RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy235
         (226 letters)



>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like
           protein kinase 3-like Protein Serine/Threonine Kinases. 
           Serine/threonine kinases (STKs), mammalian Ste20-like
           protein kinase 3 (MST3)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MST3-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of MST3, MST4,
           STK25, Schizosaccharomyces pombe Nak1 and Sid1,
           Saccharomyces cerevisiae sporulation-specific protein 1
           (SPS1), and related proteins. Nak1 is required by
           fission yeast for polarizing the tips of actin
           cytoskeleton and is involved in cell growth, cell
           separation, cell morphology and cell-cycle progression.
           Sid1 is a component in the septation initiation network
           (SIN) signaling pathway, and plays a role in
           cytokinesis. SPS1 plays a role in regulating proteins
           required for spore wall formation. MST4 plays a role in
           mitogen-activated protein kinase (MAPK) signaling during
           cytoskeletal rearrangement, morphogenesis, and
           apoptosis. MST3 phosphorylates the STK NDR and may play
           a role in cell cycle progression and cell morphology.
           STK25 may play a role in the regulation of cell
           migration and polarization.
          Length = 274

 Score = 39.9 bits (94), Expect = 5e-04
 Identities = 14/24 (58%), Positives = 17/24 (70%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFH 49
           KDF+  CLN+DP  RP A +LL H
Sbjct: 228 KDFVSLCLNKDPKERPSAKELLKH 251


>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control
           protein 7-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs),  (Cdc7)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Cdc7-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this subfamily include
           Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae
           Cdc15, Arabidopsis thaliana mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK) epsilon, and
           related proteins. MAPKKKs phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. Fission yeast Cdc7
           is essential for cell division by playing a key role in
           the initiation of septum formation and cytokinesis.
           Budding yeast Cdc15 functions to coordinate mitotic exit
           with cytokinesis. Arabidopsis MAPKKK epsilon is required
           for pollen development in the plasma membrane.
          Length = 254

 Score = 38.4 bits (90), Expect = 0.001
 Identities = 15/24 (62%), Positives = 17/24 (70%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFH 49
           KDF+  C  +DPNLRP A QLL H
Sbjct: 228 KDFLMQCFQKDPNLRPTAKQLLKH 251


>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant
           dual-specificity MAP kinase kinases and similar
           proteins.  Protein kinases (PKs), MAP kinase kinase
           (MAPKK) subfamily, Plant MAPKKs and similar proteins,
           catalytic (c) domain. PKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine or
           tyrosine residues on protein substrates. The MAPKK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein serine/threonine
           kinases, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The mitogen-activated protein
           (MAP) kinase signaling pathways are important mediators
           of cellular responses to extracellular signals. The
           pathways involve a triple kinase core cascade comprising
           of the MAP kinase (MAPK), which is phosphorylated and
           activated by a MAPK kinase (MAPKK or MKK), which itself
           is phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). Members of this group include MAPKKs
           from plants, kinetoplastids, alveolates, and mycetozoa.
           The MAPKK, LmxPK4, from Leishmania mexicana, is
           important in differentiation and virulence.
           Dictyostelium discoideum MEK1 is required for proper
           chemotaxis. MEK1 null mutants display severe defects in
           cell polarization and directional movement. Plants
           contain multiple MAPKKs like other eukaryotes. The
           Arabidopsis genome encodes for 10 MAPKKs while poplar
           and rice contain 13 MAPKKs each. The functions of these
           proteins have not been fully elucidated. There is
           evidence to suggest that MAPK cascades are involved in
           plant stress responses. In Arabidopsis, MKK3 plays a
           role in pathogen signaling, MKK2 is involved in cold and
           salt stress signaling, MKK4/MKK5 participates in innate
           immunity, and MKK7 regulates basal and systemic acquired
           resistance.
          Length = 264

 Score = 37.2 bits (87), Expect = 0.004
 Identities = 13/32 (40%), Positives = 18/32 (56%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFHAVLFEVHA 57
           +DFI  CL +DP  RP A +LL H  + +   
Sbjct: 233 RDFISACLQKDPKKRPSAAELLQHPFIKKADN 264


>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein
           Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. 
           Serine/threonine kinases (STKs), plant MAP/ERK kinase
           kinase 1 (MEKK1)-like subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The plant MEKK1 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein STKs, protein tyrosine kinases, RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily is
           composed of plant mitogen-activated protein kinase
           (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks)
           including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1
           is a MAPKKK that phosphorylