neurological processes. They are also required for
proper centrosome duplication. Higher eukaryotes contain
two NDR isoforms, NDR1 and NDR2. This subfamily also
contains fungal NDR-like kinases.
Length = 364
Score = 39.3 bits (92), Expect = 3e-05
Identities = 19/65 (29%), Positives = 34/65 (52%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
++ +P ++ +Y F++ + L+MEY GG++ L +K TEEE R + A+
Sbjct: 55 LAEADNPWVVKLYYSFQDENYLYLIMEYLPGGDMMTLLMKKDTFTEEETRFYIAETILAI 114
Query: 61 YYCHK 65
HK
Sbjct: 115 DSIHK 119
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control
protein 7-like Protein Serine/Threonine Kinases.
Serine/threonine kinases (STKs), (Cdc7)-like subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Cdc7-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Members of this subfamily include
Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae
Cdc15, Arabidopsis thaliana mitogen-activated protein
kinase (MAPK) kinase kinase (MAPKKK) epsilon, and
related proteins. MAPKKKs phosphorylate and activate
MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
phosphorylate and activate MAPKs during signaling
cascades that are important in mediating cellular
responses to extracellular signals. Fission yeast Cdc7
is essential for cell division by playing a key role in
the initiation of septum formation and cytokinesis.
Budding yeast Cdc15 functions to coordinate mitotic exit
with cytokinesis. Arabidopsis MAPKKK epsilon is required
for pollen development in the plasma membrane.
Length = 254
Score = 39.2 bits (92), Expect = 3e-05
Identities = 14/65 (21%), Positives = 29/65 (44%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ +++HPNI+ E + + +++EYA G L + + E Q+ +
Sbjct: 53 LKNLKHPNIVKYIGSIETSDSLYIILEYAENGSLRQIIKKFGPFPESLVAVYVYQVLQGL 112
Query: 61 YYCHK 65
Y H+
Sbjct: 113 AYLHE 117
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein
Serine/Threonine Kinase, Mitogen and stress-activated
kinase 2. Serine/Threonine Kinases (STKs), Mitogen and
stress-activated kinase (MSK) subfamily, MSK2,
N-terminal catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The MSK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MSKs contain an N-terminal kinase domain (NTD)
from the AGC family and a C-terminal kinase domain (CTD)
from the CAMK family, similar to 90 kDa ribosomal
protein S6 kinases (RSKs). MSKs are activated by two
major signaling cascades, the Ras-MAPK and p38 stress
kinase pathways, which trigger phosphorylation in the
activation loop (A-loop) of the CTD of MSK. The active
CTD phosphorylates the hydrophobic motif (HM) of NTD,
which facilitates the phosphorylation of the A-loop and
activates the NTD, which in turn phosphorylates
downstream targets. MSK2 and MSK1 play nonredundant
roles in activating histone H3 kinases, which play
pivotal roles in compaction of the chromatin fiber. MSK2
is the required H3 kinase in response to stress stimuli
and activation of the p38 MAPK pathway. MSK2 also plays
a role in the pathogenesis of psoriasis.
Length = 332
Score = 39.2 bits (91), Expect = 4e-05
Identities = 17/60 (28%), Positives = 36/60 (60%)
Query: 7 PNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCHKV 66
P ++ ++ F+ K+ L+++Y +GGE++ L Q+ +E+E R +I A+ + HK+
Sbjct: 65 PFLVTLHYAFQTEAKLHLILDYVSGGEMFTHLYQRDNFSEDEVRFYSGEIILALEHLHKL 124
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein
Serine/Threonine Kinase, MAP/ERK kinase kinase 3.
Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
(MEKK3) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MEKK3 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MEKK3 is a mitogen-activated protein kinase
(MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
phosphorylates and activates the MAPK kinase MEK5 (or
MKK5), which in turn phosphorylates and activates
extracellular signal-regulated kinase 5 (ERK5). The ERK5
cascade plays roles in promoting cell proliferation,
differentiation, neuronal survival, and neuroprotection.
MEKK3 plays an essential role in embryonic angiogenesis
and early heart development. In addition, MEKK3 is
involved in interleukin-1 receptor and Toll-like
receptor 4 signaling. It is also a specific regulator of
the proinflammatory cytokines IL-6 and GM-CSF in some
immune cells. MEKK3 also regulates calcineurin, which
plays a critical role in T cell activation, apoptosis,
skeletal myocyte differentiation, and cardiac
hypertrophy.
Length = 266
Score = 38.9 bits (90), Expect = 4e-05
Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 2/66 (3%)
Query: 1 MSSVRHPNIIHIYEVFENR--EKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIAT 58
+ +++H I+ Y +R + + + MEY GG + D L LTE R+ RQI
Sbjct: 58 LKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILE 117
Query: 59 AVYYCH 64
+ Y H
Sbjct: 118 GMSYLH 123
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional.
Length = 335
Score = 38.6 bits (90), Expect = 5e-05
Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 1/65 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
M+ ++H NI+ + +V+ + + LVM+ A +L +D+K LTE + + I QI +
Sbjct: 74 MNEIKHENIMGLVDVYVEGDFINLVMDIMA-SDLKKVVDRKIRLTESQVKCILLQILNGL 132
Query: 61 YYCHK 65
HK
Sbjct: 133 NVLHK 137
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase 7.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase 7 (CDK7) subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The CDK7 subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. CDKs belong to a large family
of STKs that are regulated by their cognate cyclins.
Together, they are involved in the control of cell-cycle
progression, transcription, and neuronal function. CDK7
plays essential roles in the cell cycle and in
transcription. It associates with cyclin H and MAT1 and
acts as a CDK-Activating Kinase (CAK) by phosphorylating
and activating cell cycle CDKs (CDK1/2/4/6). In the
brain, it activates CDK5. CDK7 is also a component of
the general transcription factor TFIIH, which
phosphorylates the C-terminal domain (CTD) of RNA
polymerase II when it is bound with unphosphorylated
DNA, as present in the pre-initiation complex. Following
phosphorylation, the CTD dissociates from the DNA which
allows transcription initiation.
Length = 298
Score = 38.7 bits (91), Expect = 5e-05
Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 2/66 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKK-VLTEEEARRIFRQIATA 59
+ ++HPNII + +VF ++ + LV E+ +L + K VLT + +
Sbjct: 56 LQELKHPNIIGLLDVFGHKSNINLVFEFME-TDLEKVIKDKSIVLTPADIKSYMLMTLRG 114
Query: 60 VYYCHK 65
+ Y H
Sbjct: 115 LEYLHS 120
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein
Serine/Threonine Kinase, Atypical Protein Kinase C.
Serine/Threonine Kinases (STKs), Atypical Protein Kinase
C (aPKC) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
aPKC subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PKCs are classified into three groups
(classical, atypical, and novel) depending on their mode
of activation and the structural characteristics of
their regulatory domain. aPKCs only require
phosphatidylserine (PS) for activation. They contain a
C2-like region, instead of a calcium-binding (C2) region
found in classical PKCs, in their regulatory domain.
There are two aPKC isoforms, zeta and iota. aPKCs are
involved in many cellular functions including
proliferation, migration, apoptosis, polarity
maintenance and cytoskeletal regulation. They also play
a critical role in the regulation of glucose metabolism
and in the pathogenesis of type 2 diabetes.
Length = 329
Score = 38.6 bits (90), Expect = 5e-05
Identities = 16/60 (26%), Positives = 36/60 (60%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCHK 65
HP ++ ++ F+ ++ V+E+ +GG+L + +++ L EE AR +I+ A+ + H+
Sbjct: 55 HPFLVGLHSCFQTESRLFFVIEFVSGGDLMFHMQRQRKLPEEHARFYSAEISLALNFLHE 114
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein
Serine/Threonine Kinase, Mitogen and stress-activated
kinase 1. Serine/Threonine Kinases (STKs), Mitogen and
stress-activated kinase (MSK) subfamily, MSK1,
N-terminal catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The MSK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MSKs contain an N-terminal kinase domain (NTD)
from the AGC family and a C-terminal kinase domain (CTD)
from the CAMK family, similar to 90 kDa ribosomal
protein S6 kinases (RSKs). MSKs are activated by two
major signaling cascades, the Ras-MAPK and p38 stress
kinase pathways, which trigger phosphorylation in the
activation loop (A-loop) of the CTD of MSK. The active
CTD phosphorylates the hydrophobic motif (HM) of NTD,
which facilitates the phosphorylation of the A-loop and
activates the NTD, which in turn phosphorylates
downstream targets. MSK1 plays a role in the regulation
of translational control and transcriptional activation.
It phosphorylates the transcription factors, CREB and
NFkappaB. It also phosphorylates the nucleosomal
proteins H3 and HMG-14. Increased phosphorylation of
MEK1 is associated with the development of cerebral
ischemic/hypoxic preconditioning.
Length = 290
Score = 38.4 bits (89), Expect = 5e-05
Identities = 17/60 (28%), Positives = 35/60 (58%)
Query: 7 PNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCHKV 66
P ++ ++ F+ K+ L+++Y GGEL+ L Q++ E+E + +I A+ + HK+
Sbjct: 65 PFLVTLHYAFQTDTKLHLILDYINGGELFTHLSQRERFKEQEVQIYSGEIVLALEHLHKL 124
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein
Serine/Threonine Kinase, p21-activated kinase 6.
Serine/threonine kinases (STKs), p21-activated kinase
(PAK) 6, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The PAK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PAKs are Rho family GTPase-regulated kinases
that serve as important mediators in the function of
Cdc42 (cell division cycle 42) and Rac. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
PAK6 belongs to group II. Group II PAKs contain a PBD
(p21-binding domain) and a C-terminal catalytic domain,
but do not harbor an AID (autoinhibitory domain) or SH3
binding sites. PAK6 may play a role in stress responses
through its activation by the mitogen-activated protein
kinase (MAPK) p38 and MAPK kinase 6 (MKK6) pathway. PAK6
is highly expressed in the brain. It is not required for
viability, but together with PAK5, it is required for
normal levels of locomotion and activity, and for
learning and memory. Increased expression of PAK6 is
found in primary and metastatic prostate cancer. PAK6
may play a role in the regulation of motility.
Length = 297
Score = 38.5 bits (89), Expect = 6e-05
Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
M +H N++ +Y+ + E++ ++ME+ GG L D + Q + L EE+ + + A+
Sbjct: 72 MRDYQHQNVVEMYKSYLVGEELWVLMEFLQGGALTDIVSQTR-LNEEQIATVCESVLQAL 130
Query: 61 YYCH 64
Y H
Sbjct: 131 CYLH 134
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein
Serine/Threonine Kinases, Mammalian Ste20-like protein
kinase 1 and 2. Serine/threonine kinases (STKs),
mammalian Ste20-like protein kinase 1 (MST1) and MST2
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MST1/2 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. This subfamily is composed of MST1, MST2, and
related proteins including Drosophila Hippo and
Dictyostelium discoideum Krs1 (kinase responsive to
stress 1). MST1/2 and Hippo are involved in a conserved
pathway that governs cell contact inhibition, organ size
control, and tumor development. MST1 activates the
mitogen-activated protein kinases (MAPKs) p38 and c-Jun
N-terminal kinase (JNK) through MKK7 (a MAPK kinase) and
MEKK1 (a MAPK kinase kinase) by acting as a MAPK kinase
kinase kinase (MAPKKKK). Activation of JNK by MST1 leads
to caspase activation and apoptosis. MST1 has also been
implicated in cell proliferation and differentiation.
Krs1 may regulate cell growth arrest and apoptosis in
response to cellular stress.
Length = 256
Score = 38.0 bits (89), Expect = 7e-05
Identities = 19/68 (27%), Positives = 28/68 (41%), Gaps = 1/68 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLD-QKKVLTEEEARRIFRQIATA 59
+ P I+ Y + + +VMEY G + D + K LTEEE I Q
Sbjct: 52 LKQCDSPYIVKYYGSYFKNTDLWIVMEYCGAGSVSDIMKITNKTLTEEEIAAILYQTLKG 111
Query: 60 VYYCHKVQ 67
+ Y H +
Sbjct: 112 LEYLHSNK 119
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein
Serine/Threonine Kinase, Atypical Protein Kinase C zeta.
Serine/Threonine Kinases (STKs), Atypical Protein
Kinase C (aPKC) subfamily, zeta isoform, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The aPKC subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PKCs are
classified into three groups (classical, atypical, and
novel) depending on their mode of activation and the
structural characteristics of their regulatory domain.
aPKCs only require phosphatidylserine (PS) for
activation. There are two aPKC isoforms, zeta and iota.
PKC-zeta plays a critical role in activating the glucose
transport response. It is activated by glucose, insulin,
and exercise through diverse pathways. PKC-zeta also
plays a central role in maintaining cell polarity in
yeast and mammalian cells. In addition, it affects actin
remodeling in muscle cells.
Length = 327
Score = 38.1 bits (88), Expect = 7e-05
Identities = 17/60 (28%), Positives = 35/60 (58%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCHK 65
+P ++ ++ F+ ++ LV+EY GG+L + +++ L EE AR +I A+ + H+
Sbjct: 55 NPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHE 114
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein
Tyrosine Kinases. Protein Tyrosine Kinase (PTK)
family; Fes subfamily; catalytic (c) domain. Fes
subfamily members include Fes (or Fps), Fer, and
similar proteins. The PTKc family is part of a larger
superfamily that includes the catalytic domains of
other kinases such as protein serine/threonine kinases,
RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
catalyze the transfer of the gamma-phosphoryl group
from ATP to tyrosine (tyr) residues in protein
substrates. Fes subfamily proteins are cytoplasmic (or
nonreceptor) tyr kinases containing an N-terminal
region with FCH (Fes/Fer/CIP4 homology) and coiled-coil
domains, followed by a SH2 domain, and a C-terminal
catalytic domain. The genes for Fes (feline sarcoma)
and Fps (Fujinami poultry sarcoma) were first isolated
from tumor-causing retroviruses. The viral oncogenes
encode chimeric Fes proteins consisting of Gag
sequences at the N-termini, resulting in unregulated
tyr kinase activity. Fes and Fer kinases play roles in
haematopoiesis, inflammation and immunity, growth
factor signaling, cytoskeletal regulation, cell
migration and adhesion, and the regulation of cell-cell
interactions. Fes and Fer show redundancy in their
biological functions.
Length = 251
Score = 38.2 bits (89), Expect = 7e-05
Identities = 15/38 (39%), Positives = 22/38 (57%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKK 42
HPNI+ + V ++ + +VME GG L FL +KK
Sbjct: 50 DHPNIVKLIGVCVQKQPIYIVMELVPGGSLLTFLRKKK 87
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like
Protein Serine/Threonine Kinases. Serine/Threonine
Kinases (STKs), Microtubule-associated serine/threonine
(MAST) kinase subfamily, fungal Rim15-like kinases,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MAST kinase
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Members of this group include Saccharomyces
cerevisiae Rim15, Schizosaccharomyces pombe cek1, and
similar fungal proteins. They contain a central
catalytic domain, which contains an insert relative to
MAST kinases. In addition, Rim15 contains a C-terminal
signal receiver (REC) domain while cek1 contains an
N-terminal PAS domain. Rim15 (or Rim15p) functions as a
regulator of meiosis. It acts as a downstream effector
of PKA and regulates entry into stationary phase (G0).
Thus, it plays a crucial role in regulating yeast
proliferation, differentiation, and aging. Cek1 may
facilitate progression of mitotic anaphase.
Length = 260
Score = 38.2 bits (89), Expect = 7e-05
Identities = 16/65 (24%), Positives = 31/65 (47%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
M P + +Y F++++ + LVMEY GG+ + L E+ A++ ++ V
Sbjct: 51 MIQGESPYVAKLYYSFQSKDYLYLVMEYLNGGDCASLIKTLGGLPEDWAKQYIAEVVLGV 110
Query: 61 YYCHK 65
H+
Sbjct: 111 EDLHQ 115
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine
Kinase, Ste20-like kinase. Serine/threonine kinases
(STKs), Ste20-like kinase (SLK) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The SLK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. SLK promotes
apoptosis through apoptosis signal-regulating kinase 1
(ASK1) and the mitogen-activated protein kinase (MAPK)
p38. It acts as a MAPK kinase kinase (MAPKKK) by
phosphorylating ASK1, resulting in the phosphorylation
of p38. SLK also plays a role in mediating actin
reorganization. It is part of a microtubule-associated
complex that is targeted at adhesion sites, and is
required in focal adhesion turnover and in regulating
cell migration.
Length = 282
Score = 38.1 bits (88), Expect = 8e-05
Identities = 19/66 (28%), Positives = 38/66 (57%), Gaps = 1/66 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYD-FLDQKKVLTEEEARRIFRQIATA 59
++S HPNI+ + + F + +++E+ AGG + L+ ++ LTE + R + +Q A
Sbjct: 56 LASCDHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTEPQIRVVCKQTLEA 115
Query: 60 VYYCHK 65
+ Y H+
Sbjct: 116 LNYLHE 121
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase 9.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase 9 (CDK9) subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The CDK9 subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. CDKs belong to a large family
of STKs that are regulated by their cognate cyclins.
Together, they are involved in the control of cell-cycle
progression, transcription, and neuronal function. CDK9
together with a cyclin partner (cyclin T1, T2a, T2b, or
K) is the main component of distinct positive
transcription elongation factors (P-TEFb), which
function as Ser2 C-terminal domain kinases of RNA
polymerase II. P-TEFb participates in multiple steps of
gene expression including transcription elongation, mRNA
synthesis, processing, export, and translation. It also
plays a role in mediating cytokine induced transcription
networks such as IL6-induced STAT3 signaling. In
addition, the CDK9/cyclin T2a complex promotes muscle
differentiation and enhances the function of some
myogenic regulatory factors.
Length = 310
Score = 37.7 bits (88), Expect = 9e-05
Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 10/71 (14%)
Query: 3 SVRHPNIIHIYEV------FENREK--MVLVMEYAAGGELYDFLDQKKV-LTEEEARRIF 53
++H N++++ E+ NR K LV E+ +L L K V T E +++
Sbjct: 67 LLKHENVVNLIEICRTKATPYNRYKGSFYLVFEFCE-HDLAGLLSNKNVKFTLSEIKKVM 125
Query: 54 RQIATAVYYCH 64
+ + +YY H
Sbjct: 126 KMLLNGLYYIH 136
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein
Serine/Threonine Kinase, 90 kDa ribosomal protein S6
kinase. Serine/Threonine Kinases (STKs), 90 kDa
ribosomal protein S6 kinase (RSK) subfamily, N-terminal
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The RSK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. RSKs contain an
N-terminal kinase domain (NTD) from the AGC family and a
C-terminal kinase domain (CTD) from the CAMK family.
They are activated by signaling inputs from
extracellular regulated kinase (ERK) and
phosphoinositide dependent kinase 1 (PDK1). ERK
phosphorylates and activates the CTD of RSK, serving as
a docking site for PDK1, which phosphorylates and
activates the NTD, which in turn phosphorylates all
known RSK substrates. RSKs act as downstream effectors
of mitogen-activated protein kinase (MAPK) and play key
roles in mitogen-activated cell growth, differentiation,
and survival. Mammals possess four RSK isoforms (RSK1-4)
from distinct genes. RSK proteins are also referred to
as MAP kinase-activated protein kinases (MAPKAPKs),
p90-RSKs, or p90S6Ks.
Length = 318
Score = 37.9 bits (88), Expect = 9e-05
Identities = 17/64 (26%), Positives = 39/64 (60%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
++ V HP I+ ++ F+ K+ L++++ GG+L+ L ++ + TEE+ + ++A A+
Sbjct: 52 LAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAL 111
Query: 61 YYCH 64
+ H
Sbjct: 112 DHLH 115
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein
Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1.
Serine/threonine kinases (STKs), plant MAP/ERK kinase
kinase 1 (MEKK1)-like subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The plant MEKK1 subfamily is part of a
larger superfamily that includes the catalytic domains
of other protein STKs, protein tyrosine kinases, RIO
kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. This subfamily is
composed of plant mitogen-activated protein kinase
(MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks)
including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1
is a MAPKKK that phosphorylates and activates MAPK
kinases (MAPKKs or MKKs or MAP2Ks), which in turn
phosphorylate and activate MAPKs during signaling
cascades that are important in mediating cellular
responses to extracellular signals. Arabidopsis thaliana
MEKK1 activates MPK4, a MAPK that regulates systemic
acquired resistance. MEKK1 also participates in the
regulation of temperature-sensitive and tissue-specific
cell death.
Length = 258
Score = 37.8 bits (88), Expect = 1e-04
Identities = 17/64 (26%), Positives = 27/64 (42%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+S ++HPNI+ + + + +E GG L L + E R RQI +
Sbjct: 56 LSKLQHPNIVQYLGTEREEDNLYIFLELVPGGSLAKLLKKYGSFPEPVIRLYTRQILLGL 115
Query: 61 YYCH 64
Y H
Sbjct: 116 EYLH 119
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein
Serine/Threonine Kinases, Never In Mitosis gene
A-related kinase 6 and 7. Serine/Threonine Kinases
(STKs), Never In Mitosis gene A (NIMA)-related kinase 6
(Nek6) and Nek7 subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The Nek6/7 subfamily is part of a family of 11 different
Neks (Nek1-11) that are involved in cell cycle control.
The Nek family is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Nek6 and Nek7 are the shortest Neks,
consisting only of the catalytic domain and a very short
N-terminal extension. They show distinct expression
patterns and both appear to be downstream substrates of
Nek9. They are required for mitotic spindle formation
and cytokinesis. They may also be regulators of the p70
ribosomal S6 kinase.
Length = 267
Score = 37.8 bits (88), Expect = 1e-04
Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 4/68 (5%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELY----DFLDQKKVLTEEEARRIFRQI 56
+ + HPN+I F ++ +V+E A G+L F QK+++ E + F Q+
Sbjct: 56 LKQLDHPNVIKYLASFIENNELNIVLELADAGDLSRMIKHFKKQKRLIPERTIWKYFVQL 115
Query: 57 ATAVYYCH 64
+A+ + H
Sbjct: 116 CSALEHMH 123
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity
Protein Kinase, Mitogen-Activated Protein Kinase Kinase.
Protein kinases (PKs), MAP kinase kinase (MAPKK)
subfamily, catalytic (c) domain. PKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine or tyrosine residues on protein
substrates. The MAPKK subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein serine/threonine kinases, protein tyrosine
kinases, RIO kinases, aminoglycoside phosphotransferase,
choline kinase, and phosphoinositide 3-kinase. The
mitogen-activated protein (MAP) kinase signaling
pathways are important mediators of cellular responses
to extracellular signals. The pathways involve a triple
kinase core cascade comprising the MAP kinase (MAPK),
which is phosphorylated and activated by a MAPK kinase
(MAPKK or MKK or MAP2K), which itself is phosphorylated
and activated by a MAPK kinase kinase (MAPKKK or MKKK or
MAP3K). MAPKKs are dual-specificity PKs that
phosphorylate their downstream targets, MAPKs, at
specific threonine and tyrosine residues. There are
three MAPK subfamilies: extracellular signal-regulated
kinase (ERK), c-Jun N-terminal kinase (JNK), and p38. In
mammalian cells, there are seven MAPKKs (named MKK1-7)
and 20 MAPKKKs. Each MAPK subfamily can be activated by
at least two cognate MAPKKs and by multiple MAPKKKs.
Length = 265
Score = 37.3 bits (87), Expect = 1e-04
Identities = 16/63 (25%), Positives = 25/63 (39%), Gaps = 1/63 (1%)
Query: 3 SVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQ-KKVLTEEEARRIFRQIATAVY 61
P I+ Y F N + + MEY GG L L + + + E +I + +
Sbjct: 55 KCNSPYIVGFYGAFYNNGDISICMEYMDGGSLDKILKEVQGRIPERILGKIAVAVLKGLT 114
Query: 62 YCH 64
Y H
Sbjct: 115 YLH 117
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine
Kinases, Receptor tyrosine kinase-like Orphan
Receptors. Protein Tyrosine Kinase (PTK) family;
Receptor tyrosine kinase-like Orphan Receptor (Ror)
subfamily; catalytic (c) domain. The Ror subfamily
consists of Ror1, Ror2, and similar proteins. The PTKc
family is part of a larger superfamily that includes
the catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Ror
proteins are orphan receptor tyr kinases (RTKs)
containing an extracellular region with
immunoglobulin-like, cysteine-rich, and kringle
domains, a transmembrane segment, and an intracellular
catalytic domain. Ror RTKs are unrelated to the nuclear
receptor subfamily called retinoid-related orphan
receptors (RORs). RTKs are usually activated through
ligand binding, which causes dimerization and
autophosphorylation of the intracellular tyr kinase
catalytic domain. Ror kinases are expressed in many
tissues during development. They play important roles
in bone and heart formation. Mutations in human Ror2
result in two different bone development genetic
disorders, recessive Robinow syndrome and brachydactyly
type B. Drosophila Ror is expressed only in the
developing nervous system during neurite outgrowth and
neuronal differentiation, suggesting a role for
Drosophila Ror in neural development. More recently,
mouse Ror1 and Ror2 have also been found to play an
important role in regulating neurite growth in central
neurons. Ror1 and Ror2 are believed to have some
overlapping and redundant functions.
Length = 283
Score = 37.4 bits (87), Expect = 1e-04
Identities = 14/38 (36%), Positives = 24/38 (63%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
MS ++HPNI+ + V + ++ EY A G+L++FL
Sbjct: 62 MSDLQHPNIVCLLGVCTKEQPTCMLFEYLAHGDLHEFL 99
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein
Serine/Threonine Kinase, Large Tumor Suppressor 2.
Serine/Threonine Kinases (STKs), Large Tumor Suppressor
(LATS) subfamily, LATS2 isoform, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The LATS subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. LATS functions as a tumor
suppressor and is implicated in cell cycle regulation.
LATS2 is an essential mitotic regulator responsible for
coordinating accurate cytokinesis completion and
governing the stabilization of other mitotic regulators.
It is also critical in the maintenance of proper
chromosome number, genomic stability, mitotic fidelity,
and the integrity of centrosome duplication.
Downregulation of LATS2 is associated with poor
prognosis in acute lymphoblastic leukemia and breast
cancer.
Length = 381
Score = 37.3 bits (86), Expect = 1e-04
Identities = 15/58 (25%), Positives = 32/58 (55%)
Query: 9 IIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCHKV 66
++ +Y F++++ + VM+Y GG++ L + +V E AR ++ A+ HK+
Sbjct: 63 VVKLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMEVFPEVLARFYIAELTLAIESVHKM 120
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine
Kinase, Protein Kinase N. Serine/Threonine Kinases
(STKs), Protein Kinase N (PKN) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The PKN subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PKN has a
C-terminal catalytic domain that is highly homologous to
PKCs. Its unique N-terminal regulatory region contains
antiparallel coiled-coil (ACC) domains. In mammals,
there are three PKN isoforms from different genes
(designated PKN-alpha, beta, and gamma), which show
different enzymatic properties, tissue distribution, and
varied functions. PKN can be activated by the small
GTPase Rho, and by fatty acids such as arachidonic and
linoleic acids. It is involved in many biological
processes including cytokeletal regulation, cell
adhesion, vesicle transport, glucose transport,
regulation of meiotic maturation and embryonic cell
cycles, signaling to the nucleus, and tumorigenesis.
Length = 324
Score = 37.4 bits (87), Expect = 1e-04
Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
Query: 2 SSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEAR 50
+S RHP +++++ F+ + + VMEYAAGG+L + V +E A
Sbjct: 57 NSERHPFLVNLFACFQTEDHVCFVMEYAAGGDLMMHI-HTDVFSEPRAV 104
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine
Kinase-like Protein Tyrosine Kinases. Protein Tyrosine
Kinase (PTK) family; Spleen Tyrosine Kinase (Syk)
subfamily; catalytic (c) domain. The Syk subfamily is
composed of Syk, ZAP-70, Shark, and similar proteins.
The PTKc family is part of a larger superfamily that
includes the catalytic domains of other kinases such as
protein serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Syk
subfamily kinases are cytoplasmic (or nonreceptor) tyr
kinases containing two Src homology 2 (SH2) domains
N-terminal to the catalytic tyr kinase domain. They are
involved in the signaling downstream of activated
receptors (including B-cell, T-cell, and Fc receptors)
that contain ITAMs (immunoreceptor tyr activation
motifs), leading to processes such as cell
proliferation, differentiation, survival, adhesion,
migration, and phagocytosis. Syk is important in B-cell
receptor (BCR) signaling, while Zap-70 is primarily
expressed in T-cells and NK cells, and is a crucial
component in T-cell receptor (TCR) signaling. Syk also
plays a central role in Fc receptor-mediated
phagocytosis in the adaptive immune system. Shark is
exclusively expressed in ectodermally derived epithelia,
and is localized preferentially to the apical surface of
the epithelial cells, it may play a role in a signaling
pathway for epithelial cell polarity.
Length = 257
Score = 37.3 bits (87), Expect = 2e-04
Identities = 17/62 (27%), Positives = 34/62 (54%), Gaps = 1/62 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
M+ + HP I+ + V + E ++LVME A G L +L +++ + + + + Q+A +
Sbjct: 50 MAQLDHPCIVRLIGVCKG-EPLMLVMELAPLGPLLKYLKKRREIPVSDLKELAHQVAMGM 108
Query: 61 YY 62
Y
Sbjct: 109 AY 110
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine
Kinases, Cyclin-Dependent protein Kinase Like 2 and 3.
Serine/Threonine Kinases (STKs), Cyclin-dependent
protein kinase like 2 (CDKL2) and CDKL3 subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDKL2 and CDKL3
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. CDKL2, also called
p56 KKIAMRE, is expressed in testis, kidney, lung, and
brain. It functions mainly in mature neurons and plays
an important role in learning and memory. Inactivation
of CDKL3, also called NKIAMRE (NKIATRE in rat), by
translocation is associated with mild mental
retardation. It has been reported that CDKL3 is lost in
leukemic cells having a chromosome arm 5q deletion, and
may contribute to the transformed phenotype.
Length = 286
Score = 36.6 bits (85), Expect = 2e-04
Identities = 18/60 (30%), Positives = 30/60 (50%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCH 64
RH N++++ EVF ++++ LV E+ L D L E R+ QI + +CH
Sbjct: 58 RHENLVNLIEVFRRKKRLYLVFEFVDHTVLDDLEKYPNGLDESRVRKYLFQILRGIEFCH 117
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein
Serine/Threonine Kinase, MAP/ERK kinase kinase 2.
Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2
(MEKK2) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MEKK2 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MEKK2 is a mitogen-activated protein kinase
(MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
phosphorylates and activates the MAPK kinase MEK5 (or
MKK5), which in turn phosphorylates and activates
extracellular signal-regulated kinase 5 (ERK5). The ERK5
cascade plays roles in promoting cell proliferation,
differentiation, neuronal survival, and neuroprotection.
MEKK2 also activates ERK1/2, c-Jun N-terminal kinase
(JNK) and p38 through their respective MAPKKs MEK1/2,
JNK-activating kinase 2 (JNKK2), and MKK3/6. MEKK2 plays
roles in T cell receptor signaling, immune synapse
formation, cytokine gene expression, as well as in EGF
and FGF receptor signaling.
Length = 265
Score = 36.6 bits (84), Expect = 3e-04
Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 2/66 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVL--VMEYAAGGELYDFLDQKKVLTEEEARRIFRQIAT 58
+ ++ H I+ Y + + L ME+ GG + D L LTE R+ RQI
Sbjct: 58 LKNLLHERIVQYYGCLRDPMERTLSIFMEHMPGGSIKDQLKSYGALTENVTRKYTRQILE 117
Query: 59 AVYYCH 64
V Y H
Sbjct: 118 GVSYLH 123
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine
Kinase, Mitogen-Activated Protein Kinase.
Serine/Threonine Kinases (STKs), Mitogen-Activated
Protein Kinase (MAPK) subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The MAPK subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. MAPKs serve as important
mediators of cellular responses to extracellular
signals. They control critical cellular functions
including differentiation, proliferation, migration, and
apoptosis. They are also implicated in the pathogenesis
of many diseases including multiple types of cancer,
stroke, diabetes, and chronic inflammation. Typical MAPK
pathways involve a triple kinase core cascade comprising
of the MAPK, which is phosphorylated and activated by a
MAPK kinase (MAP2K or MKK), which itself is
phosphorylated and activated by a MAPK kinase kinase
(MAP3K or MKKK). Each cascade is activated either by a
small GTP-binding protein or by an adaptor protein,
which transmits the signal either directly to a MAP3K to
start the triple kinase core cascade or indirectly
through a mediator kinase, a MAP4K. There are three main
typical MAPK subfamilies: Extracellular signal-Regulated
Kinase (ERK), c-Jun N-terminal Kinase (JNK), and p38.
Some MAPKs are atypical in that they are not regulated
by MAP2Ks. These include MAPK4, MAPK6, NLK, and ERK7.
Length = 330
Score = 36.4 bits (85), Expect = 3e-04
Identities = 15/69 (21%), Positives = 31/69 (44%), Gaps = 6/69 (8%)
Query: 1 MSSVRHPNIIHIYEVF-----ENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQ 55
+ +RH NII + ++ E+ + +V E +L+ + + LT++ + Q
Sbjct: 53 LRHLRHENIIGLLDILRPPSPEDFNDVYIVTEL-METDLHKVIKSPQPLTDDHIQYFLYQ 111
Query: 56 IATAVYYCH 64
I + Y H
Sbjct: 112 ILRGLKYLH 120
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein
Serine/Threonine Kinase, Microtubule-associated
serine/threonine kinase. Serine/Threonine Kinases
(STKs), Microtubule-associated serine/threonine (MAST)
kinase subfamily, MAST, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The MAST kinase subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. MAST kinases contain an
N-terminal domain of unknown function, a central
catalytic domain, and a C-terminal PDZ domain that
mediates protein-protein interactions. There are four
mammalian MAST kinases, named MAST1-MAST4. MAST1 is also
referred to as syntrophin-associated STK (SAST), while
MAST2 is also called MAST205. MAST kinases are
cytoskeletal associated kinases of unknown function that
are also expressed at neuromuscular junctions and
postsynaptic densities. MAST1, MAST2, and MAST3 bind and
phosphorylate the tumor suppressor PTEN, and may
contribute to the regulation and stabilization of PTEN.
MAST2 is involved in the regulation of the Fc-gamma
receptor of the innate immune response in macrophages,
and may also be involved in the regulation of the Na+/H+
exchanger NHE3.
Length = 305
Score = 36.3 bits (84), Expect = 4e-04
Identities = 17/59 (28%), Positives = 29/59 (49%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCH 64
+P ++ ++ FE + + +VMEY GG+ L L + AR F + A+ Y H
Sbjct: 60 NPFVVSMFCSFETKRHLCMVMEYVEGGDCATLLKNIGALPVDMARMYFAETVLALEYLH 118
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine
Kinase, Fungal Cyclin-Dependent protein Kinase Pho85.
Serine/Threonine Kinases (STKs), Pho85 subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Pho85 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Pho85 is a
multifunctional Cyclin-Dependent protein Kinase (CDK) in
yeast. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. Pho85 is regulated
by 10 different cyclins (Pcls) and plays a role in G1
progression, cell polarity, phosphate and glycogen
metabolism, gene expression, and in signaling changes in
the environment. It is not essential for yeast viability
and is the functional homolog of mammalian CDK5, which
plays a role in central nervous system development.
Length = 284
Score = 36.3 bits (84), Expect = 4e-04
Identities = 16/68 (23%), Positives = 33/68 (48%), Gaps = 4/68 (5%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLD---QKKVLTEEEARRIFRQIA 57
M ++H NI+ +++V K++LV EY +L ++D + L + Q+
Sbjct: 52 MKELKHENIVRLHDVIHTENKLMLVFEYMD-KDLKKYMDTHGVRGALDPNTVKSFTYQLL 110
Query: 58 TAVYYCHK 65
+ +CH+
Sbjct: 111 KGIAFCHE 118
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like
Protein Tyrosine Kinases. Protein Tyrosine Kinase
(PTK) family; Src kinase subfamily; catalytic (c)
domain. Src subfamily members include Src, Lck, Hck,
Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is
part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Src (or
c-Src) proteins are cytoplasmic (or non-receptor) tyr
kinases which are anchored to the plasma membrane. They
contain an N-terminal SH4 domain with a myristoylation
site, followed by SH3 and SH2 domains, a tyr kinase
domain, and a regulatory C-terminal region containing a
conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). Src
proteins are involved in signaling pathways that
regulate cytokine and growth factor responses,
cytoskeleton dynamics, cell proliferation, survival,
and differentiation. They were identified as the first
proto-oncogene products, and they regulate cell
adhesion, invasion, and motility in cancer cells and
tumor vasculature, contributing to cancer progression
and metastasis. Src kinases are overexpressed in a
variety of human cancers, making them attractive
targets for therapy. They are also implicated in acute
inflammatory responses and osteoclast function. Src,
Fyn, Yes, and Yrk are widely expressed, while Blk, Lck,
Hck, Fgr, and Lyn show a limited expression pattern.
Length = 261
Score = 36.1 bits (84), Expect = 4e-04
Identities = 14/38 (36%), Positives = 21/38 (55%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
M +RH ++ +Y V E + +V EY + G L DFL
Sbjct: 55 MKKLRHDKLVQLYAVCSEEEPIYIVTEYMSKGSLLDFL 92
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein
Serine/Threonine Kinase, Mitogen-activated protein
kinase kinase kinase kinase 5. Serine/threonine kinases
(STKs), mitogen-activated protein kinase (MAPK) kinase
kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MAP4K5 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Members of this
subfamily contain an N-terminal catalytic domain and a
C-terminal citron homology (CNH) regulatory domain,
similar to MAP4K4/6. MAP4Ks are involved in some MAPK
signaling pathways that are important in mediating
cellular responses to extracellular signals by
activating a MAPK kinase kinase (MAPKKK or MAP3K or
MKKK). Each MAPK cascade is activated either by a small
GTP-binding protein or by an adaptor protein, which
transmits the signal either directly to a MAP3K to start
the triple kinase core cascade or indirectly through a
mediator kinase, a MAP4K. MAP4K5, also called germinal
center kinase-related enzyme (GCKR), has been shown to
activate the MAPK c-Jun N-terminal kinase (JNK). MAP4K5
also facilitates Wnt signaling in B cells, and may
therefore be implicated in the control of cell fate,
proliferation, and polarity.
Length = 267
Score = 35.8 bits (82), Expect = 4e-04
Identities = 18/60 (30%), Positives = 30/60 (50%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCH 64
+H NI+ + + +REK+ + MEY GG L D L+E + + R+ + Y H
Sbjct: 64 KHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIYHVTGPLSELQIAYVCRETLQGLAYLH 123
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein
Serine/Threonine Kinase, p21-activated kinase 2.
Serine/threonine kinases (STKs), p21-activated kinase
(PAK) 2, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The PAK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PAKs are Rho family GTPase-regulated kinases
that serve as important mediators in the function of
Cdc42 (cell division cycle 42) and Rac. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
PAK2 belongs to group I. Group I PAKs contain a PBD
(p21-binding domain) overlapping with an AID
(autoinhibitory domain), a C-terminal catalytic domain,
SH3 binding sites and a non-classical SH3 binding site
for PIX (PAK-interacting exchange factor). PAK2 plays a
role in pro-apoptotic signaling. It is cleaved and
activated by caspases leading to morphological changes
during apoptosis. PAK2 is also activated in response to
a variety of stresses including DNA damage,
hyperosmolarity, serum starvation, and contact
inhibition, and may play a role in coordinating the
stress response. PAK2 also contributes to cancer cell
invasion through a mechanism distinct from that of PAK1.
Length = 296
Score = 35.9 bits (82), Expect = 5e-04
Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
M +++PNI++ + F +++ +VMEY AGG L D + + + E + + R+ A+
Sbjct: 70 MKELKNPNIVNFLDSFLVGDELFVVMEYLAGGSLTDVVTE-TCMDEAQIAAVCRECLQAL 128
Query: 61 YYCHKVQ 67
+ H Q
Sbjct: 129 EFLHANQ 135
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine
Kinase, Activated Cdc42-associated kinase. Protein
Tyrosine Kinase (PTK) family; Activated
Cdc42-associated kinase (Ack) subfamily; catalytic (c)
domain. Ack subfamily members include Ack1,
thirty-eight-negative kinase 1 (Tnk1), and similar
proteins. The PTKc family is part of a larger
superfamily that includes the catalytic domains of
other kinases such as protein serine/threonine kinases,
RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
catalyze the transfer of the gamma-phosphoryl group
from ATP to tyrosine (tyr) residues in protein
substrates. Ack subfamily members are cytoplasmic (or
nonreceptor) tyr kinases containing an N-terminal
catalytic domain, an SH3 domain, a Cdc42-binding CRIB
domain, and a proline-rich region. They are mainly
expressed in brain and skeletal tissues and are
involved in the regulation of cell adhesion and growth,
receptor degradation, and axonal guidance. Ack1 is also
associated with androgen-independent prostate cancer
progression. Tnk1 regulates TNFalpha signaling and may
play an important role in cell death.
Length = 257
Score = 35.8 bits (83), Expect = 5e-04
Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKK 42
M S+ H N+I +Y V +++V E A G L D L +
Sbjct: 50 MHSLDHENLIRLYGVVLT-HPLMMVTELAPLGSLLDRLRKDA 90
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain
Receptor-like Protein Tyrosine Kinases. Protein
Tyrosine Kinase (PTK) family; Discoidin Domain Receptor
(DDR)-like proteins; catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. DDR-like
proteins are members of the DDR subfamily, which are
receptor tyr kinases (RTKs) containing an extracellular
discoidin homology domain, a transmembrane segment, an
extended juxtamembrane region, and an intracellular
catalytic domain. The binding of the ligand, collagen,
to DDRs results in a slow but sustained receptor
activation. DDRs regulate cell adhesion, proliferation,
and extracellular matrix remodeling. They have been
linked to a variety of human cancers including breast,
colon, ovarian, brain, and lung. There is no evidence
showing that DDRs act as transforming oncogenes. They
are more likely to play a role in the regulation of
tumor growth and metastasis.
Length = 295
Score = 35.7 bits (82), Expect = 5e-04
Identities = 14/43 (32%), Positives = 27/43 (62%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKV 43
MS +++PNII + V + + + ++ EY G+L FL Q+++
Sbjct: 71 MSRLKNPNIIRLLGVCVSDDPLCMITEYMENGDLNQFLSQREI 113
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine
Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer
kinase; catalytic (c) domain. The PTKc family is part
of a larger superfamily that includes the catalytic
domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Fer
kinase is a member of the Fes subfamily of proteins
which are cytoplasmic (or nonreceptor) tyr kinases
containing an N-terminal region with FCH (Fes/Fer/CIP4
homology) and coiled-coil domains, followed by a SH2
domain, and a C-terminal catalytic domain. Fer kinase
is expressed in a wide variety of tissues, and is found
to reside in both the cytoplasm and the nucleus. It
plays important roles in neuronal polarization and
neurite development, cytoskeletal reorganization, cell
migration, growth factor signaling, and the regulation
of cell-cell interactions mediated by adherens
junctions and focal adhesions. Fer kinase also
regulates cell cycle progression in malignant cells.
Length = 250
Score = 35.7 bits (82), Expect = 5e-04
Identities = 15/37 (40%), Positives = 22/37 (59%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKK 42
HPNI+ + V R+ + +VME GG+ FL +KK
Sbjct: 51 HPNIVKLIGVCTQRQPIYIVMELVPGGDFLSFLRKKK 87
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional.
Length = 478
Score = 35.8 bits (82), Expect = 6e-04
Identities = 19/68 (27%), Positives = 37/68 (54%), Gaps = 4/68 (5%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKV----LTEEEARRIFRQI 56
+++ H I+ ++ F++ +K++L+MEY +GG+L + Q+ E E +F QI
Sbjct: 119 LAACDHFGIVKHFDDFKSDDKLLLIMEYGSGGDLNKQIKQRLKEHLPFQEYEVGLLFYQI 178
Query: 57 ATAVYYCH 64
A+ H
Sbjct: 179 VLALDEVH 186
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine
Kinases, Anaplastic Lymphoma Kinase and Leukocyte
Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family;
Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine
(tyr) Kinase (LTK); catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to tyr
residues in protein substrates. ALK and LTK are orphan
receptor tyr kinases (RTKs) whose ligands are not yet
well-defined. RTKs contain an extracellular
ligand-binding domain, a transmembrane region, and an
intracellular tyr kinase domain. They are usually
activated through ligand binding, which causes
dimerization and autophosphorylation of the
intracellular tyr kinase catalytic domain. ALK appears
to play an important role in mammalian neural
development as well as visceral muscle differentiation
in Drosophila. ALK is aberrantly expressed as fusion
proteins, due to chromosomal translocations, in about
60% of anaplastic large cell lymphomas (ALCLs). ALK
fusion proteins are also found in rare cases of diffuse
large B cell lymphomas (DLBCLs). LTK is mainly expressed
in B lymphocytes and neuronal tissues. It is important
in cell proliferation and survival. Transgenic mice
expressing TLK display retarded growth and high
mortality rate. In addition, a polymorphism in mouse and
human LTK is implicated in the pathogenesis of systemic
lupus erythematosus.
Length = 277
Score = 35.5 bits (82), Expect = 6e-04
Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 7/69 (10%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL-------DQKKVLTEEEARRIF 53
MS H NI+ + V R +++E AGG+L FL ++ LT ++
Sbjct: 63 MSKFNHQNIVRLIGVSFERLPRFILLELMAGGDLKSFLRENRPRPERPSSLTMKDLLFCA 122
Query: 54 RQIATAVYY 62
R +A Y
Sbjct: 123 RDVAKGCKY 131
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase 10.
Serine/Threonine Kinases (STKs), Cyclin-dependent
protein Kinase 10 (CDK10) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK10 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. CDKs belong to a
large family of STKs that are regulated by their cognate
cyclins. Together, they are involved in the control of
cell-cycle progression, transcription, and neuronal
function. CDK10, also called PISSLRE, is essential for
cell growth and proliferation, and acts through the G2/M
phase of the cell cycle. CDK10 has also been identified
as an important factor in endocrine therapy resistance
in breast cancer. CDK10 silencing increases the
transcription of c-RAF and the activation of the p42/p44
MAPK pathway, which leads to antiestrogen resistance.
Patients who express low levels of CDK10 relapse early
on tamoxifen.
Length = 309
Score = 35.4 bits (82), Expect = 6e-04
Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 4/65 (6%)
Query: 3 SVRHPNIIHIYEVFENR--EKMVLVMEYAAGGELYDFLDQ-KKVLTEEEARRIFRQIATA 59
++RHPNI+ + EV + + + LVMEY +L LD +E + + + Q+
Sbjct: 62 NLRHPNIVELKEVVVGKHLDSIFLVMEYCE-QDLASLLDNMPTPFSESQVKCLMLQLLRG 120
Query: 60 VYYCH 64
+ Y H
Sbjct: 121 LQYLH 125
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine
Kinase, Cell Division Cycle 2-like 1. Serine/Threonine
Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1)
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
CDC2L1 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. CDC2L1, also
called PITSLRE, exists in different isoforms which are
named using the alias CDK11(p). The CDC2L1 gene produces
two protein products, CDK11(p110) and CDK11(p58). CDC2L1
is also represented by the caspase-processed CDK11(p46).
CDK11(p110), the major isoform, associates with cyclin L
and is expressed throughout the cell cycle. It is
involved in RNA processing and the regulation of
transcription. CDK11(p58) associates with cyclin D3 and
is expressed during the G2/M phase of the cell cycle. It
plays roles in spindle morphogenesis, centrosome
maturation, sister chromatid cohesion, and the
completion of mitosis. CDK11(p46) is formed from the
larger isoforms by caspases during TNFalpha- and
Fas-induced apoptosis. It functions as a downstream
effector kinase in apoptotic signaling pathways and
interacts with eukaryotic initiation factor 3f (eIF3f),
p21-activated kinase (PAK1), and Ran-binding protein
(RanBPM).
Length = 293
Score = 35.3 bits (82), Expect = 7e-04
Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 4/68 (5%)
Query: 1 MSSVRHPNIIHIYEVF--ENREKMVLVMEYAAGGELYDFLDQKK-VLTEEEARRIFRQIA 57
+ ++HPNI+ + EV N +K+ +VMEY +L ++ K + E + + Q+
Sbjct: 58 LLKLQHPNIVTVKEVVVGSNLDKIYMVMEYVE-HDLKSLMETMKQPFLQSEVKCLMLQLL 116
Query: 58 TAVYYCHK 65
+ V + H
Sbjct: 117 SGVAHLHD 124
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein
Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2.
Serine/Threonine Kinases (STKs), NDR kinase subfamily,
NDR2 isoform, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The NDR
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. NDR kinase contains an N-terminal regulatory
(NTR) domain and an insert within the catalytic domain
that contains an auto-inhibitory sequence. Like many
other AGC kinases, NDR kinase requires phosphorylation
at two sites, the activation loop (A-loop) and the
hydrophobic motif (HM), for activity. Higher eukaryotes
contain two NDR isoforms, NDR1 and NDR2. Both isoforms
play a role in proper centrosome duplication. In
addition, NDR2 plays a role in regulating neuronal
growth and differentiation, as well as in facilitating
neurite outgrowth. It is also implicated in fear
conditioning as it contributes to the coupling of
neuronal morphological changes with fear-memory
consolidation. NDR2 is also referred to as STK38-like.
Length = 360
Score = 35.4 bits (81), Expect = 7e-04
Identities = 13/58 (22%), Positives = 32/58 (55%)
Query: 9 IIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCHKV 66
++ ++ F+++ + L+ME+ GG++ L +K L+EE + + A+ H++
Sbjct: 63 VVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLSEEATQFYIAETVLAIDAIHQL 120
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein
Serine/Threonine Kinase, Large Tumor Suppressor 1.
Serine/Threonine Kinases (STKs), Large Tumor Suppressor
(LATS) subfamily, LATS1 isoform, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The LATS subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. LATS functions as a tumor
suppressor and is implicated in cell cycle regulation.
Inactivation of LATS1 in mice results in the development
of various tumors, including sarcomas and ovarian
cancer. Promoter methylation, loss of heterozygosity,
and missense mutations targeting the LATS1 gene have
also been found in human sarcomas and ovarian cancers.
In addition, decreased expression of LATS1 is associated
with an aggressive phenotype and poor prognosis. LATS1
induces G2 arrest and promotes cytokinesis. It may be a
component of the mitotic exit network in higher
eukaryotes.
Length = 382
Score = 35.4 bits (81), Expect = 7e-04
Identities = 15/58 (25%), Positives = 32/58 (55%)
Query: 9 IIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCHKV 66
++ +Y F++++ + VM+Y GG++ L + + E+ AR ++ AV HK+
Sbjct: 63 VVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPEDLARFYIAELTCAVESVHKM 120
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein
Serine/Threonine Kinase, Group I p21-activated kinase.
Serine/threonine kinases (STKs), p21-activated kinase
(PAK) subfamily, Group I, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The PAK subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PAKs are Rho family GTPase-regulated kinases
that serve as important mediators in the function of
Cdc42 (cell division cycle 42) and Rac. PAKs are
implicated in the regulation of many cellular processes
including growth factor receptor-mediated proliferation,
cell polarity, cell motility, cell death and survival,
and actin cytoskeleton organization. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
Group I PAKs, also called conventional PAKs, include
PAK1, PAK2, and PAK3. Group I PAKs contain a PBD
(p21-binding domain) overlapping with an AID
(autoinhibitory domain), a C-terminal catalytic domain,
SH3 binding sites and a non-classical SH3 binding site
for PIX (PAK-interacting exchange factor). They interact
with the SH3 domain containing proteins Nck, Grb2 and
PIX. Binding of group I PAKs to activated GTPases leads
to conformational changes that destabilize the AID,
allowing autophosphorylation and full activation of the
kinase domain. Known group I PAK substrates include
MLCK, Bad, Raf, MEK1, LIMK, Merlin, Vimentin, Myc,
Stat5a, and Aurora A, among others.
Length = 293
Score = 35.3 bits (81), Expect = 7e-04
Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 1/67 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
M +HPNI++ + + +++ +VMEY AGG L D + + + E + + R+ A+
Sbjct: 70 MRENKHPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTE-TCMDEGQIAAVCRECLQAL 128
Query: 61 YYCHKVQ 67
+ H Q
Sbjct: 129 EFLHSNQ 135
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein
Serine/Threonine Kinase, Novel Protein Kinase C epsilon.
Serine/Threonine Kinases (STKs), Novel Protein Kinase C
(nPKC), epsilon isoform, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The nPKC subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PKCs are classified into three groups
(classical, atypical, and novel) depending on their mode
of activation and the structural characteristics of
their regulatory domain. nPKCs are calcium-independent,
but require DAG (1,2-diacylglycerol) and
phosphatidylserine (PS) for activity. There are four
nPKC isoforms, delta, epsilon, eta, and theta.
PKC-epsilon has been shown to behave as an oncoprotein.
Its overexpression contributes to neoplastic
transformation depending on the cell type. It
contributes to oncogenesis by inducing disordered cell
growth and inhibiting cell death. It also plays a role
in tumor invasion and metastasis. PKC-epsilon has also
been found to confer cardioprotection against ischemia
and reperfusion-mediated damage. Other cellular
functions include the regulation of gene expression,
cell adhesion, and cell motility.
Length = 321
Score = 35.2 bits (81), Expect = 8e-04
Identities = 14/63 (22%), Positives = 34/63 (53%)
Query: 3 SVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYY 62
+ +HP + ++ F+ ++++ VMEY GG+L + + + E +R ++ A+ +
Sbjct: 52 AAKHPFLTALHCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTLALMF 111
Query: 63 CHK 65
H+
Sbjct: 112 LHR 114
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase;
Provisional.
Length = 353
Score = 35.2 bits (81), Expect = 8e-04
Identities = 15/63 (23%), Positives = 35/63 (55%), Gaps = 4/63 (6%)
Query: 3 SVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYY 62
V HPN++ +++F++ ++ +++E+ GG L+ + E+ + RQI + + Y
Sbjct: 128 DVNHPNVVKCHDMFDHNGEIQVLLEFMDGGS----LEGTHIADEQFLADVARQILSGIAY 183
Query: 63 CHK 65
H+
Sbjct: 184 LHR 186
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase Like 5.
Serine/Threonine Kinases (STKs), Cyclin-dependent
protein kinase like 5 (CDKL5) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDKL5 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. CDKs belong to a
large family of STKs that are regulated by their cognate
cyclins. Together, they are involved in the control of
cell-cycle progression, transcription, and neuronal
function. Mutations in the gene encoding CDKL5,
previously called STK9, are associated with early onset
epilepsy and severe mental retardation [X-linked
infantile spasm syndrome (ISSX) or West syndrome]. In
addition, CDKL5 mutations also sometimes cause a
phenotype similar to Rett syndrome (RTT), a progressive
neurodevelopmental disorder. These pathogenic mutations
are located in the N-terminal portion of the protein
within the kinase domain.
Length = 287
Score = 35.0 bits (80), Expect = 9e-04
Identities = 18/65 (27%), Positives = 32/65 (49%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ +++ NI+ + E F R K+ LV EY L + + E+ R Q+ A+
Sbjct: 54 LRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVRSYIYQLIKAI 113
Query: 61 YYCHK 65
++CHK
Sbjct: 114 HWCHK 118
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein
Serine/Threonine Kinase, Novel Protein Kinase C theta.
Serine/Threonine Kinases (STKs), Novel Protein Kinase C
(nPKC), theta isoform, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The nPKC subfamily is part of a larger
superfamily that includes the catalytic domains of
other protein STKs, protein tyrosine kinases, RIO
kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PKCs are
classified into three groups (classical, atypical, and
novel) depending on their mode of activation and the
structural characteristics of their regulatory domain.
nPKCs are calcium-independent, but require DAG
(1,2-diacylglycerol) and phosphatidylserine (PS) for
activity. There are four nPKC isoforms, delta, epsilon,
eta, and theta. PKC-theta is selectively expressed in
T-cells and plays an important and non-redundant role
in several aspects of T-cell biology. Although T-cells
also express other PKC isoforms, PKC-theta is unique in
that upon antigen stimulation, it is translocated to
the plasma membrane at the immunological synapse, where
it mediates signals essential for T-cell activation. It
is essential for TCR-induced proliferation, cytokine
production, T-cell survival, and the differentiation
and effector function of T-helper (Th) cells,
particularly Th2 and Th17. PKC-theta is being developed
as a therapeutic target for Th2-mediated allergic
inflammation and Th17-mediated autoimmune diseases.
Length = 316
Score = 34.9 bits (80), Expect = 9e-04
Identities = 13/29 (44%), Positives = 19/29 (65%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYAAGGEL 34
HP + H+Y F+ +E + VMEY GG+L
Sbjct: 55 HPFLTHLYCTFQTKENLFFVMEYLNGGDL 83
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein
Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1.
Serine/Threonine Kinases (STKs), NDR kinase subfamily,
NDR1 isoform, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The NDR
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. NDR kinase contains an N-terminal regulatory
(NTR) domain and an insert within the catalytic domain
that contains an auto-inhibitory sequence. Like many
other AGC kinases, NDR kinase requires phosphorylation
at two sites, the activation loop (A-loop) and the
hydrophobic motif (HM), for activity. Higher eukaryotes
contain two NDR isoforms, NDR1 and NDR2. Both isoforms
play a role in proper centrosome duplication. NDR1 is
highly expressed in thymus, muscle, lung and spleen. It
is not an essential protein because mice deficient of
NDR1 remain viable and fertile. However, these mice
develop T-cell lymphomas and appear to be hypersenstive
to carcinogenic treatment. NDR1 appears to act as a
tumor suppressor. NDR1 is also called STK38.
Length = 363
Score = 35.0 bits (80), Expect = 0.001
Identities = 15/58 (25%), Positives = 33/58 (56%)
Query: 9 IIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCHKV 66
++ ++ F+++ + L+ME+ GG++ L +K LTEEE + + A+ H++
Sbjct: 63 VVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQL 120
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal
Byr2-like MAP Kinase Kinase Kinases. Serine/threonine
kinases (STKs), mitogen-activated protein kinase (MAPK)
kinase kinase (MAPKKK) subfamily, fungal Byr2-like
proteins, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MAPKKK subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Members of this group include the MAPKKKs
Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae
and Cryptococcus neoformans Ste11, and related proteins.
They contain an N-terminal SAM (sterile alpha-motif)
domain, which mediates protein-protein interaction, and
a C-terminal catalytic domain. MAPKKKs phosphorylate and
activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which
in turn phosphorylate and activate MAPKs during
signaling cascades that are important in mediating
cellular responses to extracellular signals. Fission
yeast Byr2 is regulated by Ras1. It responds to
pheromone signaling and controls mating through the MAPK
pathway. Budding yeast Ste11 functions in MAPK cascades
that regulate mating, high osmolarity glycerol, and
filamentous growth responses.
Length = 267
Score = 34.8 bits (80), Expect = 0.001
Identities = 15/64 (23%), Positives = 27/64 (42%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ ++H NI+ + + + + +EY GG + L+ E R RQI +
Sbjct: 60 LKELQHENIVQYLGSSLDADHLNIFLEYVPGGSVAALLNNYGAFEETLVRNFVRQILKGL 119
Query: 61 YYCH 64
Y H
Sbjct: 120 NYLH 123
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 7. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek7 subfamily is
one of a family of 11 different Neks (Nek1-11) that are
involved in cell cycle control. The Nek family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Nek7 is required
for mitotic spindle formation and cytokinesis. It is
enriched in the centrosome and is critical for
microtubule nucleation. Nek7 is activated by Nek9 during
mitosis, and may regulate the p70 ribosomal S6 kinase.
Length = 267
Score = 35.0 bits (80), Expect = 0.001
Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 4/68 (5%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYD----FLDQKKVLTEEEARRIFRQI 56
+ + HPN+I Y F ++ +V+E A G+L F QK+++ E+ + F Q+
Sbjct: 56 LKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPEKTVWKYFVQL 115
Query: 57 ATAVYYCH 64
+A+ + H
Sbjct: 116 CSALEHMH 123
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase,
Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK)
family; Focal Adhesion Kinase (FAK); catalytic (c)
domain. The PTKc family is part of a larger superfamily
that includes the catalytic domains of other kinases
such as protein serine/threonine kinases, RIO kinases,
and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. FAK is a
cytoplasmic (or nonreceptor) tyr kinase that contains an
autophosphorylation site and a FERM domain at the
N-terminus, a central tyr kinase domain, proline-rich
regions, and a C-terminal FAT (focal adhesion targeting)
domain. FAK activity is dependent on integrin-mediated
cell adhesion, which facilitates N-terminal
autophosphorylation. Full activation is achieved by the
phosphorylation of its two adjacent A-loop tyrosines.
FAK is important in mediating signaling initiated at
sites of cell adhesions and at growth factor receptors.
Through diverse molecular interactions, FAK functions as
a biosensor or integrator to control cell motility. It
is a key regulator of cell survival, proliferation,
migration and invasion, and thus plays an important role
in the development and progression of cancer. Src binds
to autophosphorylated FAK forming the FAK-Src dual
kinase complex, which is activated in a wide variety of
tumor cells and generates signals promoting growth and
metastasis. FAK is being developed as a target for
cancer therapy.
Length = 270
Score = 34.7 bits (80), Expect = 0.001
Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIF-RQIATA 59
M HP+I+ + V + +VME A GEL +L K + + ++ Q++TA
Sbjct: 61 MRQFDHPHIVKLIGVITE-NPVWIVMELAPLGELRSYLQVNKYSLDLASLILYSYQLSTA 119
Query: 60 VYYCH 64
+ Y
Sbjct: 120 LAYLE 124
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein
Serine/Threonine Kinase, Novel Protein Kinase C eta.
Serine/Threonine Kinases (STKs), Novel Protein Kinase C
(nPKC), eta isoform, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
nPKC subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PKCs are classified into three groups
(classical, atypical, and novel) depending on their mode
of activation and the structural characteristics of
their regulatory domain. nPKCs are calcium-independent,
but require DAG (1,2-diacylglycerol) and
phosphatidylserine (PS) for activity. There are four
nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta
is predominantly expressed in squamous epithelia, where
it plays a crucial role in the signaling of cell-type
specific differentiation. It is also expressed in pro-B
cells and early-stage thymocytes, and acts as a key
regulator in early B-cell development. PKC-eta increases
glioblastoma multiforme (GBM) proliferation and
resistance to radiation, and is being developed as a
therapeutic target for the management of GBM.
Length = 320
Score = 34.9 bits (80), Expect = 0.001
Identities = 16/59 (27%), Positives = 31/59 (52%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCH 64
HP + +Y F+ +++ VME+ GG+L + + + E AR +I +A+ + H
Sbjct: 55 HPFLTQLYCCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEITSALMFLH 113
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent
protein Kinase 1-like Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase 1 (CDK1)-like subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK1 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. CDKs belong to a
large family of STKs that are regulated by their cognate
cyclins. Together, they are involved in the control of
cell-cycle progression, transcription, and neuronal
function. This subfamily is composed of CDK1 from higher
eukaryotes, plants, and yeasts, as well as CDK2 and
CDK3. CDK1 is also called Cell division control protein
2 (Cdc2) or p34 protein kinase, and is regulated by
cyclins A, B, and E. The CDK1/cyclin A complex controls
G2 phase entry and progression while the CDK1/cyclin B
complex is critical for G2 to M phase transition. CDK2
is regulated by cyclin E or cyclin A. Upon activation by
cyclin E, it phosphorylates the retinoblastoma (pRb)
protein which activates E2F mediated transcription and
allows cells to move into S phase. The CDK2/cyclin A
complex plays a role in regulating DNA replication.
Studies in knockout mice revealed that CDK1 can
compensate for the loss of the cdk2 gene as it can also
bind cyclin E and drive G1 to S phase transition. CDK3
is regulated by cyclin C and it phosphorylates pRB
specifically during the G0/G1 transition. This
phosphorylation is required for cells to exit G0
efficiently and enter the G1 phase.
Length = 283
Score = 34.6 bits (80), Expect = 0.001
Identities = 16/64 (25%), Positives = 30/64 (46%), Gaps = 3/64 (4%)
Query: 3 SVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKV--LTEEEARRIFRQIATAV 60
+ HPNI+ + +V + K+ LV E+ +L ++D + L + Q+ +
Sbjct: 54 ELNHPNIVRLLDVVHSENKLYLVFEF-LDLDLKKYMDSSPLTGLDPPLIKSYLYQLLQGI 112
Query: 61 YYCH 64
YCH
Sbjct: 113 AYCH 116
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 6. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Nek6 subfamily is
one of a family of 11 different Neks (Nek1-11) that are
involved in cell cycle control. The Nek family is part
of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Nek6 is required
for the transition from metaphase to anaphase. It also
plays important roles in mitotic spindle formation and
cytokinesis. Activated by Nek9 during mitosis, Nek6
phosphorylates Eg5, a kinesin that is important for
spindle bipolarity. Nek6 localizes to spindle
microtubules during metaphase and anaphase, and to the
midbody during cytokinesis.
Length = 267
Score = 34.2 bits (78), Expect = 0.002
Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 4/68 (5%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYD----FLDQKKVLTEEEARRIFRQI 56
+ + HPN+I + F ++ +V+E A G+L F QK+++ E + F Q+
Sbjct: 56 LKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQL 115
Query: 57 ATAVYYCH 64
+AV + H
Sbjct: 116 CSAVEHMH 123
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic
subunit; Provisional.
Length = 340
Score = 34.6 bits (79), Expect = 0.002
Identities = 13/42 (30%), Positives = 26/42 (61%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKK 42
++ + HP +++Y F++ + LV+E+ GGE + FL + K
Sbjct: 85 LNYINHPFCVNLYGSFKDESYLYLVLEFVIGGEFFTFLRRNK 126
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like
Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK)
family; Human Fyn-related kinase (Frk) and similar
proteins; catalytic (c) domain. The PTKc family is part
of a larger superfamily that includes the catalytic
domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Frk and
Srk are members of the Src subfamily of proteins, which
are cytoplasmic (or non-receptor) tyr kinases. Src
kinases contain an N-terminal SH4 domain with a
myristoylation site, followed by SH3 and SH2 domains, a
tyr kinase domain, and a regulatory C-terminal region
containing a conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). Src
proteins are involved in signaling pathways that
regulate cytokine and growth factor responses,
cytoskeleton dynamics, cell proliferation, survival, and
differentiation. Frk, also known as Rak, is specifically
expressed in liver, lung, kidney, intestine, mammary
glands, and the islets of Langerhans. Rodent homologs
were previously referred to as GTK (gastrointestinal tyr
kinase), BSK (beta-cell Src-like kinase), or IYK
(intestinal tyr kinase). Studies in mice reveal that Frk
is not essential for viability. It plays a role in the
signaling that leads to cytokine-induced beta-cell death
in Type I diabetes. It also regulates beta-cell number
during embryogenesis and early in life.
Length = 261
Score = 33.9 bits (78), Expect = 0.002
Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 2/64 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL--DQKKVLTEEEARRIFRQIAT 58
M +RHP +I +Y V E + +V E G L ++L + L + + Q+A+
Sbjct: 55 MKKLRHPKLIQLYAVCTLEEPIYIVTELMKYGSLLEYLQGGAGRALKLPQLIDMAAQVAS 114
Query: 59 AVYY 62
+ Y
Sbjct: 115 GMAY 118
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein
kinase; Provisional.
Length = 968
Score = 34.1 bits (78), Expect = 0.002
Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 3/64 (4%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
M ++HPNI+ + + + + L+ EY G L + L L+ E R+I IA A+
Sbjct: 737 MGKLQHPNIVKLIGLCRSEKGAYLIHEYIEGKNLSEVLRN---LSWERRRKIAIGIAKAL 793
Query: 61 YYCH 64
+ H
Sbjct: 794 RFLH 797
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein
Tyrosine Kinases. Protein Tyrosine Kinase (PTK)
family; Tyrosine kinase expressed in hepatocellular
carcinoma (Tec) subfamily; catalytic (c) domain. The
Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk
(Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc
family is part of a larger superfamily that includes
the catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Tec
kinases are cytoplasmic (or nonreceptor) tyr kinases
(nRTKs) with similarity to Src kinases in that they
contain Src homology protein interaction domains (SH3,
SH2) N-terminal to the catalytic tyr kinase domain.
Unlike Src kinases, most Tec subfamily members (except
Rlk) also contain an N-terminal pleckstrin homology
(PH) domain, which binds the products of PI3K and
allows membrane recruitment and activation. In
addition, some members contain the Tec homology (TH)
domain, which contains proline-rich and zinc-binding
regions. Tec kinases form the second largest subfamily
of nRTKs and are expressed mainly by haematopoietic
cells, although Tec and Bmx are also found in
endothelial cells. B-cells express Btk and Tec, while
T-cells express Itk, Txk, and Tec. Collectively, Tec
kinases are expressed in a variety of myeloid cells
such as mast cells, platelets, macrophages, and
dendritic cells. Each Tec kinase shows a distinct
cell-type pattern of expression. The function of Tec
kinases in lymphoid cells have been studied
extensively. They play important roles in the
development, differentiation, maturation, regulation,
survival, and function of B-cells and T-cells.
Mutations in Btk cause the severe B-cell
immunodeficiency, X-linked agammaglobulinaemia (XLA).
Length = 256
Score = 33.6 bits (77), Expect = 0.003
Identities = 14/42 (33%), Positives = 25/42 (59%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKK 42
M + HPN++ +Y V + + +V EY A G L ++L ++K
Sbjct: 53 MMKLSHPNLVQLYGVCTKQRPIFIVTEYMANGCLLNYLRERK 94
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine
Kinases, Discoidin Domain Receptors. Protein Tyrosine
Kinase (PTK) family; Discoidin Domain Receptor (DDR)
subfamily; catalytic (c) domain. The DDR subfamily
consists of homologs of mammalian DDR1, DDR2, and
similar proteins. The PTKc family is part of a larger
superfamily that includes the catalytic domains of other
kinases such as protein serine/threonine kinases, RIO
kinases, and phosphoinositide 3-kinase (PI3K). PTKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to tyrosine (tyr) residues in protein substrates.
DDR subfamily members are receptor tyr kinases (RTKs)
containing an extracellular discoidin homology domain, a
transmembrane segment, an extended juxtamembrane region,
and an intracellular catalytic domain. The binding of
the ligand, collagen, to DDRs results in a slow but
sustained receptor activation. DDRs regulate cell
adhesion, proliferation, and extracellular matrix
remodeling. They have been linked to a variety of human
cancers including breast, colon, ovarian, brain, and
lung. There is no evidence showing that DDRs act as
transforming oncogenes. They are more likely to play a
role in the regulation of tumor growth and metastasis.
Length = 296
Score = 33.5 bits (77), Expect = 0.003
Identities = 12/38 (31%), Positives = 19/38 (50%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
+S + PNI + V + ++MEY G+L FL
Sbjct: 73 LSRLSDPNIARLLGVCTVDPPLCMIMEYMENGDLNQFL 110
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent
protein Kinase 4 and 6-like Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Cyclin-dependent
protein kinase 4 (CDK4) and CDK6-like subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK4/6-like
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CDKs belong to a large family of STKs that are
regulated by their cognate cyclins. Together, they are
involved in the control of cell-cycle progression,
transcription, and neuronal function. CDK4 and CDK6
partner with D-type cyclins to regulate the early G1
phase of the cell cycle. They are the first kinase
activated by mitogenic signals to release cells from the
G0 arrested state. CDK4 and CDK6 are both expressed
ubiquitously, associate with all three D cyclins (D1, D2
and D3), and phosphorylate the retinoblastoma (pRb)
protein. They are also regulated by the INK4 family of
inhibitors which associate with either the CDK alone or
the CDK/cyclin complex. CDK4 and CDK6 show differences
in subcellular localization, sensitivity to some
inhibitors, timing in activation, tumor selectivity, and
possibly substrate profiles. Although CDK4 and CDK6 seem
to show some redundancy, they also have discrete,
nonoverlapping functions. CDK6 plays an important role
in cell differentiation.
Length = 287
Score = 33.4 bits (77), Expect = 0.004
Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 8/66 (12%)
Query: 6 HPNIIHIYEVFEN----RE-KMVLVMEYAAGGELYDFLDQ--KKVLTEEEARRIFRQIAT 58
HPNI+ + +V RE K+ LV E+ +L +L + K L E + + RQ+
Sbjct: 60 HPNIVRLLDVCHGPRTDRELKLTLVFEHVD-QDLATYLSKCPKPGLPPETIKDLMRQLLR 118
Query: 59 AVYYCH 64
V + H
Sbjct: 119 GVDFLH 124
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase 1 from higher
eukaryotes-like. Serine/Threonine Kinases (STKs),
Cyclin-Dependent protein Kinase 1 (CDK1) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK1 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. CDKs belong to a
large family of STKs that are regulated by their cognate
cyclins. Together, they are involved in the control of
cell-cycle progression, transcription, and neuronal
function. This subfamily is composed of CDK1 from higher
eukaryotes. CDK1 is also called Cell division control
protein 2 (Cdc2) or p34 protein kinase, and is regulated
by cyclins A, B, and E. The CDK1/cyclin A complex
controls G2 phase entry and progression. CDK1/cyclin A2
has also been implicated as an important regulator of S
phase events. The CDK1/cyclin B complex is critical for
G2 to M phase transition. It induces mitosis by
activating nuclear enzymes that regulate chromatin
condensation, nuclear membrane degradation,
mitosis-specific microtubule and cytoskeletal
reorganization. CDK1 also associates with cyclin E and
plays a role in the entry into S phase. CDK1
transcription is stable throughout the cell cycle but is
modulated in some pathological conditions. It may play a
role in regulating apoptosis under these conditions. In
breast cancer cells, HER2 can mediate apoptosis by
inactivating CDK1. Activation of CDK1 may contribute to
HIV-1 induced apoptosis and neuronal apoptosis in
neurodegenerative diseases.
Length = 285
Score = 33.2 bits (76), Expect = 0.004
Identities = 15/65 (23%), Positives = 32/65 (49%), Gaps = 4/65 (6%)
Query: 4 VRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQ---KKVLTEEEARRIFRQIATAV 60
++HPNI+ + +V ++ L+ E+ + +L +LD + + E + QI +
Sbjct: 56 LQHPNIVCLQDVLMQESRLYLIFEFLS-MDLKKYLDSLPKGQYMDAELVKSYLYQILQGI 114
Query: 61 YYCHK 65
+CH
Sbjct: 115 LFCHS 119
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein
Serine/Threonine Kinase, Citron Rho-interacting kinase.
Serine/Threonine Kinases (STKs), Citron Rho-interacting
kinase (CRIK) subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The CRIK subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. CRIK is also called citron kinase. It contains
a catalytic domain, a central coiled-coil domain, and a
C-terminal region containing a Rho-binding domain (RBD),
a zinc finger, and a pleckstrin homology (PH) domain, in
addition to other motifs. CRIK, an effector of the small
GTPase Rho, plays an important function during
cytokinesis and affects its contractile process.
CRIK-deficient mice show severe ataxia and epilepsy as a
result of abnormal cytokinesis and massive apoptosis in
neuronal precursors. A Down syndrome critical region
protein TTC3 interacts with CRIK and inhibits
CRIK-dependent neuronal differentiation and neurite
extension.
Length = 330
Score = 33.3 bits (76), Expect = 0.004
Identities = 17/65 (26%), Positives = 34/65 (52%), Gaps = 1/65 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQ-KKVLTEEEARRIFRQIATA 59
+S P I + F++++ + LVMEY GG+L L++ + E+ A+ ++ A
Sbjct: 55 LSISNSPWIPQLQYAFQDKDNLYLVMEYQPGGDLLSLLNRYEDQFDEDMAQFYLAELVLA 114
Query: 60 VYYCH 64
++ H
Sbjct: 115 IHSVH 119
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine
Kinase, Muscle-specific kinase. Protein Tyrosine
Kinase (PTK) family; Muscle-specific kinase (Musk);
catalytic (c) domain. The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. Musk is a receptor tyr
kinase (RTK) containing an extracellular region with
four immunoglobulin-like domains and a cysteine-rich
cluster, a transmembrane segment, and an intracellular
catalytic domain. Musk is expressed and concentrated in
the postsynaptic membrane in skeletal muscle. It is
essential for the establishment of the neuromuscular
junction (NMJ), a peripheral synapse that conveys
signals from motor neurons to muscle cells. Agrin, a
large proteoglycan released from motor neurons,
stimulates Musk autophosphorylation and activation,
leading to the clustering of acetylcholine receptors
(AChRs). To date, there is no evidence to suggest that
agrin binds directly to Musk. Mutations in AChR, Musk
and other partners are responsible for diseases of the
NMJ, such as the autoimmune syndrome myasthenia gravis.
Length = 288
Score = 33.3 bits (76), Expect = 0.004
Identities = 15/38 (39%), Positives = 22/38 (57%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
M+ HPNI+ + V + M L+ EY A G+L +FL
Sbjct: 62 MAEFDHPNIVKLLGVCAVGKPMCLLFEYMAYGDLNEFL 99
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine
Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn
kinase; catalytic (c) domain. The PTKc family is part
of a larger superfamily that includes the catalytic
domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Lyn is a
member of the Src subfamily of proteins, which are
cytoplasmic (or non-receptor) tyr kinases. Src kinases
contain an N-terminal SH4 domain with a myristoylation
site, followed by SH3 and SH2 domains, a tyr kinase
domain, and a regulatory C-terminal region containing a
conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). Src
proteins are involved in signaling pathways that
regulate cytokine and growth factor responses,
cytoskeleton dynamics, cell proliferation, survival,
and differentiation. Lyn is expressed in B lymphocytes
and myeloid cells. It exhibits both positive and
negative regulatory roles in B cell receptor (BCR)
signaling. Lyn, as well as Fyn and Blk, promotes B cell
activation by phosphorylating ITAMs (immunoreceptor tyr
activation motifs) in CD19 and in Ig components of BCR.
It negatively regulates signaling by its unique ability
to phosphorylate ITIMs (immunoreceptor tyr inhibition
motifs) in cell surface receptors like CD22 and CD5.
Lyn also plays an important role in G-CSF receptor
signaling by phosphorylating a variety of adaptor
molecules.
Length = 261
Score = 33.1 bits (75), Expect = 0.005
Identities = 13/38 (34%), Positives = 22/38 (57%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
M +++H ++ +Y V E + ++ EY A G L DFL
Sbjct: 55 MKTLQHDKLVRLYAVVTKEEPIYIITEYMAKGSLLDFL 92
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional.
Length = 1021
Score = 33.2 bits (75), Expect = 0.005
Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 6/74 (8%)
Query: 1 MSSVRHPNIIHIYEVFENR--EKMVLVMEYAAGGELYDFLDQKKVL---TEEEA-RRIFR 54
M ++H NI+ + F N+ +K+ ++ME+ G+L + + + EE A I R
Sbjct: 66 MRELKHKNIVRYIDRFLNKANQKLYILMEFCDAGDLSRNIQKCYKMFGKIEEHAIVDITR 125
Query: 55 QIATAVYYCHKVQD 68
Q+ A+ YCH ++D
Sbjct: 126 QLLHALAYCHNLKD 139
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein
Serine/Threonine Kinase, Classical Protein Kinase C
alpha. Serine/Threonine Kinases (STKs), Classical
Protein Kinase C (cPKC) subfamily, alpha isoform,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The cPKC subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PKCs are
classified into three groups (classical, atypical, and
novel) depending on their mode of activation and the
structural characteristics of their regulatory domain.
PKCs undergo three phosphorylations in order to take
mature forms. In addition, cPKCs depend on calcium, DAG
(1,2-diacylglycerol), and in most cases,
phosphatidylserine (PS) for activation. There are four
cPKC isoforms, named alpha, betaI, betaII, and gamma.
PKC-alpha is expressed in many tissues and is associated
with cell proliferation, apoptosis, and cell motility.
It plays a role in the signaling of the growth factors
PDGF, VEGF, EGF, and FGF. Abnormal levels of PKC-alpha
have been detected in many transformed cell lines and
several human tumors. In addition, PKC-alpha is required
for HER2 dependent breast cancer invasion.
Length = 323
Score = 32.7 bits (74), Expect = 0.006
Identities = 14/59 (23%), Positives = 30/59 (50%)
Query: 7 PNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCHK 65
P + ++ F+ +++ VMEY GG+L + Q E +A +I+ +++ H+
Sbjct: 61 PFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISVGLFFLHR 119
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase
1-like Protein Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Yeast protein kinase 1
(YPK1)-like subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The YPK1-like subfamily is part of a larger superfamily
that includes the catalytic domains of other protein
STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. This subfamily is composed of
fungal proteins with similarity to the AGC STKs,
Saccharomyces cerevisiae YPK1 and Schizosaccharomyces
pombe Gad8p. YPK1 is required for cell growth and acts
as a downstream kinase in the sphingolipid-mediated
signaling pathway of yeast. It also plays a role in
efficient endocytosis and in the maintenance of cell
wall integrity. Gad8p is a downstream target of Tor1p,
the fission yeast homolog of mTOR. It plays a role in
cell growth and sexual development.
Length = 312
Score = 32.6 bits (74), Expect = 0.006
Identities = 18/65 (27%), Positives = 33/65 (50%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
++ V P I+ + F++ EK+ LV+ + GGEL+ L ++ AR ++ A+
Sbjct: 47 LAQVNCPFIVPLKFSFQSPEKLYLVLAFINGGELFHHLQREGRFDLSRARFYTAELLCAL 106
Query: 61 YYCHK 65
HK
Sbjct: 107 ENLHK 111
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine
Kinase, REarranged during Transfection protein.
Protein Tyrosine Kinase (PTK) family; RET (REarranged
during Transfection) protein; catalytic (c) domain. The
PTKc family is part of a larger superfamily that
includes the catalytic domains of other kinases such as
protein serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. RET is a
receptor tyr kinase (RTK) containing an extracellular
region with four cadherin-like repeats, a
calcium-binding site, and a cysteine-rich domain, a
transmembrane segment, and an intracellular catalytic
domain. It is part of a multisubunit complex that binds
glial-derived neurotropic factor (GDNF) family ligands
(GFLs) including GDNF, neurturin, artemin, and
persephin. GFLs bind RET along with four GPI-anchored
coreceptors, bringing two RET molecules together,
leading to autophosphorylation, activation, and
intracellular signaling. RET is essential for the
development of the sympathetic, parasympathetic and
enteric nervous systems, and the kidney. RET disruption
by germline mutations causes diseases in humans
including congenital aganglionosis of the
gastrointestinal tract (Hirschsprung's disease) and
three related inherited cancers: multiple endocrine
neoplasia type 2A (MEN2A), MEN2B, and familial
medullary thyroid carcinoma (FMTC).
Length = 290
Score = 32.6 bits (74), Expect = 0.006
Identities = 13/42 (30%), Positives = 23/42 (54%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKK 42
+ V HP++I +Y ++L++EYA G L FL + +
Sbjct: 57 LKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRSFLRESR 98
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine
Kinases, Tropomyosin Related Kinases. Protein Tyrosine
Kinase (PTK) family; Tropomyosin Related Kinase (Trk)
subfamily; catalytic (c) domain. The Trk subfamily
consists of TrkA, TrkB, TrkC, and similar proteins. The
PTKc family is part of a larger superfamily that
includes the catalytic domains of other kinases such as
protein serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Trk
subfamily members are receptor tyr kinases (RTKs)
containing an extracellular region with arrays of
leucine-rich motifs flanked by two cysteine-rich
clusters followed by two immunoglobulin-like domains, a
transmembrane segment, and an intracellular catalytic
domain. Binding to their ligands, the nerve growth
factor (NGF) family of neutrotrophins, leads to Trk
receptor oligomerization and activation of the catalytic
domain. Trk receptors are mainly expressed in the
peripheral and central nervous systems. They play
important roles in cell fate determination, neuronal
survival and differentiation, as well as in the
regulation of synaptic plasticity. Altered expression of
Trk receptors is associated with many human diseases.
Length = 280
Score = 32.8 bits (75), Expect = 0.006
Identities = 19/76 (25%), Positives = 32/76 (42%), Gaps = 14/76 (18%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL--------------DQKKVLTE 46
+++ +H NI+ Y V + ++V EY G+L FL LT
Sbjct: 62 LTNFQHENIVKFYGVCTEGDPPIMVFEYMEHGDLNKFLRSHGPDAAFLKSPDSPMGELTL 121
Query: 47 EEARRIFRQIATAVYY 62
+ +I QIA+ + Y
Sbjct: 122 SQLLQIAVQIASGMVY 137
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine
Kinase, C-ros. Protein Tyrosine Kinases (PTK) family;
C-ros and Drosophila Sevenless proteins; catalytic (c)
domain. The PTKc family is part of a larger superfamily
that includes the catalytic domains of other kinases
such as protein serine/threonine kinases, RIO kinases,
and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. The
proto-oncogene c-ros encodes an orphan receptor tyr
kinase (RTK) with an unknown ligand. RTKs contain an
extracellular ligand-binding domain, a transmembrane
region, and an intracellular tyr kinase domain. RTKs
are usually activated through ligand binding, which
causes dimerization and autophosphorylation of the
intracellular tyr kinase catalytic domain. C-ros is
expressed in embryonic cells of the kidney, intestine
and lung, but disappears soon after birth. It persists
only in the adult epididymis. Male mice bearing
inactive mutations of c-ros lack the initial segment of
the epididymis and are infertile. The Drosophila
protein, Sevenless, is required for the specification
of the R7 photoreceptor cell during eye development.
Length = 269
Score = 32.5 bits (74), Expect = 0.007
Identities = 15/43 (34%), Positives = 23/43 (53%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKV 43
MS+ HPNI+ + V E ++ME GG+L +L +V
Sbjct: 53 MSNFNHPNIVKLLGVCLLNEPQYIIMELMEGGDLLSYLRDARV 95
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein
Serine/Threonine Kinase, p21-activated kinase 1.
Serine/threonine kinases (STKs), p21-activated kinase
(PAK) 1, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The PAK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PAKs are Rho family GTPase-regulated kinases
that serve as important mediators in the function of
Cdc42 (cell division cycle 42) and Rac. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
PAK1 belongs to group I. Group I PAKs contain a PBD
(p21-binding domain) overlapping with an AID
(autoinhibitory domain), a C-terminal catalytic domain,
SH3 binding sites and a non-classical SH3 binding site
for PIX (PAK-interacting exchange factor). PAK1 is
important in the regulation of many cellular processes
including cytoskeletal dynamics, cell motility, growth,
and proliferation. Although PAK1 has been regarded
mainly as a cytosolic protein, recent reports indicate
that PAK1 also exists in significant amounts in the
nucleus, where it is involved in transcription
modulation and in cell cycle regulatory events. PAK1 is
also involved in transformation and tumorigenesis. Its
overexpression, hyperactivation and increased nuclear
accumulation is correlated to breast cancer invasiveness
and progression. Nuclear accumulation is also linked to
tamoxifen resistance in breast cancer cells.
Length = 296
Score = 32.4 bits (73), Expect = 0.007
Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 1/67 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
M ++PNI++ + + +++ +VMEY AGG L D + + + E + + R+ A+
Sbjct: 71 MRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTE-TCMDEGQIAAVCRECLQAL 129
Query: 61 YYCHKVQ 67
+ H Q
Sbjct: 130 EFLHSNQ 136
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like
Protein Serine/Threonine Kinases. Serine/threonine
kinases (STKs), Nak1 subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The Nak1 subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. This subfamily is composed of
Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae
Kic1p (kinase that interacts with Cdc31p) and related
proteins. Nak1 (also known as N-rich kinase 1), is
required by fission yeast for polarizing the tips of
actin cytoskeleton and is involved in cell growth, cell
separation, cell morphology and cell-cycle progression.
Kic1p is required by budding yeast for cell integrity
and morphogenesis. Kic1p interacts with Cdc31p, the
yeast homologue of centrin, and phosphorylates
substrates in a Cdc31p-dependent manner.
Length = 277
Score = 32.4 bits (74), Expect = 0.007
Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 4/69 (5%)
Query: 1 MSSVRH---PNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIA 57
+S +R PNI Y + ++ ++MEYA GG + + + E+ I R++
Sbjct: 53 LSQLRQSQPPNITKYYGSYLKGPRLWIIMEYAEGGSVRTLMKAGP-IAEKYISVIIREVL 111
Query: 58 TAVYYCHKV 66
A+ Y HKV
Sbjct: 112 VALKYIHKV 120
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein
Serine/Threonine Kinase, STK10 or Lymphocyte-oriented
kinase. Serine/threonine kinases (STKs), STK10
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
STK10 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Other names for STK10 include
lymphocyte-oriented kinase (LOK) and Xenopus polo-like
kinase kinase 1 (xPlkk1). STK10 is highly expressed in
lymphocytes and is responsible in regulating leukocyte
function associated antigen (LFA-1)-mediated lymphocyte
adhesion. It plays a role in regulating the CD28
responsive element in T cells, and may also function as
a regulator of polo-like kinase 1 (Plk1), a protein
which is overexpressed in multiple tumor types.
Length = 292
Score = 32.7 bits (74), Expect = 0.007
Identities = 18/68 (26%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGEL-YDFLDQKKVLTEEEARRIFRQIATA 59
+++ HP I+ + F K+ +++E+ GG + L+ + LTE + + I RQ+ A
Sbjct: 63 LATCNHPYIVKLLGAFYWDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVICRQMLEA 122
Query: 60 VYYCHKVQ 67
+ Y H ++
Sbjct: 123 LQYLHSMK 130
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein
Serine/Threonine Kinase, p21-activated kinase 3.
Serine/threonine kinases (STKs), p21-activated kinase
(PAK) 3, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The PAK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PAKs are Rho family GTPase-regulated kinases
that serve as important mediators in the function of
Cdc42 (cell division cycle 42) and Rac. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
PAK3 belongs to group I. Group I PAKs contain a PBD
(p21-binding domain) overlapping with an AID
(autoinhibitory domain), a C-terminal catalytic domain,
SH3 binding sites and a non-classical SH3 binding site
for PIX (PAK-interacting exchange factor). PAK3 is
highly expressed in the brain. It is implicated in
neuronal plasticity, synapse formation, dendritic spine
morphogenesis, cell cycle progression, neuronal
migration, and apoptosis. Inactivating mutations in the
PAK3 gene cause X-linked non-syndromic mental
retardation, the severity of which depends on the site
of the mutation.
Length = 297
Score = 32.4 bits (73), Expect = 0.008
Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 1/67 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
M ++PNI++ + + +++ +VMEY AGG L D + + + E + + R+ A+
Sbjct: 70 MRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTE-TCMDEGQIAAVCRECLQAL 128
Query: 61 YYCHKVQ 67
+ H Q
Sbjct: 129 DFLHSNQ 135
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein
Serine/Threonine Kinase, Never In Mitosis gene A-related
kinase 11. Serine/Threonine Kinases (STKs), Never In
Mitosis gene A (NIMA)-related kinase 11 (Nek11)
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
Nek11 subfamily is one of a family of 11 different Neks
(Nek1-11) that are involved in cell cycle control. The
Nek family is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Nek11 is involved, through direct
phosphorylation, in regulating the degradation of Cdc25A
(Cell Division Cycle 25 homolog A), which plays a role
in cell cycle progression and in activating cyclin
dependent kinases. Nek11 is activated by CHK1
(CHeckpoint Kinase 1) and may be involved in the G2/M
checkpoint. Nek11 may also play a role in the S-phase
checkpoint as well as in DNA replication and genotoxic
stress responses.
Length = 260
Score = 32.2 bits (73), Expect = 0.009
Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 4/69 (5%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQ----KKVLTEEEARRIFRQI 56
+S + HP I+ + F R+ ++ EY G +L L++ K L+E + F Q+
Sbjct: 56 LSKLDHPAIVKFHASFLERDAFCIITEYCEGRDLDCKLEELKHTGKTLSENQVCEWFIQL 115
Query: 57 ATAVYYCHK 65
V+Y H+
Sbjct: 116 LLGVHYMHQ 124
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit;
Provisional.
Length = 329
Score = 32.1 bits (73), Expect = 0.009
Identities = 14/59 (23%), Positives = 30/59 (50%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCH 64
HP I+++ F++ ++ ++E+ GGEL+ L + + A+ ++ A Y H
Sbjct: 77 HPFIVNMMCSFQDENRVYFLLEFVVGGELFTHLRKAGRFPNDVAKFYHAELVLAFEYLH 135
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine
Kinase, Discoidin Domain Receptor 2. Protein Tyrosine
Kinase (PTK) family; mammalian Discoidin Domain Receptor
2 (DDR2) and homologs; catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. DDR2 is a
member of the DDR subfamily, which are receptor tyr
kinases (RTKs) containing an extracellular discoidin
homology domain, a transmembrane segment, an extended
juxtamembrane region, and an intracellular catalytic
domain. The binding of the ligand, collagen, to DDRs
results in a slow but sustained receptor activation.
DDR2 binds mostly to fibrillar collagens. More recently,
it has been reported to also bind collagen X. DDR2 is
widely expressed in many tissues with the highest levels
found in skeletal muscle, skin, kidney and lung. It is
important in cell proliferation and development. Mice,
with a deletion of DDR2, suffer from dwarfism and
delayed healing of epidermal wounds. DDR2 also
contributes to collagen (type I) regulation by
inhibiting fibrillogenesis and altering the morphology
of collagen fibers. It is also expressed in immature
dendritic cells (DCs), where it plays a role in DC
activation and function.
Length = 296
Score = 32.2 bits (73), Expect = 0.011
Identities = 13/38 (34%), Positives = 21/38 (55%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
MS ++ PNII + V + + ++ EY G+L FL
Sbjct: 73 MSRLKDPNIIRLLAVCITSDPLCMITEYMENGDLNQFL 110
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein
Serine/Threonine Kinase, p21-activated kinase 5.
Serine/threonine kinases (STKs), p21-activated kinase
(PAK) 5, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The PAK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PAKs are Rho family GTPase-regulated kinases
that serve as important mediators in the function of
Cdc42 (cell division cycle 42) and Rac. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
PAK5 belongs to group II. Group II PAKs contain a PBD
(p21-binding domain) and a C-terminal catalytic domain,
but do not harbor an AID (autoinhibitory domain) or SH3
binding sites. PAK5 is mainly expressed in the brain. It
is not required for viability, but together with PAK6,
it is required for normal levels of locomotion and
activity, and for learning and memory. PAK5 cooperates
with Inca (induced in neural crest by AP2) in the
regulation of cell adhesion and cytoskeletal
organization in the embryo and in neural crest cells
during craniofacial development. PAK5 may also play a
role in controlling the signaling of Raf-1, an effector
of Ras, at the mitochondria.
Length = 292
Score = 31.9 bits (72), Expect = 0.011
Identities = 16/64 (25%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
M H N++ +Y + +++ +VME+ GG L D + + + EE+ + + A+
Sbjct: 73 MRDYHHENVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIATVCLSVLRAL 131
Query: 61 YYCH 64
Y H
Sbjct: 132 SYLH 135
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine
Kinases, Class EphB Ephrin Receptors. Protein Tyrosine
Kinase (PTK) family; Ephrin Receptor (EphR) subfamily;
class EphB receptors; catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes
the catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. EphRs
comprise the largest subfamily of receptor tyr kinases
(RTKs). Class EphB receptors bind to transmembrane
ephrin-B ligands. There are six vertebrate EhpB
receptors (EphB1-6), which display promiscuous
interactions with three ephrin-B ligands. One exception
is EphB2, which also interacts with ephrin A5. EphRs
contain an ephrin-binding domain and two fibronectin
repeats extracellularly, a transmembrane segment, and a
cytoplasmic tyr kinase domain. Binding of the ephrin
ligand to EphR requires cell-cell contact since both
are anchored to the plasma membrane. The resulting
downstream signals occur bidirectionally in both
EphR-expressing cells (forward signaling) and
ephrin-expressing cells (reverse signaling).
Ephrin/EphR interaction mainly results in cell-cell
repulsion or adhesion. EphBRs play important roles in
synapse formation and plasticity, spine morphogenesis,
axon guidance, and angiogenesis. In the intestinal
epithelium, EphBRs are Wnt signaling target genes that
control cell compartmentalization. They function as
suppressors of color cancer progression.
Length = 269
Score = 31.8 bits (72), Expect = 0.012
Identities = 14/41 (34%), Positives = 20/41 (48%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQK 41
M HPNIIH+ V ++++ E+ G L FL Q
Sbjct: 59 MGQFDHPNIIHLEGVVTKSRPVMIITEFMENGALDSFLRQN 99
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase 5.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase 5 (CDK5) subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The CDK5 subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. CDKs belong to a large family
of STKs that are regulated by their cognate cyclins.
Together, they are involved in the control of cell-cycle
progression, transcription, and neuronal function. CDK5
is unusual in that it is regulated by non-cyclin
proteins, p35 and p39. It is highly expressed in the
nervous system and is critical in normal neural
development and function. It plays a role in neuronal
migration and differentiation, and is also important in
synaptic plasticity and learning. CDK5 also participates
in protecting against cell death and promoting
angiogenesis. Impaired CDK5 activity is implicated in
Alzheimer's disease, amyotrophic lateral sclerosis,
Parkinson's disease, Huntington's disease and acute
neuronal injury.
Length = 284
Score = 31.6 bits (72), Expect = 0.014
Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 2/65 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFR-QIATA 59
+ ++H NI+ +Y+V + +K+ LV EY +L + D + E + F Q+
Sbjct: 53 LKELKHKNIVRLYDVLHSDKKLTLVFEY-CDQDLKKYFDSCNGDIDPEIVKSFMFQLLKG 111
Query: 60 VYYCH 64
+ +CH
Sbjct: 112 LAFCH 116
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine
Kinases, Class EphA Ephrin Receptors. Protein Tyrosine
Kinase (PTK) family; Ephrin Receptor (EphR) subfamily;
most class EphA receptors including EphA3, EphA4,
EphA5, and EphA7, but excluding EphA1, EphA2 and
EphA10; catalytic (c) domain. The PTKc family is part
of a larger superfamily that includes the catalytic
domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. EphRs
comprise the largest subfamily of receptor tyr kinases
(RTKs). In general, class EphA receptors bind
GPI-anchored ephrin-A ligands. There are ten vertebrate
EphA receptors (EphA1-10), which display promiscuous
interactions with six ephrin-A ligands. One exception
is EphA4, which also binds ephrins-B2/B3. EphRs contain
an ephrin-binding domain and two fibronectin repeats
extracellularly, a transmembrane segment, and a
cytoplasmic tyr kinase domain. Binding of the ephrin
ligand to EphR requires cell-cell contact since both
are anchored to the plasma membrane. The resulting
downstream signals occur bidirectionally in both
EphR-expressing cells (forward signaling) and
ephrin-expressing cells (reverse signaling).
Ephrin/EphR interaction mainly results in cell-cell
repulsion or adhesion, making it important in neural
development and plasticity, cell morphogenesis,
cell-fate determination, embryonic development, tissue
patterning, and angiogenesis. EphARs and ephrin-A
ligands are expressed in multiple areas of the
developing brain, especially in the retina and tectum.
They are part of a system controlling retinotectal
mapping.
Length = 267
Score = 31.4 bits (71), Expect = 0.017
Identities = 15/38 (39%), Positives = 20/38 (52%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
M HPNIIH+ V + +++V EY G L FL
Sbjct: 59 MGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDAFL 96
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein
Serine/Threonine Kinase, Classical Protein Kinase C
beta. Serine/Threonine Kinases (STKs), Classical
Protein Kinase C (cPKC) subfamily, beta isoforms,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The cPKC subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PKCs are
classified into three groups (classical, atypical, and
novel) depending on their mode of activation and the
structural characteristics of their regulatory domain.
PKCs undergo three phosphorylations in order to take
mature forms. In addition, cPKCs depend on calcium, DAG
(1,2-diacylglycerol), and in most cases,
phosphatidylserine (PS) for activation. There are four
cPKC isoforms, named alpha, betaI, betaII, and gamma.
The PKC beta isoforms (I and II), generated by
alternative splicing of a single gene, are
preferentially activated by hyperglycemia-induced DAG in
retinal tissues. This is implicated in diabetic
microangiopathy such as ischemia, neovascularization,
and abnormal vasodilator function. PKC-beta also plays
an important role in VEGF signaling. In addition,
glucose regulates proliferation in retinal endothelial
cells via PKC-betaI. PKC-beta is also being explored as
a therapeutic target in cancer. It contributes to tumor
formation and is involved in the tumor host mechanisms
of inflammation and angiogenesis.
Length = 323
Score = 31.5 bits (71), Expect = 0.019
Identities = 15/58 (25%), Positives = 28/58 (48%)
Query: 7 PNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCH 64
P + ++ F+ +++ VMEY GG+L + Q E A +IA +++ H
Sbjct: 61 PFLTQLHSCFQTMDRLYFVMEYVNGGDLMYQIQQVGRFKEPHAVFYAAEIAIGLFFLH 118
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase,
MAPK/MAK/MRK Overlapping Kinase. Serine/Threonine
Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK)
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The MOK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MOK, also called Renal tumor antigen 1
(RAGE-1), is widely expressed and is enriched in testis,
kidney, lung, and brain. It is expressed in
approximately 50% of renal cell carcinomas (RCC) and is
a potential target for immunotherapy. MOK is stabilized
by its association with the HSP90 molecular chaperone.
It is induced by the transcription factor Cdx2 and may
be involved in regulating intestinal epithelial
development and differentiation.
Length = 282
Score = 31.1 bits (71), Expect = 0.019
Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 4/63 (6%)
Query: 6 HPNIIHIYEVFENRE--KMVLVMEYAAGGELYDFL-DQKKVLTEEEARRIFRQIATAVYY 62
HPNI+ + EV +R+ ++ LV E LY+ + +K+ L E+ + Q+ ++ +
Sbjct: 57 HPNILRLIEVLFDRKTGRLALVFELMD-MNLYELIKGRKRPLPEKRVKSYMYQLLKSLDH 115
Query: 63 CHK 65
H+
Sbjct: 116 MHR 118
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase,
p38 Mitogen-Activated Protein Kinase. Serine/Threonine
Kinases (STKs), p38 subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The p38 subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. p38 kinases are
mitogen-activated protein kinases (MAPKs), serving as
important mediators of cellular responses to
extracellular signals. They function in the regulation
of the cell cycle, cell development, cell
differentiation, senescence, tumorigenesis, apoptosis,
pain development and pain progression, and immune
responses. p38 kinases are activated by the MAPK kinases
MKK3 and MKK6, which in turn are activated by upstream
MAPK kinase kinases including TAK1, ASK1, and MLK3, in
response to cellular stresses or inflammatory cytokines.
p38 substrates include other protein kinases and factors
that regulate transcription, nuclear export, mRNA
stability and translation. p38 kinases are drug targets
for the inflammatory diseases psoriasis, rheumatoid
arthritis, and chronic pulmonary disease. Vertebrates
contain four isoforms of p38, named alpha, beta, gamma,
and delta, which show varying substrate specificity and
expression patterns. p38alpha and p38beta are
ubiquitously expressed, p38gamma is predominantly found
in skeletal muscle, and p38delta is found in the heart,
lung, testis, pancreas, and small intestine.
Length = 343
Score = 31.1 bits (71), Expect = 0.020
Identities = 16/66 (24%), Positives = 32/66 (48%), Gaps = 8/66 (12%)
Query: 5 RHPNIIHIYEVF------ENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIAT 58
H N+I + +VF E+ + + LV G +L + + +K L+++ + + QI
Sbjct: 72 DHENVIGLLDVFTPASSLEDFQDVYLVTHLM-GADLNNIVKCQK-LSDDHIQFLVYQILR 129
Query: 59 AVYYCH 64
+ Y H
Sbjct: 130 GLKYIH 135
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine
Kinases, Lymphocyte-specific kinase and Blk. Protein
Tyrosine Kinase (PTK) family; Lck and Blk kinases;
catalytic (c) domain. The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. Lck
(lymphocyte-specific kinase) and Blk are members of the
Src subfamily of proteins, which are cytoplasmic (or
non-receptor) tyr kinases. Src kinases contain an
N-terminal SH4 domain with a myristoylation site,
followed by SH3 and SH2 domains, a tyr kinase domain,
and a regulatory C-terminal region containing a
conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). Src
proteins are involved in signaling pathways that
regulate cytokine and growth factor responses,
cytoskeleton dynamics, cell proliferation, survival,
and differentiation. Lck is expressed in T-cells and
natural killer (NK) cells. It plays a critical role in
T-cell maturation, activation, and T-cell receptor
(TCR) signaling. Lck phosphorylates ITAM
(immunoreceptor tyr activation motif) sequences on
several subunits of TCRs, leading to the activation of
different second messenger cascades. Phosphorylated
ITAMs serve as binding sites for other signaling factor
such as Syk and ZAP-70, leading to their activation and
propagation of downstream events. In addition, Lck
regulates drug-induced apoptosis by interfering with
the mitochondrial death pathway. The apototic role of
Lck is independent of its primary function in T-cell
signaling. Blk is expressed specifically in B-cells. It
is involved in pre-BCR (B-cell receptor) signaling.
Length = 260
Score = 31.4 bits (71), Expect = 0.021
Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
M ++HP ++ +Y V +E + ++ EY G L DFL
Sbjct: 55 MKQLQHPRLVRLYAVV-TQEPIYIITEYMENGSLVDFL 91
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein
Serine/Threonine Kinase, Novel Protein Kinase C delta.
Serine/Threonine Kinases (STKs), Novel Protein Kinase C
(nPKC), delta isoform, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The nPKC subfamily is part of a larger
superfamily that includes the catalytic domains of
other protein STKs, protein tyrosine kinases, RIO
kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PKCs are
classified into three groups (classical, atypical, and
novel) depending on their mode of activation and the
structural characteristics of their regulatory domain.
nPKCs are calcium-independent, but require DAG
(1,2-diacylglycerol) and phosphatidylserine (PS) for
activity. There are four nPKC isoforms, delta, epsilon,
eta, and theta. PKC-delta plays a role in cell cycle
regulation and programmed cell death in many cell
types. It slows down cell proliferation, inducing cell
cycle arrest and enhancing cell differentiation.
PKC-delta is also involved in the regulation of
transcription as well as immune and inflammatory
responses. It plays a central role in the genotoxic
stress response that leads to DNA damaged-induced
apoptosis.
Length = 316
Score = 31.1 bits (70), Expect = 0.023
Identities = 11/29 (37%), Positives = 19/29 (65%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYAAGGEL 34
+P + H+Y F+ +E + VME+ GG+L
Sbjct: 55 NPFLTHLYCTFQTKEHLFFVMEFLNGGDL 83
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src
kinase-like Protein Tyrosine Kinases. Protein Tyrosine
Kinase (PTK) family; C-terminal Src kinase (Csk)
subfamily; catalytic (c) domain. The Csk subfamily is
composed of Csk, Chk, and similar proteins. The PTKc
family is part of a larger superfamily that includes
the catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Csk
subfamily kinases are cytoplasmic (or nonreceptor) tyr
kinases containing the Src homology domains, SH3 and
SH2, N-terminal to the catalytic tyr kinase domain.
They negatively regulate the activity of Src kinases
that are anchored to the plasma membrane. To inhibit
Src kinases, Csk and Chk are translocated to the
membrane via binding to specific transmembrane
proteins, G-proteins, or adaptor proteins near the
membrane. Csk catalyzes the tyr phosphorylation of the
regulatory C-terminal tail of Src kinases, resulting in
their inactivation. Chk inhibit Src kinases using a
noncatalytic mechanism by simply binding to them. As
negative regulators of Src kinases, Csk and Chk play
important roles in cell proliferation, survival, and
differentiation, and consequently, in cancer
development and progression.
Length = 256
Score = 30.8 bits (70), Expect = 0.026
Identities = 14/38 (36%), Positives = 23/38 (60%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
M+++RHPN++ + V + +V EY A G L D+L
Sbjct: 54 MTTLRHPNLVQLLGVVLQGNPLYIVTEYMAKGSLVDYL 91
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein
Serine/Threonine Kinase, Mammalian Ste20-like protein
kinase 3. Serine/threonine kinases (STKs), mammalian
Ste20-like protein kinase 3 (MST3) subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MST3 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. MST3
phosphorylates the STK NDR and may play a role in cell
cycle progression and cell morphology. It may also
regulate paxillin and consequently, cell migration. MST3
is present in human placenta, where it plays an
essential role in the oxidative stress-induced apoptosis
of trophoblasts in normal spontaneous delivery.
Dysregulation of trophoblast apoptosis may result in
pregnancy complications such as preeclampsia and
intrauterine growth retardation.
Length = 277
Score = 30.8 bits (69), Expect = 0.026
Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 1/64 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+S P + Y + K+ ++MEY GG D L+ L E + I R+I +
Sbjct: 56 LSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGP-LDETQIATILREILKGL 114
Query: 61 YYCH 64
Y H
Sbjct: 115 DYLH 118
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase,
Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK)
family; Spleen tyrosine kinase (Syk); catalytic (c)
domain. The PTKc family is part of a larger superfamily
that includes the catalytic domains of other kinases
such as protein serine/threonine kinases, RIO kinases,
and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Syk,
together with Zap-70, form the Syk subfamily of kinases
which are cytoplasmic (or nonreceptor) tyr kinases
containing two Src homology 2 (SH2) domains N-terminal
to the catalytic tyr kinase domain. Syk was first cloned
from the spleen, and its function in hematopoietic cells
is well-established. Syk is involved in the signaling
downstream of activated receptors (including B-cell and
Fc receptors) that contain ITAMs (immunoreceptor tyr
activation motifs), leading to processes such as cell
proliferation, differentiation, survival, adhesion,
migration, and phagocytosis. More recently, Syk
expression has been detected in other cell types
(including epithelial cells, vascular endothelial cells,
neurons, hepatocytes, and melanocytes), suggesting a
variety of biological functions in non-immune cells. Syk
plays a critical role in maintaining vascular integrity
and in wound healing during embryogenesis. It also
regulates Vav3, which is important in osteoclast
function including bone development. In breast
epithelial cells, where Syk acts as a negative regulator
for epidermal growth factor receptor (EGFR) signaling,
loss of Syk expression is associated with abnormal
proliferation during cancer development suggesting a
potential role as a tumor suppressor. In mice, Syk has
been shown to inhibit malignant transformation of
mammary epithelial cells induced with murine mammary
tumor virus (MMTV).
Length = 257
Score = 30.7 bits (69), Expect = 0.027
Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
M + +P I+ + + E E +LVME A G L FL + K +TE+ + Q++ +
Sbjct: 50 MQQLDNPYIVRMIGICEA-ESWMLVMELAELGPLNKFLQKNKHVTEKNITELVHQVSMGM 108
Query: 61 YY 62
Y
Sbjct: 109 KY 110
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine
Kinase, Zeta-chain-associated protein of 70kDa. Protein
Tyrosine Kinase (PTK) family; Zeta-chain-associated
protein of 70kDa (Zap-70); catalytic (c) domain. The
PTKc family is part of a larger superfamily that
includes the catalytic domains of other kinases such as
protein serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Zap-70 is
a member of the Syk subfamily of kinases, which are
cytoplasmic (or nonreceptor) tyr kinases containing two
Src homology 2 (SH2) domains N-terminal to the catalytic
tyr kinase domain. Zap-70 is primarily expressed in
T-cells and NK cells, and is a crucial component in
T-cell receptor (TCR) signaling. Zap-70 binds the
phosphorylated ITAM (immunoreceptor tyr activation
motif) sequences of the activated TCR zeta-chain through
its SH2 domains, leading to its phosphorylation and
activation. It then phosphorylates target proteins,
which propagate the signals to downstream pathways.
Zap-70 is hardly detected in normal peripheral B-cells,
but is present in some B-cell malignancies. It is used
as a diagnostic marker for chronic lymphocytic leukemia
(CLL) as it is associated with the more aggressive
subtype of the disease.
Length = 257
Score = 30.7 bits (69), Expect = 0.027
Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 2/63 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKK-VLTEEEARRIFRQIATA 59
M + +P I+ + V E E ++LVME A+GG L FL KK +T + Q++
Sbjct: 49 MHQLDNPYIVRMIGVCE-AEALMLVMEMASGGPLNKFLSGKKDEITVSNVVELMHQVSMG 107
Query: 60 VYY 62
+ Y
Sbjct: 108 MKY 110
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine
Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases
(STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The PCTAIRE-3 subfamily is part of a larger superfamily
that includes the catalytic domains of other protein
STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. PCTAIRE-3 shares sequence
similarity with Cyclin-Dependent Kinases (CDKs), which
belong to a large family of STKs that are regulated by
their cognate cyclins. Together, CDKs and cyclins are
involved in the control of cell-cycle progression,
transcription, and neuronal function. PCTAIRE-3 shows a
restricted pattern of expression and is present in
brain, kidney, and intestine. It is elevated in
Alzheimer's disease (AD) and has been shown to associate
with paired helical filaments (PHFs) and stimulate Tau
phosphorylation. As AD progresses, phosphorylated Tau
aggregates and forms PHFs, which leads to the formation
of neurofibrillary tangles (NFTs). In human glioma
cells, PCTAIRE-3 induces cell cycle arrest and cell
death.
Length = 288
Score = 30.8 bits (69), Expect = 0.028
Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 2/66 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFR-QIATA 59
+ +++H NI+ ++++ + LV EY +L +LD L +IF Q+
Sbjct: 57 LKNLKHANIVTLHDIIHTERCLTLVFEY-LDSDLKQYLDNCGNLMSMHNVKIFMFQLLRG 115
Query: 60 VYYCHK 65
+ YCHK
Sbjct: 116 LSYCHK 121
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine
Kinases, Fibroblast Growth Factor Receptors. Protein
Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
Receptor (FGFR) subfamily; catalytic (c) domain. The
FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4,
and similar proteins. The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K).PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. FGFR subfamily members
are receptor tyr kinases (RTKs) containing an
extracellular ligand-binding region with three
immunoglobulin-like domains, a transmembrane segment,
and an intracellular catalytic domain. The binding of
FGFRs to their ligands, the FGFs, and to heparin/heparan
sulfate (HS) results in the formation of a ternary
complex, which leads to receptor dimerization and
activation, and intracellular signaling. There are at
least 23 FGFs and four types of FGFRs. The binding of
FGFs to FGFRs is promiscuous, in that a receptor may be
activated by several ligands and a ligand may bind to
more that one type of receptor. FGF/FGFR signaling is
important in the regulation of embryonic development,
homeostasis, and regenerative processes. Depending on
the cell type and stage, FGFR signaling produces diverse
cellular responses including proliferation, growth
arrest, differentiation, and apoptosis. Aberrant
signaling leads to many human diseases such as skeletal,
olfactory, and metabolic disorders, as well as cancer.
Length = 293
Score = 30.8 bits (70), Expect = 0.029
Identities = 15/34 (44%), Positives = 21/34 (61%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
+H NII++ V + +V+EYAA G L DFL
Sbjct: 74 KHKNIINLLGVCTQEGPLYVVVEYAAHGNLRDFL 107
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine
Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases
(STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The PCTAIRE-1 subfamily is part of a larger superfamily
that includes the catalytic domains of other protein
STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. PCTAIRE-1 shares sequence
similarity with Cyclin-Dependent Kinases (CDKs), which
belong to a large family of STKs that are regulated by
their cognate cyclins. Together, CDKs and cyclins are
involved in the control of cell-cycle progression,
transcription, and neuronal function. PCTAIRE-1 is
expressed ubiquitously and is localized in the
cytoplasm. Its kinase activity is cell cycle dependent
and peaks at the S and G2 phases. PCTAIRE-1 is highly
expressed in the brain and may play a role in regulating
neurite outgrowth. It can also associate with Trap
(Tudor repeat associator with PCTAIRE-2), a
physiological partner of PCTAIRE-2; with p11, a small
dimeric protein with similarity to S100; and with 14-3-3
proteins, mediators of phosphorylation-dependent
interactions in many different proteins.
Length = 301
Score = 30.7 bits (69), Expect = 0.029
Identities = 14/66 (21%), Positives = 31/66 (46%), Gaps = 2/66 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQ-KKVLTEEEARRIFRQIATA 59
+ ++H NI+ ++++ + + LV EY +L +LD + + Q+
Sbjct: 58 LKDLKHANIVTLHDIIHTEKSLTLVFEY-LDKDLKQYLDDCGNSINMHNVKLFLFQLLRG 116
Query: 60 VYYCHK 65
+ YCH+
Sbjct: 117 LNYCHR 122
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein
Serine/Threonine Kinase, MAP/ERK kinase kinase 1.
Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1
(MEKK1) subfamily, catalytic (c) domain. STKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
MEKK1 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MEKK1 is a mitogen-activated protein kinase
(MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
phosphorylates and activates MAPK kinases (MAPKKs or
MKKs or MAP2Ks), which in turn phosphorylate and
activate MAPKs during signaling cascades that are
important in mediating cellular responses to
extracellular signals. MEKK1 activates the extracellular
signal-regulated kinase 1/2 (ERK1/2) and c-Jun
N-terminal kinase (JNK) pathways by activating their
respective MAPKKs, MEK1/2 and MKK4/MKK7, respectively.
MEKK1 is important in regulating cell survival and
apoptosis. MEKK1 also plays a role in cell migration,
tissue maintenance and homeostasis, and wound healing.
Length = 268
Score = 30.6 bits (69), Expect = 0.031
Identities = 16/67 (23%), Positives = 27/67 (40%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
M+ + HP+II + L +E+ AGG + L + E Q+ +
Sbjct: 57 MARLNHPHIIRMLGATCEDSHFNLFVEWMAGGSVSHLLSKYGAFKEAVIINYTEQLLRGL 116
Query: 61 YYCHKVQ 67
Y H+ Q
Sbjct: 117 SYLHENQ 123
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine
Kinase, Receptor tyrosine kinase-like Orphan Receptor
1. Protein Tyrosine Kinase (PTK) family; Receptor
tyrosine kinase-like Orphan Receptor 1 (Ror1);
catalytic (c) domain. The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. Ror proteins are orphan
receptor tyr kinases (RTKs) containing an extracellular
region with immunoglobulin-like, cysteine-rich, and
kringle domains, a transmembrane segment, and an
intracellular catalytic domain. Ror RTKs are unrelated
to the nuclear receptor subfamily called
retinoid-related orphan receptors (RORs). RTKs are
usually activated through ligand binding, which causes
dimerization and autophosphorylation of the
intracellular tyr kinase catalytic domain. Ror kinases
are expressed in many tissues during development. Avian
Ror1 was found to be involved in late limb development.
Studies in mice reveal that Ror1 is important in the
regulation of neurite growth in central neurons, as
well as in respiratory development. Loss of Ror1 also
enhances the heart and skeletal abnormalities found in
Ror2-deficient mice.
Length = 283
Score = 30.7 bits (69), Expect = 0.032
Identities = 12/38 (31%), Positives = 23/38 (60%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
M+ + HPNI+ + V + + ++ EY G+L++FL
Sbjct: 61 MAELHHPNIVCLLGVVTQEQPVCMLFEYLNQGDLHEFL 98
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase,
Interleukin-2-inducible T-cell Kinase. Protein Tyrosine
Kinase (PTK) family; Interleukin-2 (IL-2)-inducible
T-cell kinase (Itk); catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Itk (also
known as Tsk or Emt) is a member of the Tec subfamily of
proteins, which are cytoplasmic (or nonreceptor) tyr
kinases with similarity to Src kinases in that they
contain Src homology protein interaction domains (SH3,
SH2) N-terminal to the catalytic tyr kinase domain.
Unlike Src kinases, most Tec subfamily members (except
Rlk) also contain an N-terminal pleckstrin homology (PH)
domain, which binds the products of PI3K and allows
membrane recruitment and activation. In addition, Itk
contains the Tec homology (TH) domain containing one
proline-rich region and a zinc-binding region. Tec
kinases are expressed mainly by haematopoietic cells.
Itk is expressed in T-cells and mast cells, and is
important in their development and differentiation. Of
the three Tec kinases expressed in T-cells, Itk plays
the predominant role in T-cell receptor (TCR) signaling.
It is activated by phosphorylation upon TCR crosslinking
and is involved in the pathway resulting in
phospholipase C-gamma1 activation and actin
polymerization. It also plays a role in the downstream
signaling of the T-cell costimulatory receptor CD28, the
T-cell surface receptor CD2, and the chemokine receptor
CXCR4. In addition, Itk is crucial for the development
of T-helper(Th)2 effector responses.
Length = 256
Score = 30.3 bits (68), Expect = 0.037
Identities = 14/49 (28%), Positives = 24/49 (48%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEA 49
M + HP ++ +Y V R + LV E+ G L D+L ++ +E
Sbjct: 53 MMKLSHPKLVQLYGVCTERSPICLVFEFMEHGCLSDYLRAQRGKFSQET 101
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine
Kinase, Cyclin-Dependent protein Kinase 12.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase 12 (CDK12) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK12 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. CDKs belong to a
large family of STKs that are regulated by their cognate
cyclins. Together, they are involved in the control of
cell-cycle progression, transcription, and neuronal
function. CDK12 is also called Cdc2-related protein
kinase 7 (CRK7) or Cdc2-related kinase
arginine/serine-rich (CrkRS). It is a unique CDK that
contains an arginine/serine-rich (RS) domain, which is
predominantly found in splicing factors. CDK12 is widely
expressed in tissues. It interacts with cyclins L1 and
L2, and plays roles in regulating transcription and
alternative splicing.
Length = 302
Score = 30.5 bits (69), Expect = 0.042
Identities = 17/73 (23%), Positives = 33/73 (45%), Gaps = 12/73 (16%)
Query: 4 VRHPNIIHIYEVF----------ENREKMVLVMEYAAGGELYDFLDQKKV-LTEEEARRI 52
+ H NI+++ E+ +++ LV EY +L L+ V +E+ +
Sbjct: 63 LNHRNIVNLKEIVTDKQDALDFKKDKGAFYLVFEYM-DHDLMGLLESGLVHFSEDHIKSF 121
Query: 53 FRQIATAVYYCHK 65
+Q+ + YCHK
Sbjct: 122 MKQLLEGLNYCHK 134
>gnl|CDD|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein
Serine/Threonine Kinases, RPK118 and similar proteins.
Serine/Threonine Kinases (STKs), RPK118-like subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The RPK118-like
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. Members of this subfamily show similarity to
human RPK118, which contains an N-terminal Phox homology
(PX) domain, a Microtubule Interacting and Trafficking
(MIT) domain, and a kinase domain containing a long
insert. Also included in the family is human RPK60 (or
ribosomal protein S6 kinase-like 1), which also contains
MIT and kinase domains but lacks a PX domain. RPK118
binds sphingosine kinase, a key enzyme in the synthesis
of sphingosine 1-phosphate (SPP), a lipid messenger
involved in many cellular events. RPK118 may be involved
in transmitting SPP-mediated signaling. RPK118 also
binds the antioxidant peroxiredoxin-3 (PRDX3). RPK118
may be involved in the transport of PRDX3 from the
cytoplasm to its site of function in the mitochondria.
Length = 237
Score = 30.2 bits (68), Expect = 0.042
Identities = 13/59 (22%), Positives = 34/59 (57%)
Query: 7 PNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCHK 65
PN++ +++ + + + LV+++A GG+L+ + + + EE +R ++ A+ H+
Sbjct: 45 PNMVCLHKYIVSEDSVFLVLQHAEGGKLWSHISKFLNIPEECVKRWAAEMVVALDALHR 103
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase,
Src. Protein Tyrosine Kinase (PTK) family; Src kinase;
catalytic (c) domain. The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. Src (or c-Src) is a
cytoplasmic (or non-receptor) tyr kinase, containing an
N-terminal SH4 domain with a myristoylation site,
followed by SH3 and SH2 domains, a tyr kinase domain,
and a regulatory C-terminal region with a conserved tyr.
It is activated by autophosphorylation at the tyr kinase
domain, and is negatively regulated by phosphorylation
at the C-terminal tyr by Csk (C-terminal Src Kinase).
c-Src is the vertebrate homolog of the oncogenic protein
(v-Src) from Rous sarcoma virus. Together with other Src
subfamily proteins, it is involved in signaling pathways
that regulate cytokine and growth factor responses,
cytoskeleton dynamics, cell proliferation, survival, and
differentiation. Src also play a role in regulating cell
adhesion, invasion, and motility in cancer cells and
tumor vasculature, contributing to cancer progression
and metastasis. Elevated levels of Src kinase activity
have been reported in a variety of human cancers.
Several inhibitors of Src have been developed as
anti-cancer drugs. Src is also implicated in acute
inflammatory responses and osteoclast function.
Length = 262
Score = 30.4 bits (68), Expect = 0.043
Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 3/68 (4%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL--DQKKVLTEEEARRIFRQIAT 58
M +RH ++ +Y V + E + +V EY + G L DFL + K L + + QIA+
Sbjct: 55 MKKLRHEKLVQLYAVV-SEEPIYIVTEYMSKGSLLDFLKGEMGKYLRLPQLVDMAAQIAS 113
Query: 59 AVYYCHKV 66
+ Y ++
Sbjct: 114 GMAYVERM 121
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine
Kinase, Fes. Protein Tyrosine Kinase (PTK) family; Fes
(or Fps) kinase subfamily; catalytic (c) domain. The
PTKc family is part of a larger superfamily that
includes the catalytic domains of other kinases such as
protein serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Fes
subfamily proteins are cytoplasmic (or nonreceptor) tyr
kinases containing an N-terminal region with FCH
(Fes/Fer/CIP4 homology) and coiled-coil domains,
followed by a SH2 domain, and a C-terminal catalytic
domain. The genes for Fes (feline sarcoma) and Fps
(Fujinami poultry sarcoma) were first isolated from
tumor-causing retroviruses. The viral oncogenes encode
chimeric Fes proteins consisting of Gag sequences at
the N-termini, resulting in unregulated tyr kinase
activity. Fes kinase is expressed in myeloid, vascular
endothelial, epithelial, and neuronal cells. It plays
important roles in cell growth and differentiation,
angiogenesis, inflammation and immunity, and
cytoskeletal regulation. A recent study implicates Fes
kinase as a tumor suppressor in colorectal cancer.
Length = 252
Score = 30.4 bits (68), Expect = 0.044
Identities = 12/33 (36%), Positives = 19/33 (57%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
HPNI+ + V ++ + +VME GG+ FL
Sbjct: 52 HPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFL 84
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear
Dbf2-Related kinase-like Protein Serine/Threonine
Kinases. Serine/Threonine Kinases (STKs), NDR kinase
subfamily, fungal NDR-like proteins, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The NDR subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. This group is
composed of fungal NDR-like proteins including
Saccharomyces cerevisiae CBK1 (or CBK1p),
Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago
maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like
NDR kinase, group members contain an N-terminal
regulatory (NTR) domain and an insert within the
catalytic domain that contains an auto-inhibitory
sequence. CBK1 is an essential component in the RAM
(regulation of Ace2p activity and cellular
morphogenesis) network. CBK1 and Orb6 play similar roles
in coordinating cell morphology with cell cycle
progression. Ukc1 is involved in morphogenesis,
pathogenicity, and pigment formation. Cot1 plays a role
in polar tip extension.
Length = 377
Score = 30.2 bits (68), Expect = 0.045
Identities = 15/60 (25%), Positives = 31/60 (51%)
Query: 7 PNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCHKV 66
P ++ +Y F++ + + L+ME+ GG+L L + +E+ R + A+ HK+
Sbjct: 61 PWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIKYDTFSEDVTRFYMAECVLAIEAVHKL 120
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of
cAMP-dependent protein kinase-like Protein
Serine/Threonine Kinases. Serine/Threonine Kinases
(STKs), Fission yeast Suppressor of loss of
cAMP-dependent protein kinase (Sck1)-like subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The Sck1-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. This subfamily is composed of fungal proteins
with similarity to the Schizosaccharomyces pombe STK
Sck1. Sck1 plays a role in trehalase activation
triggered by glucose and a nitrogen source. Trehalase
catalyzes the cleavage of the disaccharide trehalose to
glucose. Trehalose, as a carbohydrate reserve and stress
metabolite, plays an important role in the response of
yeast to environmental changes.
Length = 330
Score = 30.3 bits (68), Expect = 0.046
Identities = 16/59 (27%), Positives = 32/59 (54%)
Query: 7 PNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCHK 65
P I+ + F+ + LV +Y +GGEL+ L ++ +E+ A+ ++ A+ + HK
Sbjct: 56 PFIVGLKFSFQTDSDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHK 114
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine
Kinase, C-terminal Src kinase. Protein Tyrosine Kinase
(PTK) family; C-terminal Src kinase (Csk); catalytic
(c) domain. The PTKc family is part of a larger
superfamily that includes the catalytic domains of
other kinases such as protein serine/threonine kinases,
RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
catalyze the transfer of the gamma-phosphoryl group
from ATP to tyrosine (tyr) residues in protein
substrates. The Csk subfamily kinases are cytoplasmic
(or nonreceptor) tyr kinases containing the Src
homology domains, SH3 and SH2, N-terminal to the
catalytic tyr kinase domain. They negatively regulate
the activity of Src kinases that are anchored to the
plasma membrane. To inhibit Src kinases, Csk is
translocated to the membrane via binding to specific
transmembrane proteins, G-proteins, or adaptor proteins
near the membrane. Csk catalyzes the tyr
phosphorylation of the regulatory C-terminal tail of
Src kinases, resulting in their inactivation. Csk is
expressed in a wide variety of tissues. As a negative
regulator of Src, Csk plays a role in cell
proliferation, survival, and differentiation, and
consequently, in cancer development and progression. In
addition, Csk also shows Src-independent functions. It
is a critical component in G-protein signaling, and
plays a role in cytoskeletal reorganization and cell
migration.
Length = 256
Score = 29.9 bits (67), Expect = 0.051
Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
Query: 1 MSSVRHPNIIHIYEVF-ENREKMVLVMEYAAGGELYDFL 38
M+ +RH N++ + V E + + +V EY A G L D+L
Sbjct: 53 MTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYL 91
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine
Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases
(STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The PCTAIRE-2 subfamily is part of a larger superfamily
that includes the catalytic domains of other protein
STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. PCTAIRE-2 shares sequence
similarity with Cyclin-Dependent Kinases (CDKs), which
belong to a large family of STKs that are regulated by
their cognate cyclins. Together, CDKs and cyclins are
involved in the control of cell-cycle progression,
transcription, and neuronal function. PCTAIRE-2 is
specifically expressed in neurons in the central nervous
system, mainly in terminally differentiated neurons. It
associates with Trap (Tudor repeat associator with
PCTAIRE-2) and could play a role in regulating
mitochondrial function in neurons.
Length = 309
Score = 30.0 bits (67), Expect = 0.052
Identities = 14/66 (21%), Positives = 33/66 (50%), Gaps = 2/66 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQ-KKVLTEEEARRIFRQIATA 59
+ ++H NI+ ++++ + + LV EY +L ++D +++ + QI
Sbjct: 58 LKDLKHANIVTLHDIVHTDKSLTLVFEY-LDKDLKQYMDDCGNIMSMHNVKIFLYQILRG 116
Query: 60 VYYCHK 65
+ YCH+
Sbjct: 117 LAYCHR 122
>gnl|CDD|237847 PRK14879, PRK14879, serine/threonine protein kinase; Provisional.
Length = 211
Score = 29.9 bits (68), Expect = 0.059
Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
Query: 8 NIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIAT 58
N+ +Y V ++VMEY G L D ++ + E +R I R +
Sbjct: 62 NVPAVYFVDPE--NFIIVMEYIEGEPLKDLINSNGMEELELSREIGRLVGK 110
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine
Kinases, Cyclin-Dependent protein Kinase 2 and 3.
Serine/Threonine Kinases (STKs), Cyclin-dependent
protein kinase 2 (CDK2) and CDK3 subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK2/3 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. CDKs belong to a
large family of STKs that are regulated by their cognate
cyclins. Together, they are involved in the control of
cell-cycle progression, transcription, and neuronal
function. CDK2 is regulated by cyclin E or cyclin A.
Upon activation by cyclin E, it phosphorylates the
retinoblastoma (pRb) protein which activates E2F
mediated transcription and allows cells to move into S
phase. The CDK2/cyclin A complex plays a role in
regulating DNA replication. CDK2, together with CDK4,
also regulates embryonic cell proliferation. Despite
these important roles, mice deleted for the cdk2 gene
are viable and normal except for being sterile. This may
be due to compensation provided by CDK1 (also called
Cdc2), which can also bind cyclin E and drive the G1 to
S phase transition. CDK3 is regulated by cyclin C and it
phosphorylates pRB specifically during the G0/G1
transition. This phosphorylation is required for cells
to exit G0 efficiently and enter the G1 phase.
Length = 284
Score = 29.8 bits (67), Expect = 0.061
Identities = 15/61 (24%), Positives = 27/61 (44%), Gaps = 3/61 (4%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYAAGGELYDFLD--QKKVLTEEEARRIFRQIATAVYYC 63
HPNI+ + +V K+ LV E+ +L F+D + + Q+ + +C
Sbjct: 58 HPNIVKLLDVIHTENKLYLVFEFLH-QDLKKFMDASPLSGIPLPLIKSYLFQLLQGLAFC 116
Query: 64 H 64
H
Sbjct: 117 H 117
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine
Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK)
family; Fyn and Yrk kinases; catalytic (c) domain. The
PTKc family is part of a larger superfamily that
includes the catalytic domains of other kinases such as
protein serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Fyn and
Yrk are members of the Src subfamily of proteins, which
are cytoplasmic (or non-receptor) tyr kinases. Src
kinases contain an N-terminal SH4 domain with a
myristoylation site, followed by SH3 and SH2 domains, a
tyr kinase domain, and a regulatory C-terminal region
containing a conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). Src
proteins are involved in signaling pathways that
regulate cytokine and growth factor responses,
cytoskeleton dynamics, cell proliferation, survival,
and differentiation. Fyn, together with Lck, plays a
critical role in T-cell signal transduction by
phosphorylating ITAM (immunoreceptor tyr activation
motif) sequences on T-cell receptors, ultimately
leading to the proliferation and differentiation of
T-cells. In addition, Fyn is involved in the
myelination of neurons, and is implicated in
Alzheimer's and Parkinson's diseases. Yrk has been
detected only in chickens. It is primarily found in
neuronal and epithelial cells and in macrophages. It
may play a role in inflammation and in response to
injury.
Length = 260
Score = 30.0 bits (67), Expect = 0.063
Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
M +RH ++ +Y V + E + +V EY + G L DFL
Sbjct: 55 MKKLRHDKLVQLYAVV-SEEPIYIVTEYMSKGSLLDFL 91
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine
Kinase, Discoidin Domain Receptor 1. Protein Tyrosine
Kinase (PTK) family; mammalian Discoidin Domain Receptor
1 (DDR1) and homologs; catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. DDR1 is a
member of the DDR subfamily, which are receptor tyr
kinases (RTKs) containing an extracellular discoidin
homology domain, a transmembrane segment, an extended
juxtamembrane region, and an intracellular catalytic
domain. The binding of the ligand, collagen, to DDRs
results in a slow but sustained receptor activation.
DDR1 binds to all collagens tested to date (types I-IV).
It is widely expressed in many tissues. It is abundant
in the brain and is also found in keratinocytes, colonic
mucosa epithelium, lung epithelium, thyroid follicles,
and the islets of Langerhans. During embryonic
development, it is found in the developing
neuroectoderm. DDR1 is a key regulator of cell
morphogenesis, differentiation and proliferation. It is
important in the development of the mammary gland, the
vasculator and the kidney. DDR1 is also found in human
leukocytes, where it facilitates cell adhesion,
migration, maturation, and cytokine production.
Length = 304
Score = 29.9 bits (67), Expect = 0.068
Identities = 14/48 (29%), Positives = 26/48 (54%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEE 48
+S ++ PNII + V + + + ++ EY G+L FL + +EE
Sbjct: 73 LSRLKDPNIIRLLGVCVDEDPLCMITEYMENGDLNQFLSSHHLDDKEE 120
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein
Serine/Threonine Kinase, p21-activated kinase 4.
Serine/threonine kinases (STKs), p21-activated kinase
(PAK) 4, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The PAK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. PAKs are Rho family GTPase-regulated kinases
that serve as important mediators in the function of
Cdc42 (cell division cycle 42) and Rac. PAKs from higher
eukaryotes are classified into two groups (I and II),
according to their biochemical and structural features.
PAK4 belongs to group II. Group II PAKs contain a PBD
(p21-binding domain) and a C-terminal catalytic domain,
but do not harbor an AID (autoinhibitory domain) or SH3
binding sites. PAK4 regulates cell morphology and
cytoskeletal organization. It is essential for embryonic
viability and proper neural development. Mice lacking
PAK4 die due to defects in the fetal heart. In addition,
their spinal cord motor neurons showed failure to
differentiate and migrate. PAK4 also plays a role in
cell survival and tumorigenesis. It is overexpressed in
many primary tumors including colon, esophageal, and
mammary tumors. PAK4 has also been implicated in viral
and bacterial infection pathways.
Length = 292
Score = 29.6 bits (66), Expect = 0.080
Identities = 15/64 (23%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
M +H N++ +Y + +++ +VME+ GG L D + + + EE+ + + A+
Sbjct: 71 MRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIAAVCLAVLKAL 129
Query: 61 YYCH 64
H
Sbjct: 130 SVLH 133
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein
Serine/Threonine Kinase, Rho-associated coiled-coil
containing protein kinase 2. Serine/Threonine Kinases
(STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The ROCK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. ROCK contains an
N-terminal extension, a catalytic kinase domain, and a
C-terminal extension, which contains a coiled-coil
region encompassing a Rho-binding domain (RBD) and a
pleckstrin homology (PH) domain. ROCK is auto-inhibited
by the RBD and PH domain interacting with the catalytic
domain, and is activated via interaction with Rho
GTPases. ROCK2 was the first identified target of
activated RhoA, and was found to play a role in stress
fiber and focal adhesion formation. It is prominently
expressed in the brain, heart, and skeletal muscles. It
is implicated in vascular and neurological disorders,
such as hypertension and vasospasm of the coronary and
cerebral arteries. ROCK2 is also activated by caspase-2
cleavage, resulting in thrombin-induced microparticle
generation in response to cell activation. Mice
deficient in ROCK2 show intrauterine growth retardation
and embryonic lethality because of placental
dysfunction.
Length = 370
Score = 29.6 bits (66), Expect = 0.081
Identities = 11/43 (25%), Positives = 24/43 (55%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKV 43
M+ P ++ ++ F++ + + +VMEY GG+L + + V
Sbjct: 97 MAFANSPWVVQLFCAFQDDKYLYMVMEYMPGGDLVNLMSNYDV 139
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein
Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase
4. Serine/threonine kinases (STKs), yeast
Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The YSK4 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. YSK4 is a
putative MAPKKK, whose mammalian gene has been isolated.
MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate
MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
phosphorylate and activate MAPKs during signaling
cascades that are important in mediating cellular
responses to extracellular signals.
Length = 265
Score = 29.5 bits (66), Expect = 0.083
Identities = 16/64 (25%), Positives = 29/64 (45%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+ S++H NI+ + + + ME+ GG + L++ L E + +QI V
Sbjct: 56 LKSLKHVNIVQYLGTCLDDNTISIFMEFVPGGSISSILNRFGPLPEPVFCKYTKQILDGV 115
Query: 61 YYCH 64
Y H
Sbjct: 116 AYLH 119
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional.
Length = 496
Score = 29.5 bits (66), Expect = 0.090
Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 4/52 (7%)
Query: 17 ENREKMVLVMEYAAGGELYDFLDQK----KVLTEEEARRIFRQIATAVYYCH 64
EN + LV++YA G+L + + + E EA +F Q+ AV++ H
Sbjct: 109 ENVLMIALVLDYANAGDLRQEIKSRAKTNRTFREHEAGLLFIQVLLAVHHVH 160
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein
Serine/Threonine Kinase, G protein-coupled Receptor
Kinase 3. Serine/Threonine Kinases (STKs), G
protein-coupled Receptor Kinase (GRK) subfamily, GRK3
isoform, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The GRK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. GRKs phosphorylate and regulate G
protein-coupled receptors (GPCRs), the largest
superfamily of cell surface receptors which regulate
some part of nearly all physiological functions.
Phosphorylated GPCRs bind to arrestins, which prevents
further G protein signaling despite the presence of
activating ligand. There are seven types of GRKs, named
GRK1 to GRK7. GRK3 (also known as beta-adrenergic
receptor kinase 2) is widely expressed in many tissues.
GRK3-deficient mice show a lack of olfactory receptor
desensitization and altered regulation of the M2
muscarinic airway. GRK3 is involved in modulating the
cholinergic response of airway smooth muscles. It also
plays a role in dopamine receptor regulation. GRK3
promoter polymorphisms may be associated with bipolar
disorder.
Length = 279
Score = 29.2 bits (65), Expect = 0.095
Identities = 15/58 (25%), Positives = 29/58 (50%)
Query: 7 PNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCH 64
P I+ + F +K+ +++ GG+L+ L Q V +E+E R +I + + H
Sbjct: 57 PFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATEIILGLEHMH 114
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein
Serine/Threonine Kinase, STK25 or Yeast
Sps1/Ste20-related kinase 1. Serine/threonine kinases
(STKs), STK25 subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The STK25 subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. STK25 is also called Ste20/oxidant stress
response kinase 1 (SOK1) or yeast Sps1/Ste20-related
kinase 1 (YSK1). STK25 is localized in the Golgi
apparatus through its interaction with the Golgi matrix
protein GM130. It may play a role in the regulation of
cell migration and polarization. STK25 binds and
phosphorylates CCM3 (cerebral cavernous malformation 3),
also called PCD10 (programmed cell death 10), and may
play a role in apoptosis. Human STK25 is a candidate
gene responsible for pseudopseudohypoparathyroidism
(PPHP), a disease that shares features with the Albright
hereditary osteodystrophy (AHO) phenotype.
Length = 277
Score = 29.2 bits (65), Expect = 0.097
Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 1/64 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+S P I Y + K+ ++MEY GG D L + L E I R+I +
Sbjct: 56 LSQCDSPYITRYYGSYLKGTKLWIIMEYLGGGSALDLL-KPGPLEETYIATILREILKGL 114
Query: 61 YYCH 64
Y H
Sbjct: 115 DYLH 118
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein
Serine/Threonine Kinase, Classical Protein Kinase C.
Serine/Threonine Kinases (STKs), Classical (or
Conventional) Protein Kinase C (cPKC) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The cPKC subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase (PI3K). PKCs are
classified into three groups (classical, atypical, and
novel) depending on their mode of activation and the
structural characteristics of their regulatory domain.
PKCs undergo three phosphorylations in order to take
mature forms. In addition, cPKCs depend on calcium, DAG
(1,2-diacylglycerol), and in most cases,
phosphatidylserine (PS) for activation. cPKCs contain a
calcium-binding C2 region in their regulatory domain.
There are four cPKC isoforms, named alpha, betaI,
betaII, and gamma. cPKCs are potent kinases for
histones, myelin basic protein, and protamine. PKC-gamma
is mainly expressed in neuronal tissues. It plays a role
in protection from ischemia.
Length = 324
Score = 29.0 bits (65), Expect = 0.12
Identities = 15/61 (24%), Positives = 29/61 (47%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYCH 64
+ P + ++ F+ +++ VMEY GG+L + Q E A +IA +++ H
Sbjct: 59 KPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGKFKEPHAVFYAAEIAIGLFFLH 118
Query: 65 K 65
Sbjct: 119 S 119
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine
Kinases, Tyrosine kinase expressed in hepatocellular
carcinoma and Resting lymphocyte kinase. Protein
Tyrosine Kinase (PTK) family; Tyrosine kinase expressed
in hepatocellular carcinoma (Tec) and Resting
lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc
family is part of a larger superfamily, that includes
the catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Tec and
Rlk (also named Txk) are members of the Tec subfamily
of proteins, which are cytoplasmic (or nonreceptor) tyr
kinases with similarity to Src kinases in that they
contain Src homology protein interaction domains (SH3,
SH2) N-terminal to the catalytic tyr kinase domain.
Unlike Src kinases, most Tec subfamily members (except
Rlk) also contain an N-terminal pleckstrin homology
(PH) domain, which binds the products of PI3K and
allows membrane recruitment and activation. Instead of
PH, Rlk contains an N-terminal cysteine-rich region. In
addition to PH, Tec also contains the Tec homology (TH)
domain with proline-rich and zinc-binding regions. Tec
kinases are expressed mainly by haematopoietic cells.
Tec is more widely-expressed than other Tec subfamily
kinases. It is found in endothelial cells, both B- and
T-cells, and a variety of myeloid cells including mast
cells, erythroid cells, platelets, macrophages and
neutrophils. Rlk is expressed in T-cells and mast cell
lines. Tec and Rlk are both key components of T-cell
receptor (TCR) signaling. They are important in
TCR-stimulated proliferation, IL-2 production and
phopholipase C-gamma1 activation.
Length = 256
Score = 29.0 bits (65), Expect = 0.13
Identities = 11/42 (26%), Positives = 24/42 (57%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKK 42
M + HP ++ +Y V ++ + +V E+ G L ++L Q++
Sbjct: 53 MMKLSHPKLVQLYGVCTQQKPLYIVTEFMENGCLLNYLRQRQ 94
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein
Serine/Threonine Kinase, beta-adrenergic receptor
kinase. Serine/Threonine Kinases (STKs), G
protein-coupled Receptor Kinase (GRK) subfamily,
beta-adrenergic receptor kinase (beta-ARK) group,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The GRK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. GRKs
phosphorylate and regulate G protein-coupled receptors
(GPCRs), the largest superfamily of cell surface
receptors which regulate some part of nearly all
physiological functions. Phosphorylated GPCRs bind to
arrestins, which prevents further G protein signaling
despite the presence of activating ligand. There are
seven types of GRKs, named GRK1 to GRK7. The beta-ARK
group is composed of GRK2, GRK3, and similar proteins.
GRK2 and GRK3 are both widely expressed in many tissues,
although GRK2 is present at higher levels. They contain
an N-terminal RGS homology (RH) domain, a central
catalytic domain, and C-terminal pleckstrin homology
(PH) domain that mediates PIP2 and G protein
betagamma-subunit translocation to the membrane. GRK2
(also called beta-ARK or beta-ARK1) is important in
regulating several cardiac receptor responses. It plays
a role in cardiac development and in hypertension.
Deletion of GRK2 in mice results in embryonic lethality,
caused by hypoplasia of the ventricular myocardium. GRK2
also plays important roles in the liver (as a regulator
of portal blood pressure), in immune cells, and in the
nervous system. Altered GRK2 expression has been
reported in several disorders including major
depression, schizophrenia, bipolar disorder, and
Parkinsonism.
Length = 278
Score = 29.1 bits (65), Expect = 0.13
Identities = 13/44 (29%), Positives = 23/44 (52%)
Query: 7 PNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEAR 50
P I+ + F +K+ +++ GG+L+ L Q V +E E R
Sbjct: 57 PFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEAEMR 100
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein
Serine/Threonine Kinase, DMPK-related cell division
control protein 42 binding kinase alpha.
Serine/Threonine Kinases (STKs), DMPK-like subfamily,
DMPK-related cell division control protein 42 (Cdc42)
binding kinase (MRCK) alpha isoform, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The DMPK-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MRCK is activated via interaction with the
small GTPase Cdc42. MRCK/Cdc42 signaling mediates
myosin-dependent cell motility. MRCKalpha is expressed
ubiquitously in many tissues. It plays a role in the
regulation of peripheral actin reorganization and
neurite outgrowth. It may also play a role in the
transferrin iron uptake pathway.
Length = 332
Score = 28.9 bits (64), Expect = 0.16
Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
Query: 9 IIHIYEVFENREKMVLVMEYAAGGELYDFLDQ-KKVLTEEEARRIFRQIATAVYYCHKVQ 67
I ++ F++ + LVM+Y GG+L L + + L E+ AR ++ A+ H++
Sbjct: 63 ITTLHYAFQDENNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVIAIDSVHQLH 122
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine
Kinase, Receptor tyrosine kinase-like Orphan Receptor
2. Protein Tyrosine Kinase (PTK) family; Receptor
tyrosine kinase-like Orphan Receptor 2 (Ror2);
catalytic (c) domain. The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. Ror proteins are orphan
receptor tyr kinases (RTKs) containing an extracellular
region with immunoglobulin-like, cysteine-rich, and
kringle domains, a transmembrane segment, and an
intracellular catalytic domain. Ror RTKs are unrelated
to the nuclear receptor subfamily called
retinoid-related orphan receptors (RORs). RTKs are
usually activated through ligand binding, which causes
dimerization and autophosphorylation of the
intracellular tyr kinase catalytic domain. Ror2 plays
important roles in skeletal and heart formation.
Ror2-deficient mice show widespread bone abnormalities,
ventricular defects in the heart, and respiratory
dysfunction. Mutations in human Ror2 result in two
different bone development genetic disorders, recessive
Robinow syndrome and brachydactyly type B. Ror2 is also
implicated in neural development.
Length = 283
Score = 28.8 bits (64), Expect = 0.17
Identities = 10/37 (27%), Positives = 22/37 (59%)
Query: 2 SSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
S ++HPNI+ + V + + ++ Y + +L++FL
Sbjct: 63 SRLQHPNIVCLLGVVTKEQPLSMIFSYCSHSDLHEFL 99
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase
adapter protein. Protein Kinase family, STE20-related
kinase adapter protein (STRAD) subfamily, pseudokinase
domain. The STRAD subfamily is part of a larger
superfamily that includes the catalytic domains of
serine/threonine kinases (STKs), protein tyrosine
kinases, RIO kinases, aminoglycoside phosphotransferase,
choline kinase, and phosphoinositide 3-kinase. The
pseudokinase domain shows similarity to protein kinases
but lacks crucial residues for catalytic activity. STRAD
forms a complex with the scaffolding protein MO25, and
the STK, LKB1, resulting in the activation of the
kinase. In the complex, LKB1 phosphorylates and
activates adenosine monophosphate-activated protein
kinases (AMPKs), which regulate cell energy metabolism
and cell polarity. LKB1 is a tumor suppressor linked to
the rare inherited disease, Peutz-Jeghers syndrome,
which is characterized by a predisposition to benign
polyps and hyperpigmentation of the buccal mucosa. There
are two forms of STRAD, alpha and beta, that complex
with LKB1 and MO25. The structure of STRAD-alpha is
available and shows that this protein binds ATP, has an
ordered activation loop, and adopts a closed
conformation typical of fully active protein kinases. It
does not possess activity due to nonconservative
substitutions of essential catalytic residues. ATP
binding enhances the affinity of STRAD for MO25. The
conformation of STRAD-alpha stabilized through ATP and
MO25 may be needed to activate LKB1.
Length = 314
Score = 28.5 bits (64), Expect = 0.18
Identities = 16/67 (23%), Positives = 26/67 (38%), Gaps = 2/67 (2%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQ--KKVLTEEEARRIFRQIAT 58
++HPNI+ F ++ +V A G D L + L E I + +
Sbjct: 53 SRQLQHPNILPYVTSFIVDSELYVVSPLMAYGSCEDLLKTHFPEGLPELAIAFILKDVLN 112
Query: 59 AVYYCHK 65
A+ Y H
Sbjct: 113 ALDYIHS 119
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional.
Length = 294
Score = 28.2 bits (63), Expect = 0.21
Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 15/72 (20%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVL--TEEEAR--RIFR-- 54
+ ++H NI+ + +V + +++ LV EY LD KK + + + A+ R+ +
Sbjct: 55 LKEMQHGNIVRLQDVVHSEKRLYLVFEYLD-------LDLKKHMDSSPDFAKNPRLIKTY 107
Query: 55 --QIATAVYYCH 64
QI + YCH
Sbjct: 108 LYQILRGIAYCH 119
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine
Kinase, Fibroblast Growth Factor Receptor 4. Protein
Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
Receptor 4 (FGFR4); catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. FGFR4 is
part of the FGFR subfamily, which are receptor tyr
kinases (RTKs) containing an extracellular
ligand-binding region with three immunoglobulin-like
domains, a transmembrane segment, and an intracellular
catalytic domain. The binding of FGFRs to their ligands,
the FGFs, results in receptor dimerization and
activation, and intracellular signaling. The binding of
FGFs to FGFRs is promiscuous, in that a receptor may be
activated by several ligands and a ligand may bind to
more that one type of receptor. Unlike other FGFRs,
there is only one splice form of FGFR4. It binds FGF1,
FGF2, FGF6, FGF19, and FGF23. FGF19 is a selective
ligand for FGFR4. Although disruption of FGFR4 in mice
causes no obvious phenotype, in vivo inhibition of FGFR4
in cultured skeletal muscle cells resulted in an arrest
of muscle progenitor differentiation. FGF6 and FGFR4 are
uniquely expressed in myofibers and satellite cells.
FGF6/FGFR4 signaling appears to play a key role in the
regulation of muscle regeneration. A polymorphism in
FGFR4 is found in head and neck squamous cell carcinoma.
Length = 314
Score = 28.4 bits (63), Expect = 0.21
Identities = 13/38 (34%), Positives = 23/38 (60%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKK 42
+H NII++ V + +++EYAA G L +FL ++
Sbjct: 76 KHKNIINLLGVCTQEGPLYVIVEYAAKGNLREFLRARR 113
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein
Serine/Threonine Kinase, Rho-associated coiled-coil
containing protein kinase 1. Serine/Threonine Kinases
(STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The ROCK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. ROCK contains an
N-terminal extension, a catalytic kinase domain, and a
C-terminal extension, which contains a coiled-coil
region encompassing a Rho-binding domain (RBD) and a
pleckstrin homology (PH) domain. ROCK is auto-inhibited
by the RBD and PH domain interacting with the catalytic
domain, and is activated via interaction with Rho
GTPases. ROCK1 is preferentially expressed in the liver,
lung, spleen, testes, and kidney. It mediates signaling
from Rho to the actin cytoskeleton. It is implicated in
the development of cardiac fibrosis, cardiomyocyte
apoptosis, and hyperglycemia. Mice deficient with ROCK1
display eyelids open at birth (EOB) and omphalocele
phenotypes due to the disorganization of actin filaments
in the eyelids and the umbilical ring.
Length = 371
Score = 28.4 bits (63), Expect = 0.22
Identities = 11/43 (25%), Positives = 23/43 (53%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKV 43
M+ P ++ ++ F++ + +VMEY GG+L + + V
Sbjct: 97 MAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDV 139
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase,
Yes. Protein Tyrosine Kinase (PTK) family; Yes kinase;
catalytic (c) domain. The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. Yes (or c-Yes) is a
member of the Src subfamily of proteins, which are
cytoplasmic (or non-receptor) tyr kinases. Src kinases
contain an N-terminal SH4 domain with a myristoylation
site, followed by SH3 and SH2 domains, a tyr kinase
domain, and a regulatory C-terminal region containing a
conserved tyr. They are activated by autophosphorylation
at the tyr kinase domain, but are negatively regulated
by phosphorylation at the C-terminal tyr by Csk
(C-terminal Src Kinase). Src proteins are involved in
signaling pathways that regulate cytokine and growth
factor responses, cytoskeleton dynamics, cell
proliferation, survival, and differentiation. c-Yes
kinase is the cellular homolog of the oncogenic protein
(v-Yes) encoded by the Yamaguchi 73 and Esh sarcoma
viruses. It displays functional overlap with other Src
subfamily members, particularly Src. It also shows some
unique functions such as binding to occludins,
transmembrane proteins that regulate extracellular
interactions in tight junctions. Yes also associates
with a number of proteins in different cell types that
Src does not interact with, like JAK2 and gp130 in
pre-adipocytes, and Pyk2 in treated pulmonary vein
endothelial cells. Although the biological function of
Yes remains unclear, it appears to have a role in
regulating cell-cell interactions and vesicle
trafficking in polarized cells.
Length = 260
Score = 28.5 bits (63), Expect = 0.23
Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 3/68 (4%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQ--KKVLTEEEARRIFRQIAT 58
M +RH ++ +Y V + E + +V E+ G L DFL + K L + + QIA
Sbjct: 55 MKKLRHDKLVPLYAVV-SEEPIYIVTEFMGKGSLLDFLKEGDGKYLKLPQLVDMAAQIAD 113
Query: 59 AVYYCHKV 66
+ Y ++
Sbjct: 114 GMAYIERM 121
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine
Kinase, Tropomyosin Related Kinase B. Protein Tyrosine
Kinase (PTK) family; Tropomyosin Related Kinase B
(TrkB); catalytic (c) domain. The PTKc family is part of
a larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. TrkB is a member of the
Trk subfamily of proteins, which are receptor tyr
kinases (RTKs) containing an extracellular region with
arrays of leucine-rich motifs flanked by two
cysteine-rich clusters followed by two
immunoglobulin-like domains, a transmembrane segment,
and an intracellular catalytic domain. Binding of TrkB
to its ligands, brain-derived neurotrophic factor (BDNF)
or neurotrophin 4 (NT4), results in receptor
oligomerization and activation of the catalytic domain.
TrkB is broadly expressed in the nervous system and in
some non-neural tissues. It plays important roles in
cell proliferation, differentiation, and survival.
BDNF/Trk signaling plays a key role in regulating
activity-dependent synaptic plasticity. TrkB also
contributes to protection against gp120-induced neuronal
cell death. TrkB overexpression is associated with poor
prognosis in neuroblastoma (NB) and other human cancers.
It acts as a suppressor of anoikis (detachment-induced
apoptosis) and contributes to tumor metastasis.
Length = 288
Score = 28.1 bits (62), Expect = 0.24
Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 13/75 (17%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL-------------DQKKVLTEE 47
+++++H +I+ Y V + +++V EY G+L FL ++ LT+
Sbjct: 61 LTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNRPAELTQS 120
Query: 48 EARRIFRQIATAVYY 62
+ I +QIA + Y
Sbjct: 121 QMLHIAQQIAAGMVY 135
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal
Pek1-like dual-specificity MAP kinase kinases. Protein
kinases (PKs), MAP kinase kinase(MAPKK) subfamily,
fungal Pek1-like proteins, catalytic (c) domain. PKs
catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine or tyrosine residues on
protein substrates. The MAPKK subfamily is part of a
larger superfamily that includes the catalytic domains
of other protein serine/threonine kinases, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. The mitogen-activated
protein (MAP) kinase signaling pathways are important
mediators of cellular responses to extracellular
signals. The pathways involve a triple kinase core
cascade comprising of the MAP kinase (MAPK), which is
phosphorylated and activated by a MAPK kinase (MAPKK or
MKK), which itself is phosphorylated and activated by a
MAPK kinase kinase (MAPKKK or MKKK). Members of this
group include the MAPKKs Pek1/Skh1 from
Schizosaccharomyces pombe and MKK2 from Saccharomyces
cerevisiae, and related proteins. Both fission yeast
Pek1 and baker's yeast MKK2 are components of the cell
integrity MAPK pathway. In fission yeast, Pek1
phosphorylates and activates the MAPK Pmk1/Spm1 and is
regulated by the MAPKKK Mkh1. In baker's yeast, the
pathway involves the MAPK Slt2, the MAPKKs MKK1 and
MKK2, and the MAPKKK Bck1. The cell integrity MAPK
cascade is activated by multiple stress conditions, and
is essential in cell wall construction, morphogenesis,
cytokinesis, and ion homeostasis.
Length = 287
Score = 28.2 bits (63), Expect = 0.25
Identities = 11/36 (30%), Positives = 16/36 (44%), Gaps = 2/36 (5%)
Query: 1 MSSVRHPNIIHIYEVF-ENREKMV-LVMEYAAGGEL 34
S + P I+ Y F + + + MEY GG L
Sbjct: 53 NKSCKSPYIVKYYGAFLDESSSSIGIAMEYCEGGSL 88
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein
Serine/Threonine Kinase, DMPK-related cell division
control protein 42 binding kinase beta.
Serine/Threonine Kinases (STKs), DMPK-like subfamily,
DMPK-related cell division control protein 42 (Cdc42)
binding kinase (MRCK) beta isoform, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The DMPK-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. MRCK is activated via interaction with the
small GTPase Cdc42. MRCK/Cdc42 signaling mediates
myosin-dependent cell motility. MRCKbeta is expressed
ubiquitously in many tissues.
Length = 331
Score = 28.0 bits (62), Expect = 0.29
Identities = 16/60 (26%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
Query: 9 IIHIYEVFENREKMVLVMEYAAGGELYDFLDQ-KKVLTEEEARRIFRQIATAVYYCHKVQ 67
I ++ F++ + LVM+Y GG+L L + + L E+ AR ++ A++ H++
Sbjct: 63 ITTLHYAFQDENYLYLVMDYYVGGDLLTLLSKFEDRLPEDMARFYIAEMVLAIHSIHQLH 122
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy
protein kinase-like Protein Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Myotonic Dystrophy
protein kinase (DMPK)-like subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The DMPK-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. The DMPK-like subfamily is composed of DMPK
and DMPK-related cell division control protein 42
(Cdc42) binding kinase (MRCK). Three isoforms of MRCK
are known, named alpha, beta and gamma. The DMPK gene is
implicated in myotonic dystrophy 1 (DM1), an inherited
multisystemic disorder with symptoms that include muscle
hyperexcitability, progressive muscle weakness and
wasting, cataract development, testicular atrophy, and
cardiac conduction defects. The genetic basis for DM1 is
the mutational expansion of a CTG repeat in the 3'-UTR
of DMPK. DMPK is expressed in skeletal and cardiac
muscles, and in central nervous tissues. The functional
role of DMPK is not fully understood. It may play a role
in the signal transduction and homeostasis of calcium.
MRCK is activated via interaction with the small GTPase
Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent
cell motility. MRCKgamma is expressed in heart and
skeletal muscles, unlike MRCKalpha and MRCKbeta, which
are expressed ubiquitously.
Length = 331
Score = 27.8 bits (62), Expect = 0.30
Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
Query: 9 IIHIYEVFENREKMVLVMEYAAGGELYDFLDQ-KKVLTEEEARRIFRQIATAVYYCHKV 66
I +++ F++ + LVM+Y GG+L L + + L E+ AR ++ A+ H++
Sbjct: 63 ITNLHYAFQDENNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVLAIDSVHQL 121
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine
Kinase, Tropomyosin Related Kinase C. Protein Tyrosine
Kinase (PTK) family; Tropomyosin Related Kinase C
(TrkC); catalytic (c) domain. The PTKc family is part
of a larger superfamily that includes the catalytic
domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. TrkC is
a member of the Trk subfamily of proteins, which are
receptor tyr kinases (RTKs) containing an extracellular
region with arrays of leucine-rich motifs flanked by
two cysteine-rich clusters followed by two
immunoglobulin-like domains, a transmembrane segment,
and an intracellular catalytic domain. Binding of TrkC
to its ligand, neurotrophin 3 (NT3), results in
receptor oligomerization and activation of the
catalytic domain. TrkC is broadly expressed in the
nervous system and in some non-neural tissues including
the developing heart. NT3/TrkC signaling plays an
important role in the innervation of the cardiac
conducting system and the development of smooth muscle
cells. Mice deficient with NT3 and TrkC have multiple
heart defects. NT3/TrkC signaling is also critical for
the development and maintenance of enteric neurons that
are important for the control of gut peristalsis.
Length = 291
Score = 27.7 bits (61), Expect = 0.34
Identities = 11/38 (28%), Positives = 24/38 (63%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
+++++H +I+ Y V + + +++V EY G+L FL
Sbjct: 61 LTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFL 98
>gnl|CDD|215307 PLN02567, PLN02567, alpha,alpha-trehalase.
Length = 554
Score = 27.7 bits (62), Expect = 0.36
Identities = 6/19 (31%), Positives = 12/19 (63%)
Query: 41 KKVLTEEEARRIFRQIATA 59
K + E ++++R IA+A
Sbjct: 281 SKFSSSSEKQQLYRDIASA 299
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein
Serine/Threonine Kinase, Class IIIA myosin.
Serine/threonine kinases (STKs), class IIIA myosin
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
class III myosin subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. Class III myosins are motor
proteins containing an N-terminal kinase catalytic
domain and a C-terminal actin-binding domain. Class III
myosins may play an important role in maintaining the
structural integrity of photoreceptor cell microvilli.
In photoreceptor cells, they may also function as cargo
carriers during light-dependent translocation of
proteins such as transducin and arrestin. Class IIIA
myosin is highly expressed in retina and in inner ear
hair cells. It is localized to the distal ends of
actin-bundled structures. Mutations in human myosin IIIA
are responsible for progressive nonsyndromic hearing
loss. Human myosin IIIA possesses ATPase and kinase
activities, and the ability to move actin filaments in a
motility assay. It may function as a cellular
transporter capable of moving along actin bundles in
sensory cells.
Length = 286
Score = 27.7 bits (61), Expect = 0.39
Identities = 11/38 (28%), Positives = 22/38 (57%), Gaps = 5/38 (13%)
Query: 6 HPNIIHIYEVF-----ENREKMVLVMEYAAGGELYDFL 38
HPN++ Y ++ +N +++ LV+E GG + D +
Sbjct: 74 HPNVVKFYGMYYKKDVKNGDQLWLVLELCNGGSVTDLV 111
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine
Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases
(STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The PFTAIRE-1 subfamily is part of a larger superfamily
that includes the catalytic domains of other protein
STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. PFTAIRE-1 shares sequence
similarity with Cyclin-Dependent Kinases (CDKs), which
belong to a large family of STKs that are regulated by
their cognate cyclins. Together, CDKs and cyclins are
involved in the control of cell-cycle progression,
transcription, and neuronal function. PFTAIRE-1 is
widely expressed except in the spleen and thymus. It is
highly expressed in the brain, heart, pancreas, testis,
and ovary, and is localized in the cytoplasm. It is
regulated by cyclin D3 and is inhibited by the p21 cell
cycle inhibitor. It has also been shown to interact with
the membrane-associated cyclin Y, which recruits the
protein to the plasma membrane.
Length = 303
Score = 27.7 bits (61), Expect = 0.43
Identities = 15/66 (22%), Positives = 33/66 (50%), Gaps = 2/66 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKK-VLTEEEARRIFRQIATA 59
+ ++H NI+ ++++ +E + LV EY +L ++D+ L E + Q+
Sbjct: 57 LKGLKHANIVLLHDIIHTKETLTLVFEYVH-TDLCQYMDKHPGGLHPENVKLFLFQLLRG 115
Query: 60 VYYCHK 65
+ Y H+
Sbjct: 116 LSYIHQ 121
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine
Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK)
family; Src-related kinase lacking C-terminal regulatory
tyrosine and N-terminal myristylation sites (Srm) and
breast tumor kinase (Brk, also called protein tyrosine
kinase 6); catalytic (c) domains. The PTKc family is
part of a larger superfamily that includes the catalytic
domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Srm and
Brk are a member of the Src subfamily of proteins, which
are cytoplasmic (or non-receptor) tyr kinases. Src
kinases in general contain an N-terminal SH4 domain with
a myristoylation site, followed by SH3 and SH2 domains,
a tyr kinase domain, and a regulatory C-terminal region
containing a conserved tyr; they are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). Srm and
Brk however, lack the N-terminal myristylation sites.
Src proteins are involved in signaling pathways that
regulate cytokine and growth factor responses,
cytoskeleton dynamics, cell proliferation, survival, and
differentiation. Brk has been found to be overexpressed
in a majority of breast tumors.
Length = 261
Score = 27.4 bits (61), Expect = 0.46
Identities = 15/64 (23%), Positives = 29/64 (45%), Gaps = 2/64 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLD--QKKVLTEEEARRIFRQIAT 58
+ +RH ++I ++ V E + ++ E G L FL + +VL + Q+A
Sbjct: 56 LKRLRHKHLISLFAVCSVGEPVYIITELMEKGSLLAFLRSPEGQVLPVASLIDMACQVAE 115
Query: 59 AVYY 62
+ Y
Sbjct: 116 GMAY 119
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase,
Abelson kinase. Protein Tyrosine Kinase (PTK) family;
Abelson (Abl) kinase; catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Abl (or
c-Abl) is a ubiquitously-expressed cytoplasmic (or
nonreceptor) tyr kinase that contains SH3, SH2, and tyr
kinase domains in its N-terminal region, as well as
nuclear localization motifs, a putative DNA-binding
domain, and F- and G-actin binding domains in its
C-terminal tail. It also contains a short autoinhibitory
cap region in its N-terminus. Abl is normally inactive
and requires phosphorylation and myristoylation for
activation. Abl function depends on its subcellular
localization. In the cytoplasm, Abl plays a role in cell
proliferation and survival. In response to DNA damage or
oxidative stress, Abl is transported to the nucleus
where it induces apoptosis. In chronic myelogenous
leukemia (CML) patients, an aberrant translocation
results in the replacement of the first exon of Abl with
the BCR (breakpoint cluster region) gene. The resulting
BCR-Abl fusion protein is constitutively active and
associates into tetramers, resulting in a hyperactive
kinase sending a continuous signal. This leads to
uncontrolled proliferation, morphological transformation
and anti-apoptotic effects. BCR-Abl is the target of
selective inhibitors, such as imatinib (Gleevec), used
in the treatment of CML. Abl2, also known as ARG
(Abelson-related gene), is thought to play a cooperative
role with Abl in the proper development of the nervous
system. The Tel-ARG fusion protein, resulting from
reciprocal translocation between chromosomes 1 and 12,
is associated with acute myeloid leukemia (AML). The TEL
gene is a frequent fusion partner of other tyr kinase
oncogenes, including Tel/Abl, Tel/PDGFRbeta, and
Tel/Jak2, found in patients with leukemia and
myeloproliferative disorders.
Length = 263
Score = 27.1 bits (60), Expect = 0.52
Identities = 15/67 (22%), Positives = 32/67 (47%), Gaps = 2/67 (2%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQ--KKVLTEEEARRIFRQIAT 58
M ++HPN++ + V ++ E+ G L D+L + ++ + + QI++
Sbjct: 56 MKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISS 115
Query: 59 AVYYCHK 65
A+ Y K
Sbjct: 116 AMEYLEK 122
>gnl|CDD|218977 pfam06293, Kdo, Lipopolysaccharide kinase (Kdo/WaaP) family. These
lipopolysaccharide kinases are related to protein
kinases pfam00069. This family includes waaP (rfaP) gene
product is required for the addition of phosphate to O-4
of the first heptose residue of the lipopolysaccharide
(LPS) inner core region. It has previously been shown
that WaaP is necessary for resistance to hydrophobic and
polycationic antimicrobials in E. coli and that it is
required for virulence in invasive strains of S.
enterica.
Length = 206
Score = 27.3 bits (61), Expect = 0.52
Identities = 12/47 (25%), Positives = 20/47 (42%), Gaps = 1/47 (2%)
Query: 24 LVMEYAAGGE-LYDFLDQKKVLTEEEARRIFRQIATAVYYCHKVQDN 69
L+ E G + L +L Q EE R ++R + + H+ N
Sbjct: 94 LLTERLEGAQDLVTWLAQWADPAEELRRALWRAVGRLIARMHRAGVN 140
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein
Serine/Threonine Kinase, Thousand-and-one amino acids 2.
Serine/threonine kinases (STKs), thousand-and-one amino
acids 2 (TAO2) subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The TAO subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. TAO proteins possess mitogen-activated protein
kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
activity. MAPK signaling cascades are important in
mediating cellular responses to extracellular signals.
Human TAO2 is also known as prostate-derived Ste20-like
kinase (PSK) and was identified in a screen for
overexpressed RNAs in prostate cancer. TAO2 activates
both p38 and c-Jun N-terminal kinase (JNK), by
phosphorylating and activating the respective MAP/ERK
kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6
and MKK4/MKK7. TAO2 contains a long C-terminal extension
with autoinhibitory segments. It is activated by the
release of this inhibition and the phosphorylation of
its activation loop serine. TAO2 functions as a
regulator of actin cytoskeletal and microtubule
organization. In addition, it regulates the transforming
growth factor-activated kinase 1 (TAK1), which is a
MAPKKK that plays an essential role in the signaling
pathways of tumor necrosis factor (TNF), interleukin 1
(IL-1), and Toll-like receptor (TLR).
Length = 308
Score = 27.3 bits (60), Expect = 0.56
Identities = 20/65 (30%), Positives = 26/65 (40%), Gaps = 2/65 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLD-QKKVLTEEEARRIFRQIATA 59
+ +RHPN I + LVMEY G D L+ KK L E E +
Sbjct: 69 LQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSA-SDLLEVHKKPLQEVEIAAVTHGALQG 127
Query: 60 VYYCH 64
+ Y H
Sbjct: 128 LAYLH 132
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine
Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase
(PTK) family; Ephrin Receptor (EphR) subfamily; EphA10
receptor; catalytic (c) domain. The PTKc family is part
of a larger superfamily that includes the catalytic
domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. EphRs
comprise the largest subfamily of receptor tyr kinases
(RTKs). In general, class EphA receptors bind
GPI-anchored ephrin-A ligands. There are ten vertebrate
EphA receptors (EphA1-10), which display promiscuous
interactions with six ephrin-A ligands. EphRs contain
an ephrin binding domain and two fibronectin repeats
extracellularly, a transmembrane segment, and a
cytoplasmic tyr kinase domain. Binding of the ephrin
ligand to EphR requires cell-cell contact since both
are anchored to the plasma membrane. The resulting
downstream signals occur bidirectionally in both
EphR-expressing cells (forward signaling) and
ephrin-expressing cells (reverse signaling). EphA10,
which contains an inactive tyr kinase domain, may
function to attenuate signals of co-clustered active
receptors. EphA10 is mainly expressed in the testis.
Ephrin/EphR interaction results in cell-cell repulsion
or adhesion, making it important in neural development
and plasticity, cell morphogenesis, cell-fate
determination, embryonic development, tissue
patterning, and angiogenesis.
Length = 266
Score = 27.2 bits (60), Expect = 0.57
Identities = 12/38 (31%), Positives = 18/38 (47%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
+ H NI+ + V M++V EY + G L FL
Sbjct: 60 LGQFDHSNIVRLEGVITRGNTMMIVTEYMSNGALDSFL 97
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the
Protein Tyrosine Kinases, Janus kinases. Protein
Tyrosine Kinase (PTK) family; Janus kinase (Jak)
subfamily; catalytic (c) domain (repeat 2). The Jak
subfamily is composed of Jak1, Jak2, Jak3, TYK2, and
similar proteins. The PTKc family is part of a larger
superfamily that includes the catalytic domains of
other kinases such as protein serine/threonine kinases,
RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
catalyze the transfer of the gamma-phosphoryl group
from ATP to tyrosine (tyr) residues in protein
substrates. Jak subfamily proteins are cytoplasmic (or
nonreceptor) tyr kinases containing an N-terminal FERM
domain, followed by a Src homology 2 (SH2) domain, a
pseudokinase domain, and a C-terminal tyr kinase
catalytic domain. Most Jaks are expressed in a wide
variety of tissues, except for Jak3, which is expressed
only in hematopoietic cells. Jaks are crucial for
cytokine receptor signaling. They are activated by
autophosphorylation upon cytokine-induced receptor
aggregation, and subsequently trigger downstream
signaling events such as the phosphorylation of signal
transducers and activators of transcription (STATs).
Jaks are also involved in regulating the surface
expression of some cytokine receptors. The Jak-STAT
pathway is involved in many biological processes
including hematopoiesis, immunoregulation, host
defense, fertility, lactation, growth, and
embryogenesis.
Length = 284
Score = 27.0 bits (60), Expect = 0.61
Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 2/40 (5%)
Query: 1 MSSVRHPNIIHIYEVFE--NREKMVLVMEYAAGGELYDFL 38
+ ++ H NI+ V E + L+MEY G L D+L
Sbjct: 60 LRTLDHENIVKYKGVCEKPGGRSLRLIMEYLPSGSLRDYL 99
>gnl|CDD|235828 PRK06556, PRK06556, vitamin B12-dependent ribonucleotide reductase;
Validated.
Length = 953
Score = 27.2 bits (61), Expect = 0.64
Identities = 8/22 (36%), Positives = 15/22 (68%)
Query: 42 KVLTEEEARRIFRQIATAVYYC 63
+V+ +A+ +FR+IA A + C
Sbjct: 308 EVIETVDAKELFRKIAEAAWEC 329
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine
Kinases, Bruton's tyrosine kinase and Bone marrow
kinase on the X chromosome. Protein Tyrosine Kinase
(PTK) family; Bruton's tyrosine kinase (Btk) and Bone
marrow kinase on the X chromosome (Bmx); catalytic (c)
domain. The PTKc family is part of a larger superfamily
that includes the catalytic domains of other kinases
such as protein serine/threonine kinases, RIO kinases,
and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Btk and
Bmx (also named Etk) are members of the Tec subfamily
of proteins, which are cytoplasmic (or nonreceptor) tyr
kinases with similarity to Src kinases in that they
contain Src homology protein interaction domains (SH3,
SH2) N-terminal to the catalytic tyr kinase domain.
Unlike Src kinases, most Tec subfamily members (except
Rlk) also contain an N-terminal pleckstrin homology
(PH) domain, which binds the products of PI3K and
allows membrane recruitment and activation. In
addition, Btk contains the Tec homology (TH) domain
with proline-rich and zinc-binding regions. Tec kinases
are expressed mainly by haematopoietic cells. Btk is
expressed in B-cells, and a variety of myeloid cells
including mast cells, platelets, neutrophils, and
dendrictic cells. It interacts with a variety of
partners, from cytosolic proteins to nuclear
transcription factors, suggesting a diversity of
functions. Stimulation of a diverse array of cell
surface receptors, including antigen engagement of the
B-cell receptor (BCR), leads to PH-mediated membrane
translocation of Btk and subsequent phosphorylation by
Src kinase and activation. Btk plays an important role
in the life cycle of B-cells including their
development, differentiation, proliferation, survival,
and apoptosis. Mutations in Btk cause the primary
immunodeficiency disease, X-linked agammaglobulinaemia
(XLA) in humans. Bmx is primarily expressed in bone
marrow and the arterial endothelium, and plays an
important role in ischemia-induced angiogenesis. It
facilitates arterial growth, capillary formation,
vessel maturation, and bone marrow-derived endothelial
progenitor cell mobilization.
Length = 256
Score = 26.8 bits (59), Expect = 0.76
Identities = 10/38 (26%), Positives = 20/38 (52%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
M + H ++ +Y V + + +V EY + G L ++L
Sbjct: 53 MMKLSHEKLVQLYGVCTKQRPIYIVTEYMSNGCLLNYL 90
>gnl|CDD|181983 PRK09603, PRK09603, bifunctional DNA-directed RNA polymerase
subunit beta/beta'; Reviewed.
Length = 2890
Score = 26.8 bits (59), Expect = 0.81
Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 2/33 (6%)
Query: 21 KMVL--VMEYAAGGELYDFLDQKKVLTEEEARR 51
KM+ +ME+ GG+L F+DQ L+E +R
Sbjct: 510 KMITSTIMEFFMGGQLSQFMDQTNPLSEVTHKR 542
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine
Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases
(STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The PFTAIRE-2 subfamily is part of a larger
superfamily that includes the catalytic domains of
other protein STKs, protein tyrosine kinases, RIO
kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares
sequence similarity with Cyclin-Dependent Kinases
(CDKs), which belong to a large family of STKs that are
regulated by their cognate cyclins. Together, CDKs and
cyclins are involved in the control of cell-cycle
progression, transcription, and neuronal function.
PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic
lateral sclerosis 2 (juvenile) chromosome region
candidate 7). It may be associated with amyotrophic
lateral sclerosis 2 (ALS2), an autosomal recessive form
of juvenile ALS. The function of PFTAIRE-2 is not yet
known.
Length = 291
Score = 26.9 bits (59), Expect = 0.81
Identities = 7/28 (25%), Positives = 17/28 (60%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEY 28
+ ++H NI+ ++++ +E + V EY
Sbjct: 57 LKGLKHANIVLLHDIIHTKETLTFVFEY 84
>gnl|CDD|236091 PRK07768, PRK07768, long-chain-fatty-acid--CoA ligase; Validated.
Length = 545
Score = 26.5 bits (59), Expect = 0.88
Identities = 11/43 (25%), Positives = 15/43 (34%), Gaps = 12/43 (27%)
Query: 19 REKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVY 61
RE + +E A + E RRI Q+A V
Sbjct: 478 REGFAVAVESNAFED------------PAEVRRIRHQVAHEVV 508
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine
Kinase, Fibroblast Growth Factor Receptor 2. Protein
Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
Receptor 2 (FGFR2); catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. FGFR2 is
part of the FGFR subfamily, which are receptor tyr
kinases (RTKs) containing an extracellular
ligand-binding region with three immunoglobulin-like
domains, a transmembrane segment, and an intracellular
catalytic domain. The binding of FGFRs to their ligands,
the FGFs, results in receptor dimerization and
activation, and intracellular signaling. The binding of
FGFs to FGFRs is promiscuous, in that a receptor may be
activated by several ligands and a ligand may bind to
more that one type of receptor. There are many splice
variants of FGFR2 which show differential expression and
binding to FGF ligands. Disruption of either FGFR2 or
FGFR2b is lethal in mice, due to defects in the placenta
or severe impairment of tissue development including
lung, limb, and thyroid, respectively. Disruption of
FGFR2c in mice results in defective bone and skull
development. Genetic alterations of FGFR2 are associated
with many human skeletal disorders including Apert
syndrome, Crouzon syndrome, Jackson-Weiss syndrome, and
Pfeiffer syndrome.
Length = 304
Score = 26.5 bits (58), Expect = 0.94
Identities = 13/50 (26%), Positives = 26/50 (52%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFR 54
+H NII++ + +++EYA+ G L ++L ++ E + I R
Sbjct: 79 KHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDIAR 128
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent
protein Kinase 8-like Serine/Threonine Kinases.
Serine/Threonine Kinases (STKs), Cyclin-Dependent
protein Kinase 8 (CDK8)-like subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The CDK8-like subfamily
is part of a larger superfamily that includes the
catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. CDKs belong to a large
family of STKs that are regulated by their cognate
cyclins. Together, they are involved in the control of
cell-cycle progression, transcription, and neuronal
function. This subfamily is composed of CDK8, CDC2L6,
and similar proteins. CDK8 functions as a negative or
positive regulator of transcription, depending on the
scenario. Together with its regulator, cyclin C, it
reversibly associates with the multi-subunit core
Mediator complex, a cofactor that is involved in
regulating RNA polymerase II (RNAP II)-dependent
transcription. CDC2L6 also associates with Mediator in
complexes lacking CDK8. In VP16-dependent
transcriptional activation, CDK8 and CDC2L6 exerts
opposing effects by positive and negative regulation,
respectively, in similar conditions.
Length = 316
Score = 26.5 bits (59), Expect = 1.1
Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 6/37 (16%)
Query: 4 VRHPNIIHIYEVF-ENREKMV-LVMEYAAGGELYDFL 38
++H N++ + EVF E+ +K V L+ +YA +D
Sbjct: 59 LKHENVVSLVEVFLEHADKSVYLLFDYAE----HDLW 91
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the
Protein Tyrosine Kinases, Janus kinases 2 and 3.
Protein Tyrosine Kinase (PTK) family; Janus kinase 2
(Jak2) and Jak3; catalytic (c) domain (repeat 2). The
PTKc family is part of a larger superfamily that
includes the catalytic domains of other kinases such as
protein serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Jak2 and
Jak3 are members of the Janus kinase (Jak) subfamily of
proteins, which are cytoplasmic (or nonreceptor) tyr
kinases containing an N-terminal FERM domain, followed
by a Src homology 2 (SH2) domain, a pseudokinase domain,
and a C-terminal catalytic tyr kinase domain. Jaks are
crucial for cytokine receptor signaling. They are
activated by autophosphorylation upon cytokine-induced
receptor aggregation, and subsequently trigger
downstream signaling events such as the phosphorylation
of signal transducers and activators of transcription
(STATs). Jak2 is widely expressed in many tissues while
Jak3 is expressed only in hematopoietic cells. Jak2 is
essential for the signaling of hormone-like cytokines
such as growth hormone, erythropoietin, thrombopoietin,
and prolactin, as well as some IFNs and cytokines that
signal through the IL-3 and gp130 receptors. Jak3 binds
the shared receptor subunit common gamma chain and thus,
is essential in the signaling of cytokines that use it
such as IL-2, IL-4, IL-7, IL-9, IL-15, and IL-21.
Disruption of Jak2 in mice results in an embryonic
lethal phenotype with multiple defects including
erythropoietic and cardiac abnormalities. It is the only
Jak gene that results in a lethal phenotype when
disrupted in mice. A mutation in the pseudokinase domain
of Jak2, V617F, is present in many myeloproliferative
diseases, including almost all patients with
polycythemia vera, and 50% of patients with essential
thrombocytosis and myelofibrosis. Jak3 is important in
lymphoid development and myeloid cell differentiation.
Inactivating mutations in Jak3 have been reported in
humans with severe combined immunodeficiency (SCID).
Length = 284
Score = 26.3 bits (58), Expect = 1.4
Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 2/44 (4%)
Query: 1 MSSVRHPNIIHIYEVF--ENREKMVLVMEYAAGGELYDFLDQKK 42
+ S++H NI+ V R + LVMEY G L D+L + +
Sbjct: 59 LKSLQHDNIVKYKGVCYSAGRRNLRLVMEYLPYGSLRDYLQKHR 102
>gnl|CDD|235101 PRK03059, PRK03059, PII uridylyl-transferase; Provisional.
Length = 856
Score = 26.0 bits (58), Expect = 1.4
Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
Query: 22 MVLVMEYAAG-GELYDFLDQKKVLTEEEARRIFRQ 55
+L + AAG G + L ++ ++T+ EAR++ R
Sbjct: 204 TILWIARAAGLGSSWRELAKRGLITDREARQLRRN 238
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine
Kinase, G protein-coupled Receptor Kinase.
Serine/Threonine Kinases (STKs), G protein-coupled
Receptor Kinase (GRK) subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The GRK subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. GRKs phosphorylate and
regulate G protein-coupled receptors (GPCRs), the
largest superfamily of cell surface receptors, which
regulate some part of nearly all physiological
functions. Phosphorylated GPCRs bind to arrestins, which
prevents further G protein signaling despite the
presence of activating ligand. GRKs contain a central
catalytic domain, flanked by N- and C-terminal
extensions. The N-terminus contains an RGS (regulator of
G protein signaling) homology (RH) domain and several
motifs. The C-terminus diverges among different groups
of GRKs. There are seven types of GRKs, named GRK1 to
GRK7. They are subdivided into three main groups: visual
(GRK1/7); beta-adrenergic receptor kinases (GRK2/3); and
GRK4-like (GRK4/5/6). Expression of GRK2/3/5/6 is
widespread while GRK1/4/7 show a limited tissue
distribution. The substrate spectrum of the widely
expressed GRKs partially overlaps. GRKs play important
roles in the cardiovascular, immune, respiratory,
skeletal, and nervous systems.
Length = 277
Score = 25.9 bits (57), Expect = 1.6
Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 2/67 (2%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIF--RQIAT 58
+ V I+ + FE ++ + LVM GG+L + EAR IF QI
Sbjct: 47 LEKVSSRFIVSLAYAFETKDDLCLVMTLMNGGDLKYHIYNVGEPGFPEARAIFYAAQIIC 106
Query: 59 AVYYCHK 65
+ + H+
Sbjct: 107 GLEHLHQ 113
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine
Kinases, Apoptosis-associated tyrosine kinases. Protein
Tyrosine Kinase (PTK) family; Apoptosis-associated
tyrosine kinase (Aatyk) subfamily; catalytic (c) domain.
The Aatyk subfamily is also referred to as the lemur
tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1
(Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and
similar proteins. The PTKc family is part of a larger
superfamily that includes the catalytic domains of other
kinases such as protein serine/threonine kinases, RIO
kinases, and phosphoinositide 3-kinase (PI3K). PTKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to tyrosine (tyr) residues in protein substrates.
Aatyk proteins are mostly receptor tyr kinases (RTKs)
containing a transmembrane segment and a long C-terminal
cytoplasmic tail with a catalytic domain. Aatyk1 does
not contain a transmembrane segment and is a cytoplasmic
(or nonreceptor) kinase. Aatyk proteins are classified
as tyr kinases based on overall sequence similarity and
the phylogenetic tree. However, analysis of catalytic
residues suggests that Aatyk proteins may be
multispecific kinases, functioning also as
serine/threonine kinases. They are involved in neural
differentiation, nerve growth factor (NGF) signaling,
apoptosis, and spermatogenesis.
Length = 269
Score = 26.0 bits (57), Expect = 1.7
Identities = 13/67 (19%), Positives = 33/67 (49%), Gaps = 5/67 (7%)
Query: 4 VRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEAR-----RIFRQIAT 58
+ HPN++ +LV+E+ G+L ++L + + + A+ R+ ++A+
Sbjct: 52 LNHPNVLQCLGQCIESIPYLLVLEFCPLGDLKNYLRSNRGMVAQMAQKDVLQRMACEVAS 111
Query: 59 AVYYCHK 65
+ + H+
Sbjct: 112 GLLWLHQ 118
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed.
Length = 932
Score = 25.9 bits (57), Expect = 1.7
Identities = 19/70 (27%), Positives = 30/70 (42%), Gaps = 11/70 (15%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYAAGGELYDFLD---QKKVLTEEEAR--------RIFR 54
HP I+ +Y + + + + M Y G L L QK+ L++E A IF
Sbjct: 61 HPGIVPVYSICSDGDPVYYTMPYIEGYTLKSLLKSVWQKESLSKELAEKTSVGAFLSIFH 120
Query: 55 QIATAVYYCH 64
+I + Y H
Sbjct: 121 KICATIEYVH 130
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein
Kinase, MAP/ERK Kinase 2. Protein kinases (PKs),
MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain.
PKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine or tyrosine residues on
protein substrates. The MEK subfamily is part of a
larger superfamily that includes the catalytic domains
of other protein serine/threonine kinases, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. The mitogen-activated protein (MAP) kinase
signaling pathways are important mediators of cellular
responses to extracellular signals. The pathways involve
a triple kinase core cascade comprising the MAP kinase
(MAPK), which is phosphorylated and activated by a MAPK
kinase (MAPKK or MKK), which itself is phosphorylated
and activated by a MAPK kinase kinase (MAPKKK or MKKK).
MEK2 is a dual-specificity PK that phosphorylates and
activates the downstream targets, extracellular
signal-regulated kinase (ERK) 1 and ERK2, on specific
threonine and tyrosine residues. The ERK cascade starts
with extracellular signals including growth factors,
hormones, and neurotransmitters, which act through
receptors and ion channels to initiate intracellular
signaling that leads to the activation at the MAPKKK
(Raf-1 or MOS) level, which leads to the transmission of
signals to MEK2, and finally to ERK1/2. The ERK cascade
plays an important role in cell proliferation,
differentiation, oncogenic transformation, and cell
cycle control, as well as in apoptosis and cell survival
under certain conditions. Gain-of-function mutations in
genes encoding ERK cascade proteins, including MEK2,
cause cardiofaciocutaneous (CFC) syndrome, a condition
leading to multiple congenital anomalies and mental
retardation in patients.
Length = 331
Score = 25.8 bits (56), Expect = 1.8
Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 4/54 (7%)
Query: 7 PNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
P I+ Y F + ++ + ME+ GG L L + K + EE I +++ AV
Sbjct: 63 PYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEE----ILGKVSIAV 112
>gnl|CDD|235096 PRK02991, PRK02991, D-serine dehydratase; Provisional.
Length = 441
Score = 25.6 bits (57), Expect = 1.8
Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 6/49 (12%)
Query: 12 IYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
IYEV ++ EK+ L AG D D L E R+ F Q + AV
Sbjct: 120 IYEVLKHAEKLAL----EAGLLTLD--DDYSKLASPEFRQFFSQYSIAV 162
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine
Kinase, Tropomyosin Related Kinase A. Protein Tyrosine
Kinase (PTK) family; Tropomyosin Related Kinase A
(TrkA); catalytic (c) domain. The PTKc family is part
of a larger superfamily that includes the catalytic
domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. TrkA is
a member of the Trk subfamily of proteins, which are
receptor tyr kinases (RTKs) containing an extracellular
region with arrays of leucine-rich motifs flanked by
two cysteine-rich clusters followed by two
immunoglobulin-like domains, a transmembrane segment,
and an intracellular catalytic domain. Binding of TrkA
to its ligand, nerve growth factor (NGF), results in
receptor oligomerization and activation of the
catalytic domain. TrkA is expressed mainly in
neural-crest-derived sensory and sympathetic neurons of
the peripheral nervous system, and in basal forebrain
cholinergic neurons of the central nervous system. It
is critical for neuronal growth, differentiation and
survival. Alternative TrkA splicing has been implicated
as a pivotal regulator of neuroblastoma (NB) behavior.
Normal TrkA expression is associated with better NB
prognosis, while the hypoxia-regulated TrkAIII splice
variant promotes NB pathogenesis and progression.
Aberrant TrkA expression has also been demonstrated in
non-neural tumors including prostate, breast, lung, and
pancreatic cancers.
Length = 280
Score = 25.7 bits (56), Expect = 1.8
Identities = 11/38 (28%), Positives = 21/38 (55%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
++ ++H +I+ Y V +++V EY G+L FL
Sbjct: 61 LTVLQHQHIVRFYGVCTEGRPLLMVFEYMRHGDLNRFL 98
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like
Serine/Threonine Kinases. Serine/Threonine Kinases
(STKs), PCTAIRE-like subfamily, catalytic (c) domain.
STKs catalyze the transfer of the gamma-phosphoryl group
from ATP to serine/threonine residues on protein
substrates. The PCTAIRE-like subfamily is part of a
larger superfamily that includes the catalytic domains
of other protein STKs, protein tyrosine kinases, RIO
kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. Members of this
subfamily share sequence similarity with
Cyclin-Dependent Kinases (CDKs), which belong to a large
family of STKs that are regulated by their cognate
cyclins. Together, CDKs and cyclins are involved in the
control of cell-cycle progression, transcription, and
neuronal function. The association of PCTAIRE-like
proteins with cyclins has not been widely studied,
although PFTAIRE-1 has been shown to function as a CDK
which is regulated by cyclin D3 as well as the
membrane-associated cyclin Y. PCTAIRE-like proteins show
unusual expression patterns with high levels in
post-mitotic tissues, suggesting that they may be
involved in regulating post-mitotic cellular events.
Length = 291
Score = 25.8 bits (57), Expect = 1.9
Identities = 15/62 (24%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFR-QIATAVYYC 63
+H NI+ ++++ ++ + LV EY +L ++D R+F Q+ + YC
Sbjct: 61 KHANIVTLHDIIHTKKTLTLVFEYLD-TDLKQYMDDCGGGLSMHNVRLFLFQLLRGLAYC 119
Query: 64 HK 65
H+
Sbjct: 120 HQ 121
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine
Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase
(PTK) family; Ephrin Receptor (EphR) subfamily; EphA2
receptor; catalytic (c) domain. The PTKc family is part
of a larger superfamily that includes the catalytic
domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. EphRs
comprise the largest subfamily of receptor tyr kinases
(RTKs). In general, class EphA receptors bind
GPI-anchored ephrin-A ligands. There are ten vertebrate
EphA receptors (EphA1-10), which display promiscuous
interactions with six ephrin-A ligands. EphRs contain an
ephrin binding domain and two fibronectin repeats
extracellularly, a transmembrane segment, and a
cytoplasmic tyr kinase domain. Binding of the ephrin
ligand to EphR requires cell-cell contact since both are
anchored to the plasma membrane. The resulting
downstream signals occur bidirectionally in both
EphR-expressing cells (forward signaling) and
ephrin-expressing cells (reverse signaling). Ephrin/EphR
interaction mainly results in cell-cell repulsion or
adhesion, making it important in neural development and
plasticity, cell morphogenesis, cell-fate determination,
embryonic development, tissue patterning, and
angiogenesis. The EphA2 receptor is overexpressed in
tumor cells and tumor blood vessels in a variety of
cancers including breast, prostate, lung, and colon. As
a result, it is an attractive target for drug design
since its inhibition could affect several aspects of
tumor progression.
Length = 268
Score = 25.7 bits (56), Expect = 2.0
Identities = 16/63 (25%), Positives = 26/63 (41%), Gaps = 1/63 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL-DQKKVLTEEEARRIFRQIATA 59
M H NII + V + +++ EY G L +L D + + + R IA
Sbjct: 60 MGQFSHHNIIRLEGVVTKFKPAMIITEYMENGALDKYLRDHDGEFSSYQLVGMLRGIAAG 119
Query: 60 VYY 62
+ Y
Sbjct: 120 MKY 122
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine
Kinase, Fibroblast Growth Factor Receptor 3. Protein
Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
Receptor 3 (FGFR3); catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. FGFR3 is
part of the FGFR subfamily, which are receptor tyr
kinases (RTKs) containing an extracellular
ligand-binding region with three immunoglobulin-like
domains, a transmembrane segment, and an intracellular
catalytic domain. The binding of FGFRs to their ligands,
the FGFs, results in receptor dimerization and
activation, and intracellular signaling. The binding of
FGFs to FGFRs is promiscuous, in that a receptor may be
activated by several ligands and a ligand may bind to
more that one type of receptor. Many FGFR3 splice
variants have been reported with the IIIb and IIIc
isoforms being the predominant forms. FGFR3 IIIc is the
isoform expressed in chondrocytes, the cells affected in
dwarfism, while IIIb is expressed in epithelial cells.
FGFR3 ligands include FGF1, FGF2, FGF4, FGF8, FGF9, and
FGF23. It is a negative regulator of long bone growth.
In the cochlear duct and in the lens, FGFR3 is involved
in differentiation while it appears to have a role in
cell proliferation in epithelial cells. Germline
mutations in FGFR3 are associated with skeletal
disorders including several forms of dwarfism. Some
missense mutations are associated with multiple myeloma
and carcinomas of the bladder and cervix. Overexpression
of FGFR3 is found in thyroid carcinoma.
Length = 334
Score = 25.8 bits (56), Expect = 2.2
Identities = 10/38 (26%), Positives = 22/38 (57%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKK 42
+H NII++ + +++EYA+ G L ++L ++
Sbjct: 76 KHKNIINLLGACTQDGPLYVLVEYASKGNLREYLRARR 113
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional.
Length = 501
Score = 25.8 bits (56), Expect = 2.2
Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 4/63 (6%)
Query: 6 HPNIIHIYEVFENREKMVLVM---EYAAGGELYD-FLDQKKVLTEEEARRIFRQIATAVY 61
H NI+ I E+ + ++ ++ +YD D K ++ R I +Q+ AV
Sbjct: 222 HENILKIEEILRSEANTYMITQKYDFDLYSFMYDEAFDWKDRPLLKQTRAIMKQLLCAVE 281
Query: 62 YCH 64
Y H
Sbjct: 282 YIH 284
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein
Serine/Threonine Kinase, Thousand-and-one amino acids 3.
Serine/threonine kinases (STKs), thousand-and-one amino
acids 3 (TAO3) subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The TAO subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. TAO proteins possess mitogen-activated protein
kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
activity. MAPK signaling cascades are important in
mediating cellular responses to extracellular signals.
TAO3 is also known as JIK (JNK inhibitory kinase) or KFC
(kinase from chicken). It specifically activates c-Jun
N-terminal kinase (JNK), presumably by phosphorylating
and activating MKK4/MKK7. In Saccharomyces cerevisiae,
TAO3 is a component of the RAM (regulation of Ace2p
activity and cellular morphogenesis) signaling pathway.
TAO3 is upregulated in retinal ganglion cells after
axotomy, and may play a role in apoptosis.
Length = 313
Score = 25.4 bits (55), Expect = 2.2
Identities = 20/65 (30%), Positives = 26/65 (40%), Gaps = 2/65 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLD-QKKVLTEEEARRIFRQIATA 59
+ ++HPN I + LVMEY G D L+ KK L E E I
Sbjct: 75 LQQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSA-SDLLEVHKKPLQEVEIAAITHGALQG 133
Query: 60 VYYCH 64
+ Y H
Sbjct: 134 LAYLH 138
>gnl|CDD|202568 pfam03181, BURP, BURP domain. The BURP domain is found at the
C-terminus of several different plant proteins. It was
named after the proteins in which it was first
identified: the BNM2 clone-derived protein from Brassica
napus; USPs and USP-like proteins; RD22 from Arabidopsis
thaliana; and PG1beta from Lycopersicon esculentum. This
domain is around 230 amino acid residues long. It
possesses the following conserved features: two
phenylalanine residues at its N-terminus; two cysteine
residues; and four repeated cysteine-histidine motifs,
arranged as: CH-X(10)-CH-X(25-27)-CH-X(25-26)-CH, where
X can be any amino acid. The function of this domain is
unknown.
Length = 216
Score = 25.4 bits (56), Expect = 2.3
Identities = 6/12 (50%), Positives = 7/12 (58%)
Query: 57 ATAVYYCHKVQD 68
AV+YCH V
Sbjct: 143 PYAVFYCHTVPK 154
>gnl|CDD|176739 cd08325, CARD_CASP1-like, Caspase activation and recruitment
domain found in Caspase-1 and related proteins.
Caspase activation and recruitment domain (CARD)
similar to those found in Caspase-1 (CASP1, ICE) and
related proteins, including CARD-only proteins such as
ICEBERG or CARD18, INCA (CARD17), CARD16 (COP1,
PSEUDO-ICE), CARD8 (DACAR, NDPP1, TUCAN), and CARD12
(NLRC4), as well as ICE-like caspases such as CASP12,
CASP5 (ICH-3) and CASP4 (TX, ICH-2). Caspases are
aspartate-specific cysteine proteases with functions in
apoptosis and immune signaling. CASP1 plays a central
role in the cellular response to a wide variety of
microbial and non-microbial stimuli, being activated by
the inflammasome or the pyroptosome. CARD8 binds itself
and the initiator caspase-9, interfering with the
binding of APAF-1 and suppressing caspase-9 activation.
CARD12 is a Nod-like receptor (NLR) that plays an
important role in the innate immune response to
Gram-negative bacteria. Caspase-4 (CASP4), -5 (CASP5),
and -12 (CASP12) are inflammatory caspases implicated
in inflammation and endoplasmic reticulum
stress-induced apoptosis. In general, CARDs are death
domains (DDs) found associated with caspases. They are
known to be important in the signaling pathways for
apoptosis, inflammation and host-defense mechanisms.
DDs are protein-protein interaction domains found in a
variety of domain architectures. Their common feature
is that they form homodimers by self-association or
heterodimers by associating with other members of the
DD superfamily including PYRIN and DED (Death Effector
Domain). They serve as adaptors in signaling pathways
and can recruit other proteins into signaling
complexes.
Length = 83
Score = 24.8 bits (55), Expect = 2.5
Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 3/37 (8%)
Query: 19 REKMVLVMEYAAGGELYDFLD---QKKVLTEEEARRI 52
+EK V +E G + LD +K VL EEE +I
Sbjct: 3 KEKRVKFIESVGKGVINGLLDDLLEKNVLNEEEMEKI 39
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein
Serine/Threonine Kinase, Class IIIB myosin.
Serine/threonine kinases (STKs), class IIIB myosin
subfamily, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The
class III myosin subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. Class III myosins are motor
proteins containing an N-terminal kinase catalytic
domain and a C-terminal actin-binding domain. Class III
myosins may play an important role in maintaining the
structural integrity of photoreceptor cell microvilli.
They may also function as cargo carriers during
light-dependent translocation, in photoreceptor cells,
of proteins such as transducin and arrestin. Class IIIB
myosin is expressed highly in retina. It is also present
in the brain and testis. The human class IIIB myosin
gene maps to a region that overlaps the locus for
Bardet-Biedl syndrome, which is characterized by
dysmorphic extremities, retinal dystrophy, obesity, male
hypogenitalism, and renal abnormalities.
Length = 291
Score = 25.3 bits (55), Expect = 2.6
Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 5/38 (13%)
Query: 6 HPNIIHIYEVFENREKMV-----LVMEYAAGGELYDFL 38
HPN++ Y +F +K+V LV+E GG + + +
Sbjct: 78 HPNVVKFYGMFYKADKLVGGQLWLVLELCNGGSVTELV 115
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein
Serine/Threonine Kinase, Thousand-and-one amino acids 1.
Serine/threonine kinases (STKs), thousand-and-one amino
acids 1 (TAO1) subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The TAO subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. TAO proteins possess mitogen-activated protein
kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
activity. MAPK signaling cascades are important in
mediating cellular responses to extracellular signals.
TAO1 is sometimes referred to as prostate-derived
sterile 20-like kinase 2 (PSK2). TAO1 activates the p38
MAPK through direct interaction with and activation of
MEK3. TAO1 is highly expressed in the brain and may play
a role in neuronal apoptosis. TAO1 interacts with the
checkpoint proteins BubR1 and Mad2, and plays an
important role in regulating mitotic progression, which
is required for both chromosome congression and
checkpoint-induced anaphase delay. TAO1 may play a role
in protecting genomic stability.
Length = 317
Score = 25.4 bits (55), Expect = 2.6
Identities = 20/65 (30%), Positives = 26/65 (40%), Gaps = 2/65 (3%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLD-QKKVLTEEEARRIFRQIATA 59
+ ++HPN I + LVMEY G D L+ KK L E E I
Sbjct: 79 LQRIKHPNSIEYKGCYLREHTAWLVMEYCLGSA-SDLLEVHKKPLQEVEIAAITHGALQG 137
Query: 60 VYYCH 64
+ Y H
Sbjct: 138 LAYLH 142
>gnl|CDD|183992 PRK13353, PRK13353, aspartate ammonia-lyase; Provisional.
Length = 473
Score = 25.3 bits (56), Expect = 2.6
Identities = 7/25 (28%), Positives = 12/25 (48%)
Query: 29 AAGGELYDFLDQKKVLTEEEARRIF 53
A G + + + +L+EEE I
Sbjct: 430 ATGRSVRELALENGLLSEEELDLIL 454
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine
Kinase, Mitogen-Activated Protein Kinase 15.
Serine/Threonine Kinases (STKs), Mitogen-Activated
Protein Kinase 15 (MAPK15) subfamily, catalytic (c)
domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MAPK15 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. MAPKs are
important mediators of cellular responses to
extracellular signals. Human MAPK15 is also called
Extracellular signal Regulated Kinase 8 (ERK8) while the
rat protein is called ERK7. ERK7 and ERK8 display both
similar and different biochemical properties. They
autophosphorylate and activate themselves and do not
require upstream activating kinases. ERK7 is
constitutively active and is not affected by
extracellular stimuli whereas ERK8 shows low basal
activity and is activated by DNA-damaging agents. ERK7
and ERK8 also have different substrate profiles. Genome
analysis shows that they are orthologs with similar gene
structures. ERK7 and ERK 8 may be involved in the
signaling of some nuclear receptor transcription
factors. ERK7 regulates hormone-dependent degradation of
estrogen receptor alpha while ERK8 down-regulates the
transcriptional co-activation androgen and
glucocorticoid receptors.
Length = 337
Score = 25.2 bits (56), Expect = 2.7
Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 4/61 (6%)
Query: 6 HPNIIHIYEVF--ENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYC 63
HPNI+ + V EN + + LV EY +L+ + + +L + R I Q+ A+ Y
Sbjct: 66 HPNIVKLLNVIKAENDKDIYLVFEYME-TDLHAVI-RANILEDVHKRYIMYQLLKALKYI 123
Query: 64 H 64
H
Sbjct: 124 H 124
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein
Serine/Threonine Kinase, Rho-associated coiled-coil
containing protein kinase. Serine/Threonine Kinases
(STKs), Rho-associated coiled-coil containing protein
kinase (ROCK) subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The ROCK subfamily is part of a larger superfamily that
includes the catalytic domains of other protein STKs,
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. ROCK is also referred to as Rho-associated
kinase or simply as Rho kinase. It contains an
N-terminal extension, a catalytic kinase domain, and a
long C-terminal extension, which contains a coiled-coil
region encompassing a Rho-binding domain (RBD) and a
pleckstrin homology (PH) domain. ROCK is auto-inhibited
by the RBD and PH domain interacting with the catalytic
domain. It is activated via interaction with Rho GTPases
and is involved in many cellular functions including
contraction, adhesion, migration, motility,
proliferation, and apoptosis. The ROCK subfamily
consists of two isoforms, ROCK1 and ROCK2, which may be
functionally redundant in some systems, but exhibit
different tissue distributions. Both isoforms are
ubiquitously expressed in most tissues, but ROCK2 is
more prominent in brain and skeletal muscle while ROCK1
is more pronounced in the liver, testes, and kidney.
Studies in knockout mice result in different phenotypes,
suggesting that the two isoforms do not compensate for
each other during embryonic development.
Length = 370
Score = 25.1 bits (55), Expect = 2.7
Identities = 10/34 (29%), Positives = 20/34 (58%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGEL 34
M+ I+ ++ F++ + + +VMEY GG+L
Sbjct: 97 MAHANSEWIVQLHYAFQDDKYLYMVMEYMPGGDL 130
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase,
c-Jun N-terminal Kinase. Serine/Threonine Kinases
(STKs), c-Jun N-terminal kinase (JNK) subfamily,
catalytic (c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The JNK subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. JNKs are
mitogen-activated protein kinases (MAPKs) that are
involved in many stress-activated responses including
those during inflammation, neurodegeneration, apoptosis,
and persistent pain sensitization, among others. They
are also essential regulators of physiological and
pathological processes and are involved in the
pathogenesis of several diseases such as diabetes,
atherosclerosis, stroke, Parkinson's and Alzheimer's.
Vetebrates harbor three different JNK genes (Jnk1, Jnk2,
and Jnk3) that are alternatively spliced to produce at
least 10 isoforms. JNKs are specifically activated by
the MAPK kinases MKK4 and MKK7, which are in turn
activated by upstream MAPK kinase kinases as a result of
different stimuli including stresses such as ultraviolet
(UV) irradiation, hyperosmolarity, heat shock, or
cytokines. JNKs activate a large number of different
substrates based on specific stimulus, cell type, and
cellular condition, and may be implicated in seemingly
contradictory functions.
Length = 353
Score = 25.1 bits (55), Expect = 3.0
Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 6/33 (18%)
Query: 1 MSSVRHPNIIHIYEVF------ENREKMVLVME 27
M V H NII + VF E + + LVME
Sbjct: 69 MKLVNHKNIIGLLNVFTPQKSLEEFQDVYLVME 101
>gnl|CDD|131898 TIGR02851, spore_V_T, stage V sporulation protein T. Members of
this protein family are the stage V sporulation protein
T (SpoVT), a protein of the sporulation/germination
program in Bacillus subtilis and related species. The
amino-terminal 50 amino acids are nearly perfectly
conserved across all endospore-forming bacteria. SpoVT
is a DNA-binding transcriptional regulator related to
AbrB (see pfam04014) [Regulatory functions, DNA
interactions, Cellular processes, Sporulation and
germination].
Length = 180
Score = 25.1 bits (55), Expect = 3.2
Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 7/50 (14%)
Query: 14 EVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAVYYC 63
E+F +RE V++ +Y+ GEL DF +E A +++ + V
Sbjct: 34 EIFTDREGEVILKKYSPIGELGDF-------AKEYAESLYQSLGHIVLIT 76
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the
Protein Tyrosine Kinases, Janus kinases. Protein
Tyrosine Kinase (PTK) family; Janus kinase (Jak)
subfamily; pseudokinase domain (repeat1). The Jak
subfamily is composed of Jak1, Jak2, Jak3, TYK2, and
similar proteins. The PTKc (catalytic domain) family to
which this subfamily belongs, is part of a larger
superfamily that includes the catalytic domains of
other kinases such as protein serine/threonine kinases,
RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
catalyze the transfer of the gamma-phosphoryl group
from ATP to tyrosine (tyr) residues in protein
substrates. Jak subfamily proteins are cytoplasmic (or
nonreceptor) tyr kinases containing an N-terminal FERM
domain, followed by a Src homology 2 (SH2) domain, a
pseudokinase domain, and a C-terminal catalytic tyr
kinase domain. The pseudokinase domain shows similarity
to tyr kinases but lacks crucial residues for catalytic
activity and ATP binding. It modulates the kinase
activity of the C-terminal catalytic domain. Most Jaks
are expressed in a wide variety of tissues, except for
Jak3, which is expressed only in hematopoietic cells.
Jaks are crucial for cytokine receptor signaling. They
are activated by autophosphorylation upon
cytokine-induced receptor aggregation, and subsequently
trigger downstream signaling events such as the
phosphorylation of signal transducers and activators of
transcription (STATs). Jaks are also involved in
regulating the surface expression of some cytokine
receptors. The Jak-STAT pathway is involved in many
biological processes including hematopoiesis,
immunoregulation, host defense, fertility, lactation,
growth, and embryogenesis.
Length = 259
Score = 25.1 bits (55), Expect = 3.3
Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
MS + H +++ +Y V R++ ++V EY G L FL
Sbjct: 55 MSQLSHKHLVKLYGVCV-RDENIMVEEYVKFGPLDVFL 91
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine
Kinase, Hematopoietic cell kinase. Protein Tyrosine
Kinase (PTK) family; Hematopoietic cell kinase (Hck);
catalytic (c) domain. The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. Hck is a member of the
Src subfamily of proteins, which are cytoplasmic (or
non-receptor) tyr kinases. Src kinases contain an
N-terminal SH4 domain with a myristoylation site,
followed by SH3 and SH2 domains, a tyr kinase domain,
and a regulatory C-terminal region containing a
conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). Src
proteins are involved in signaling pathways that
regulate cytokine and growth factor responses,
cytoskeleton dynamics, cell proliferation, survival,
and differentiation. Hck is present in myeloid and
lymphoid cells that play a role in the development of
cancer. It may be important in the oncogenic signaling
of the protein Tel-Abl, which induces a chronic
myelogenous leukemia (CML)-like disease. Hck also acts
as a negative regulator of granulocyte
colony-stimulating factor (G-CSF)-induced proliferation
of granulocytic precursors, suggesting a possible role
in the development of acute myeloid leukemia (AML). In
addition, Hck is essential in regulating the
degranulation of polymorphonuclear leukocytes (PMNs).
Genetic polymorphisms affect the expression level of
Hck, which affects PMN mediator release and influences
the development of chronic obstructive pulmonary
disease (COPD).
Length = 260
Score = 25.0 bits (54), Expect = 3.3
Identities = 11/38 (28%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFL 38
M +++H ++ ++ V +E + ++ E+ A G L DFL
Sbjct: 55 MKTLQHDKLVKLHAVV-TKEPIYIITEFMAKGSLLDFL 91
>gnl|CDD|235832 PRK06567, PRK06567, putative bifunctional glutamate synthase
subunit beta/2-polyprenylphenol hydroxylase; Validated.
Length = 1028
Score = 25.3 bits (55), Expect = 3.3
Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 6/44 (13%)
Query: 27 EYAAGGELYDFLDQKKVLTEEEARRIFRQIATA-VYYCHKVQDN 69
E+ A +L+ K+ EE R++F ++ A VYY ++QD+
Sbjct: 599 EFIAHAKLF-----KEAKNNEELRKVFNKLGGATVYYRGRLQDS 637
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein
Serine/Threonine Kinases, Mitogen-Activated Protein
Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine
kinases (STKs), mitogen-activated protein kinase (MAPK)
kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6
(or MAP4K6) subfamily, catalytic (c) domain. STKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to serine/threonine residues on protein substrates.
The MAP4K4/MAP4K6 subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein STKs, protein tyrosine kinases, RIO kinases,
aminoglycoside phosphotransferase, choline kinase, and
phosphoinositide 3-kinase. Members of this subfamily
contain an N-terminal catalytic domain and a C-terminal
citron homology (CNH) regulatory domain. MAP4Ks (or
MAPKKKKs) are involved in MAPK signaling pathways that
are important in mediating cellular responses to
extracellular signals by activating a MAPK kinase kinase
(MAPKKK or MAP3K or MKKK). Each MAPK cascade is
activated either by a small GTP-binding protein or by an
adaptor protein, which transmits the signal either
directly to a MAP3K to start the triple kinase core
cascade or indirectly through a mediator kinase, a
MAP4K. MAP4K4 is also called Nck Interacting kinase
(NIK). It facilitates the activation of the MAPKs,
extracellular signal-regulated kinase (ERK) 1, ERK2, and
c-Jun N-terminal kinase (JNK), by phosphorylating and
activating MEKK1. MAP4K4 plays a role in tumor necrosis
factor (TNF) alpha-induced insulin resistance. MAP4K4
silencing in skeletal muscle cells from type II diabetic
patients restores insulin-mediated glucose uptake.
MAP4K4, through JNK, also plays a broad role in cell
motility, which impacts inflammation, homeostasis, as
well as the invasion and spread of cancer. MAP4K4 is
found to be highly expressed in most tumor cell lines
relative to normal tissue. MAP4K6 (also called MINK for
Misshapen/NIKs-related kinase) is activated after Ras
induction and mediates activation of p38 MAPK. MAP4K6
plays a role in cell cycle arrest, cytoskeleton
organization, cell adhesion, and cell motility.
Length = 282
Score = 25.0 bits (54), Expect = 3.5
Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 8/67 (11%)
Query: 6 HPNIIHIYEVF------ENREKMVLVMEYAAGGELYDFLDQKK--VLTEEEARRIFRQIA 57
H NI Y F + +++ LVME+ G + D + K L E+ I R+I
Sbjct: 72 HRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSVTDLVKNTKGNALKEDWIAYICREIL 131
Query: 58 TAVYYCH 64
+ + H
Sbjct: 132 RGLAHLH 138
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine
Kinase, Extracellular signal-Regulated Kinase 5.
Serine/Threonine Kinases (STKs), Extracellular
signal-Regulated Kinase 5 (ERK5) subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The ERK5 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. MAPKs are
important mediators of cellular responses to
extracellular signals. ERK5, also called Big MAPK1
(BMK1) or MAPK7, has a unique C-terminal extension,
making it approximately twice as big as other MAPKs.
This extension contains transcriptional activation
capability which is inhibited by the N-terminal half.
ERK5 is activated in response to growth factors and
stress by a cascade that leads to its phosphorylation by
the MAP2K MEK5, which in turn is regulated by the MAP3Ks
MEKK2 and MEKK3. Activated ERK5 phosphorylates its
targets including myocyte enhancer factor 2 (MEF2),
Sap1a, c-Myc, and RSK. It plays a role in EGF-induced
cell proliferation during the G1/S phase transition.
Studies on knockout mice revealed that ERK5 is essential
for cardiovascular development and plays an important
role in angiogenesis. It is also critical for neural
differentiation and survival. The ERK5 pathway has been
implicated in the pathogenesis of many diseases
including cancer, cardiac hypertrophy, and
atherosclerosis.
Length = 334
Score = 25.0 bits (55), Expect = 3.6
Identities = 16/64 (25%), Positives = 28/64 (43%), Gaps = 5/64 (7%)
Query: 5 RHPNIIHIYEVFENREK----MVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+H NII I ++ + +VM+ +L+ + + LTEE R Q+ +
Sbjct: 62 KHDNIIAIRDILRPPGADFKDVYVVMDL-MESDLHHIIHSDQPLTEEHIRYFLYQLLRGL 120
Query: 61 YYCH 64
Y H
Sbjct: 121 KYIH 124
>gnl|CDD|235441 PRK05388, argJ, bifunctional ornithine
acetyltransferase/N-acetylglutamate synthase protein;
Validated.
Length = 395
Score = 24.7 bits (55), Expect = 3.7
Identities = 9/23 (39%), Positives = 15/23 (65%), Gaps = 6/23 (26%)
Query: 45 TEEEARRIFRQIA------TAVY 61
+EE+AR+I + IA TA++
Sbjct: 281 SEEDARKIAKAIANSPLVKTAIF 303
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth
Factor Receptor-like Protein Tyrosine Kinases. Protein
Tyrosine Kinase (PTK) family; Epidermal Growth Factor
Receptor (EGFR) subfamily; catalytic (c) domain. EGFR
(HER, ErbB) subfamily members include EGFR (HER1,
ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and
similar proteins. The PTKc family is part of a larger
superfamily that includes the catalytic domains of other
kinases such as protein serine/threonine kinases, RIO
kinases, and phosphoinositide 3-kinase (PI3K). PTKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to tyrosine (tyr) residues in protein substrates.
The EGFR proteins are receptor tyr kinases (RTKs)
containing an extracellular EGF-related ligand-binding
region, a transmembrane helix, and a cytoplasmic region
with a tyr kinase domain and a regulatory C-terminal
tail. Unlike other tyr kinases, phosphorylation of the
activation loop of EGFR proteins is not critical to
their activation. Instead, they are activated by
ligand-induced dimerization, resulting in the
phosphorylation of tyr residues in the C-terminal tail,
which serve as binding sites for downstream signaling
molecules. Collectively, they can recognize a variety of
ligands including EGF, TGFalpha, and neuregulins, among
others. All four subfamily members can form homo- or
heterodimers. HER3 contains an impaired kinase domain
and depends on its heterodimerization partner for
activation. EGFR subfamily members are involved in
signaling pathways leading to a broad range of cellular
responses including cell proliferation, differentiation,
migration, growth inhibition, and apoptosis. Gain of
function alterations, through their overexpression,
deletions, or point mutations in their kinase domains,
have been implicated in various cancers. These receptors
are targets of many small molecule inhibitors and
monoclonal antibodies used in cancer therapy.
Length = 279
Score = 24.7 bits (54), Expect = 3.9
Identities = 14/65 (21%), Positives = 31/65 (47%), Gaps = 6/65 (9%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIF---RQIA 57
M+SV HP+++ + + + ++ L+ + G L D++ K ++ + QIA
Sbjct: 63 MASVDHPHVVRLLGICLS-SQVQLITQLMPLGCLLDYVRNHK--DNIGSQYLLNWCVQIA 119
Query: 58 TAVYY 62
+ Y
Sbjct: 120 KGMSY 124
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like
dual-specificity MAP kinase kinases. Protein kinases
(PKs), MAP kinase kinase (MAPKK) subfamily, fungal
Byr1-like proteins, catalytic (c) domain. PKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
serine/threonine or tyrosine residues on protein
substrates. The MAPKK subfamily is part of a larger
superfamily that includes the catalytic domains of other
protein serine/threonine kinases, protein tyrosine
kinases, RIO kinases, aminoglycoside phosphotransferase,
choline kinase, and phosphoinositide 3-kinase. The
mitogen-activated protein (MAP) kinase signaling
pathways are important mediators of cellular responses
to extracellular signals. The pathways involve a triple
kinase core cascade comprising of the MAP kinase (MAPK),
which is phosphorylated and activated by a MAPK kinase
(MAPKK or MKK), which itself is phosphorylated and
activated by a MAPK kinase kinase (MAPKKK or MKKK).
Members of this group include the MAPKKs Byr1 from
Schizosaccharomyces pombe, FUZ7 from Ustilago maydis,
and related proteins. Byr1 phosphorylates its downstream
target, the MAPK Spk1, and is regulated by the MAPKKK
Byr2. The Spk1 cascade is pheromone-responsive and is
essential for sporulation and sexual differentiation in
fission yeast. FUZ7 phosphorylates and activates its
target, the MAPK Crk1, which is required in mating and
virulence in U. maydis.
Length = 284
Score = 24.8 bits (54), Expect = 3.9
Identities = 19/73 (26%), Positives = 28/73 (38%), Gaps = 11/73 (15%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
M R P I+ Y F N + + ME+ G L + + E I +IA AV
Sbjct: 57 MHECRSPYIVSFYGAFLNENNICMCMEFMDCGSLDRIYKKGGPIPVE----ILGKIAVAV 112
Query: 61 -------YYCHKV 66
Y H++
Sbjct: 113 VEGLTYLYNVHRI 125
>gnl|CDD|223733 COG0661, AarF, Predicted unusual protein kinase [General function
prediction only].
Length = 517
Score = 25.0 bits (55), Expect = 3.9
Identities = 13/42 (30%), Positives = 18/42 (42%), Gaps = 6/42 (14%)
Query: 21 KMVLVMEYAAGGELYDFLDQK------KVLTEEEARRIFRQI 56
+ VL ME+ G ++ D K K L E R RQ+
Sbjct: 240 RRVLTMEWIDGIKISDIAALKSAGIDRKELAELLVRAFLRQL 281
>gnl|CDD|239065 cd02152, OAT, Ornithine acetyltransferase (OAT) family; also
referred to as ArgJ. OAT catalyzes the first and fifth
steps in arginine biosynthesis, coupling acetylation of
glutamate with deacetylation of N-acetylornithine, which
allows recycling of the acetyl group in the arginine
biosynthetic pathway. Members of this family may
experience feedback inhibition by L-arginine. The active
enzyme is a heterotetramer of two alpha and two beta
chains, where the alpha and beta chains are the result
of autocatalytic cleavage. OATs found in the clavulanic
acid biosynthesis gene cluster catalyze the fifth step
only, and may utilize acetyl acceptors other than
glutamate.
Length = 390
Score = 24.7 bits (55), Expect = 4.0
Identities = 9/23 (39%), Positives = 15/23 (65%), Gaps = 6/23 (26%)
Query: 45 TEEEARRIFRQIA------TAVY 61
+EE+AR++ R IA TA++
Sbjct: 278 SEEDARKVARAIANSPLVKTAIF 300
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein
Serine/Threonine Kinase, Mammalian Ste20-like protein
kinase 4. Serine/threonine kinases (STKs), mammalian
Ste20-like protein kinase 4 (MST4) subfamily, catalytic
(c) domain. STKs catalyze the transfer of the
gamma-phosphoryl group from ATP to serine/threonine
residues on protein substrates. The MST4 subfamily is
part of a larger superfamily that includes the catalytic
domains of other protein STKs, protein tyrosine kinases,
RIO kinases, aminoglycoside phosphotransferase, choline
kinase, and phosphoinositide 3-kinase. MST4 is sometimes
referred to as MASK (MST3 and SOK1-related kinase). It
plays a role in mitogen-activated protein kinase (MAPK)
signaling during cytoskeletal rearrangement,
morphogenesis, and apoptosis. It influences cell growth
and transformation by modulating the extracellular
signal-regulated kinase (ERK) pathway. MST4 may also
play a role in tumor formation and progression. It
localizes in the Golgi apparatus by interacting with the
Golgi matrix protein GM130 and may play a role in cell
migration.
Length = 277
Score = 25.0 bits (54), Expect = 4.0
Identities = 15/64 (23%), Positives = 27/64 (42%), Gaps = 1/64 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
+S P + Y + K+ ++MEY GG D L + E + + ++I +
Sbjct: 56 LSQCDSPYVTKYYGSYLKGTKLWIIMEYLGGGSALDLL-RAGPFDEFQIATMLKEILKGL 114
Query: 61 YYCH 64
Y H
Sbjct: 115 DYLH 118
>gnl|CDD|224283 COG1364, ArgJ, N-acetylglutamate synthase (N-acetylornithine
aminotransferase) [Amino acid transport and metabolism].
Length = 404
Score = 24.9 bits (55), Expect = 4.2
Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 6/23 (26%)
Query: 45 TEEEARRIFRQIA------TAVY 61
+EE+AR I R IA TAV+
Sbjct: 292 SEEDARVIARAIANSPLVKTAVF 314
>gnl|CDD|107208 cd06447, D-Ser-dehyd, D-Serine dehydratase is a pyridoxal phosphate
(PLP)-dependent enzyme which catalyzes the conversion of
L- or D-serine to pyruvate and ammonia. D-serine
dehydratase serves as a detoxifying enzyme in most E.
coli strains where D-serine is a competitive antagonist
of beta-alanine in the biosynthetic pathway to
pentothenate and coenzyme A. D-serine dehydratase is
different from other pyridoxal-5'-phosphate-dependent
enzymes in that it catalyzes alpha, beta-elimination
reactions on amino acids.
Length = 404
Score = 24.6 bits (54), Expect = 4.5
Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 6/49 (12%)
Query: 12 IYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
IYEV ++ EK+ L G L D L E+ R++F Q + AV
Sbjct: 97 IYEVLKHAEKLAL-----EHGLL-TLEDDYSKLASEKFRKLFSQYSIAV 139
>gnl|CDD|221583 pfam12449, DUF3684, Protein of unknown function (DUF3684). This
domain family is found in eukaryotes, and is typically
between 1072 and 1090 amino acids in length.
Length = 1084
Score = 24.6 bits (54), Expect = 4.5
Identities = 9/36 (25%), Positives = 18/36 (50%)
Query: 25 VMEYAAGGELYDFLDQKKVLTEEEARRIFRQIATAV 60
V + + L +K T+ +AR++F +A+ V
Sbjct: 806 VKRHPPIAQCVQRLIRKPPKTKADARKLFEYLASRV 841
>gnl|CDD|233566 TIGR01771, L-LDH-NAD, L-lactate dehydrogenase. This model
represents the NAD-dependent L-lactate dehydrogenases
from bacteria and eukaryotes. This enzyme function as as
the final step in anaerobic glycolysis. Although lactate
dehydrogenases have in some cases been mistaken for
malate dehydrogenases due to the similarity of these two
substrates and the apparent ease with which evolution
can toggle these activities, critical residues have been
identified which can discriminate between the two
activities. At the time of the creation of this model no
hits above the trusted cutoff contained critical
residues typical of malate dehydrogenases [Energy
metabolism, Anaerobic, Energy metabolism,
Glycolysis/gluconeogenesis].
Length = 299
Score = 24.5 bits (54), Expect = 5.0
Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 2/58 (3%)
Query: 6 HPNIIHIYEVFENREKMVLVMEYA--AGGELYDFLDQKKVLTEEEARRIFRQIATAVY 61
P +H Y + E+ + V V A G L D+L K T+ + I +++ A Y
Sbjct: 157 DPQSVHAYIIGEHGDSEVPVWSSATIGGVPLLDYLKAKGTETDLDLEEIEKEVRDAAY 214
>gnl|CDD|165291 PHA02988, PHA02988, hypothetical protein; Provisional.
Length = 283
Score = 24.3 bits (53), Expect = 5.1
Identities = 15/69 (21%), Positives = 34/69 (49%), Gaps = 4/69 (5%)
Query: 1 MSSVRHPNIIHIY----EVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQI 56
+ + NI+ IY ++ ++ ++ L++EY G L + LD++K L+ + +
Sbjct: 72 LRRIDSNNILKIYGFIIDIVDDLPRLSLILEYCTRGYLREVLDKEKDLSFKTKLDMAIDC 131
Query: 57 ATAVYYCHK 65
+Y +K
Sbjct: 132 CKGLYNLYK 140
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine
Kinase, Fibroblast Growth Factor Receptor 1. Protein
Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
Receptor 1 (FGFR1); catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. FGFR1 is
part of the FGFR subfamily, which are receptor tyr
kinases (RTKs) containing an extracellular
ligand-binding region with three immunoglobulin-like
domains, a transmembrane segment, and an intracellular
catalytic domain. The binding of FGFRs to their ligands,
the FGFs, results in receptor dimerization and
activation, and intracellular signaling. The binding of
FGFs to FGFRs is promiscuous, in that a receptor may be
activated by several ligands and a ligand may bind to
more that one type of receptor. Alternative splicing of
FGFR1 transcripts produces a variety of isoforms, which
are differentially expressed in cells. FGFR1 binds the
ligands, FGF1 and FGF2, with high affinity and has also
been reported to bind FGF4, FGF6, and FGF9. FGFR1
signaling is critical in the control of cell migration
during embryo development. It promotes cell
proliferation in fibroblasts. Nuclear FGFR1 plays a role
in the regulation of transcription. Mutations,
insertions or deletions of FGFR1 have been identified in
patients with Kallman's syndrome (KS), an inherited
disorder characterized by hypogonadotropic hypogonadism
and loss of olfaction. Aberrant FGFR1 expression has
been found in some human cancers including 8P11
myeloproliferative syndrome (EMS), breast cancer, and
pancreatic adenocarcinoma.
Length = 307
Score = 24.6 bits (53), Expect = 5.2
Identities = 10/38 (26%), Positives = 22/38 (57%)
Query: 5 RHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKK 42
+H NII++ + +++EYA+ G L ++L ++
Sbjct: 82 KHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARR 119
>gnl|CDD|233667 TIGR01982, UbiB, 2-polyprenylphenol 6-hydroxylase. This model
represents the enzyme (UbiB) which catalyzes the first
hydroxylation step in the ubiquinone biosynthetic
pathway in bacteria. It is believed that the reaction is
2-polyprenylphenol -> 6-hydroxy-2-polyprenylphenol. This
model finds hits primarily in the proteobacteria. The
gene is also known as AarF in certain species
[Biosynthesis of cofactors, prosthetic groups, and
carriers, Menaquinone and ubiquinone].
Length = 437
Score = 24.6 bits (54), Expect = 5.2
Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 7/59 (11%)
Query: 5 RHPNIIHIYEVFENR-EKMVLVMEYAAGGELYDF--LDQK----KVLTEEEARRIFRQI 56
++ +++ EV+ +R + VL ME+ G L D LD+ K L E AR Q+
Sbjct: 215 KNDPGVYVPEVYWDRTSERVLTMEWIDGIPLSDIAALDEAGLDRKALAENLARSFLNQV 273
>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the
Protein Tyrosine Kinases, Janus kinases 2 and 3.
Protein Tyrosine Kinase (PTK) family; Janus kinase 2
(Jak2) and Jak3; pseudokinase domain (repeat 1). The
PTKc (catalytic domain) family to which this subfamily
belongs, is part of a larger superfamily that includes
the catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Jak2 and
Jak3 are members of the Janus kinase (Jak) subfamily of
proteins, which are cytoplasmic (or nonreceptor) tyr
kinases containing an N-terminal FERM domain, followed
by a Src homology 2 (SH2) domain, a pseudokinase domain,
and a C-terminal tyr kinase domain. The pseudokinase
domain shows similarity to tyr kinases but lacks crucial
residues for catalytic activity and ATP binding. It
modulates the kinase activity of the C-terminal
catalytic domain. Jaks are crucial for cytokine receptor
signaling. They are activated by autophosphorylation
upon cytokine-induced receptor aggregation, and
subsequently trigger downstream signaling events such as
the phosphorylation of signal transducers and activators
of transcription (STATs). Jak2 is widely expressed in
many tissues while Jak3 is expressed only in
hematopoietic cells. Jak2 is essential for the signaling
of hormone-like cytokines such as growth hormone,
erythropoietin, thrombopoietin, and prolactin, as well
as some IFNs and cytokines that signal through the IL-3
and gp130 receptors. Jak3 binds the shared receptor
subunit common gamma chain and thus, is essential in the
signaling of cytokines that use it such as IL-2, IL-4,
IL-7, IL-9, IL-15, and IL-21. Disruption of Jak2 in mice
results in an embryonic lethal phenotype with multiple
defects including erythropoietic and cardiac
abnormalities. It is the only Jak gene that results in a
lethal phenotype when disrupted in mice. A mutation in
the pseudokinase domain of Jak2, V617F, is present in
many myeloproliferative diseases, including almost all
patients with polycythemia vera, and 50% of patients
with essential thrombocytosis and myelofibrosis. Jak3 is
important in lymphoid development and myeloid cell
differentiation. Inactivating mutations in Jak3 have
been reported in humans with severe combined
immunodeficiency (SCID).
Length = 258
Score = 24.4 bits (53), Expect = 5.3
Identities = 15/63 (23%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKK-VLTEEEARRIFRQIATA 59
MS + H +++ Y V ++ ++V EY G L +L + K ++ + +Q+A A
Sbjct: 53 MSQLSHKHLVLNYGVCVCGDESIMVQEYVKFGSLDTYLKKNKNLINISWKLEVAKQLAWA 112
Query: 60 VYY 62
+++
Sbjct: 113 LHF 115
>gnl|CDD|237859 PRK14908, PRK14908, glycyl-tRNA synthetase; Provisional.
Length = 1000
Score = 24.2 bits (53), Expect = 6.1
Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 4/31 (12%)
Query: 28 YAAGGELYD----FLDQKKVLTEEEARRIFR 54
AA EL F D+ V+ ++EA R R
Sbjct: 950 VAAAAELPQAVNTFFDEVLVMADDEAIRNAR 980
>gnl|CDD|234362 TIGR03814, Gln_ase, glutaminase A. This family describes the
enzyme glutaminase, from a larger family that includes
serine-dependent beta-lactamases and penicillin-binding
proteins. Many bacteria have two isozymes. This model is
based on selected known glutaminases and their homologs
within prokaryotes, with the exclusion of highly-derived
(long branch) and architecturally varied homologs, so as
to achieve conservative assignments. A sharp drop in
scores occurs below 250, and cutoffs are set
accordingly. The enzyme converts glutamine to glutamate,
with the release of ammonia. Members tend to be
described as glutaminase A (glsA), where B (glsB) is
unknown and may not be homologous (as in Rhizobium
etli). Some species have two isozymes that may both be
designated A (GlsA1 and GlsA2) [Energy metabolism, Amino
acids and amines].
Length = 300
Score = 24.0 bits (53), Expect = 6.5
Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 2/24 (8%)
Query: 29 AAGGELYDFLDQKKVLTEEEARRI 52
A GG + L ++V++ E ARRI
Sbjct: 205 ANGG--VNPLTGEQVISAEVARRI 226
>gnl|CDD|131081 TIGR02026, BchE, magnesium-protoporphyrin IX monomethyl ester
anaerobic oxidative cyclase. This model respresents the
cobalamin-dependent oxidative cyclase responsible for
forming the distinctive E-ring of the chlorin ring
system under anaerobic conditions. This step is
essential in the biosynthesis of both
bacteriochlorophyll and chlorophyll under anaerobic
conditions (a separate enzyme, AcsF, acts under aerobic
conditions). This model identifies two clades of
sequences, one from photosynthetic, non-cyanobacterial
bacteria and another including Synechocystis and several
non-photosynthetic bacteria. The function of the
Synechocystis gene is supported by gene clustering with
other photosynthetic genes, so the purpose of the gene
in the non-photosynthetic bacteria is uncertain. Note
that homologs of this gene are not found in plants which
rely solely on the aerobic cyclase.
Length = 497
Score = 24.1 bits (52), Expect = 7.4
Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 1/52 (1%)
Query: 4 VRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIFRQ 55
VR +I+H+Y + L E AA L F T +EA R+ RQ
Sbjct: 284 VRDADILHLYRR-AGLVHISLGTEAAAQATLDHFRKGTTTSTNKEAIRLLRQ 334
>gnl|CDD|223356 COG0279, GmhA, Phosphoheptose isomerase [Carbohydrate transport and
metabolism].
Length = 176
Score = 23.8 bits (52), Expect = 8.0
Identities = 8/33 (24%), Positives = 15/33 (45%)
Query: 7 PNIIHIYEVFENREKMVLVMEYAAGGELYDFLD 39
N++ E + + V+ + GG+L LD
Sbjct: 123 KNVLKAIEAAKEKGMTVIALTGKDGGKLAGLLD 155
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein
Serine/Threonine Kinase, G protein-coupled Receptor
Kinase 7. Serine/Threonine Kinases (STKs), G
protein-coupled Receptor Kinase (GRK) subfamily, GRK7
isoform, catalytic (c) domain. STKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
serine/threonine residues on protein substrates. The GRK
subfamily is part of a larger superfamily that includes
the catalytic domains of other protein STKs, protein
tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. GRKs phosphorylate and regulate G
protein-coupled receptors (GPCRs), the largest
superfamily of cell surface receptors, which regulate
some part of nearly all physiological functions.
Phosphorylated GPCRs bind to arrestins, which prevents
further G protein signaling despite the presence of
activating ligand. There are seven types of GRKs, named
GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs
to the visual group of GRKs. It is primarily found in
the retina and plays a role in the regulation of opsin
light receptors. GRK7 is located in retinal cone outer
segments and plays an important role in regulating
photoresponse of the cones.
Length = 277
Score = 24.1 bits (52), Expect = 8.1
Identities = 17/68 (25%), Positives = 29/68 (42%), Gaps = 2/68 (2%)
Query: 1 MSSVRHPNIIHIYEVFENREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRIF--RQIAT 58
+ V P I+++ FE++ + LVM GG+L + E R I QI
Sbjct: 47 LEKVNSPFIVNLAYAFESKTHLCLVMSLMNGGDLKYHIYNVGERGLEMERVIHYSAQITC 106
Query: 59 AVYYCHKV 66
+ + H +
Sbjct: 107 GILHLHSM 114
>gnl|CDD|234866 PRK00927, PRK00927, tryptophanyl-tRNA synthetase; Reviewed.
Length = 333
Score = 23.9 bits (53), Expect = 8.2
Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 4/40 (10%)
Query: 8 NIIHIYEVFENREKMVLVMEYAAGGELY-DFLDQKKVLTE 46
N++ IY L EY AGG+ Y DF KK L E
Sbjct: 243 NLLTIYSALSGESIEELEAEYEAGGKGYGDF---KKDLAE 279
>gnl|CDD|183303 PRK11762, nudE, adenosine nucleotide hydrolase NudE; Provisional.
Length = 185
Score = 23.6 bits (52), Expect = 8.2
Identities = 8/18 (44%), Positives = 13/18 (72%)
Query: 18 NREKMVLVMEYAAGGELY 35
+ + ++L+ EYAAG E Y
Sbjct: 57 DDDTLLLIREYAAGTERY 74
>gnl|CDD|233967 TIGR02666, moaA, molybdenum cofactor biosynthesis protein A,
bacterial. The model for this family describes
molybdenum cofactor biosynthesis protein A, or MoaA, as
found in bacteria. It does not include the family of
probable functional equivalent proteins from the
archaea. MoaA works together with MoaC to synthesize
precursor Z from guanine [Biosynthesis of cofactors,
prosthetic groups, and carriers, Molybdopterin].
Length = 334
Score = 23.7 bits (52), Expect = 8.9
Identities = 10/23 (43%), Positives = 15/23 (65%)
Query: 32 GELYDFLDQKKVLTEEEARRIFR 54
G DFL ++++LT EE R+ R
Sbjct: 31 GGGLDFLPKEELLTFEEIERLVR 53
>gnl|CDD|176719 cd01671, CARD, Caspase activation and recruitment domain: a
protein-protein interaction domain. Caspase activation
and recruitment domains (CARDs) are death domains (DDs)
found associated with caspases. Caspases are
aspartate-specific cysteine proteases with functions in
apoptosis, immune signaling, inflammation, and
host-defense mechanisms. In addition to caspases,
proteins containing CARDs include adaptor proteins such
as RAIDD, CARD9, and RIG-I-like helicases, which can
form mutliprotein complexes and play important roles in
mediating the signals to induce immune and inflammatory
responses. In general, DDs are protein-protein
interaction domains found in a variety of domain
architectures. Their common feature is that they form
homodimers by self-association or heterodimers by
associating with other members of the DD superfamily
including PYRIN and DED (Death Effector Domain). They
serve as adaptors in signaling pathways and can recruit
other proteins into signaling complexes.
Length = 80
Score = 23.3 bits (51), Expect = 9.5
Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%)
Query: 18 NREKMVLVMEYAAGGELYDFLDQKKVLTEEEARRI 52
NR ++V + ++ D L VLTEEE +I
Sbjct: 4 NRLELVKDLLDV--EDVLDHLLSDGVLTEEEYEKI 36
>gnl|CDD|221703 pfam12674, Zn_ribbon_2, Putative zinc ribbon domain. This domain
appears to be a zinc binding DNA-binding domain.
Length = 81
Score = 23.4 bits (51), Expect = 9.8
Identities = 10/21 (47%), Positives = 14/21 (66%)
Query: 36 DFLDQKKVLTEEEARRIFRQI 56
FLD+ LT EEAR+I ++
Sbjct: 53 PFLDENNGLTPEEARKIMKEF 73
Database: CDD.v3.10
Posted date: Mar 20, 2013 7:55 AM
Number of letters in database: 10,937,602
Number of sequences in database: 44,354
Lambda K H
0.324 0.137 0.392
Gapped
Lambda K H
0.267 0.0807 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,545,800
Number of extensions: 270646
Number of successful extensions: 928
Number of sequences better than 10.0: 1
Number of HSP's gapped: 887
Number of HSP's successfully gapped: 273
Length of query: 69
Length of database: 10,937,602
Length adjustment: 39
Effective length of query: 30
Effective length of database: 9,207,796
Effective search space: 276233880
Effective search space used: 276233880
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 53 (24.0 bits)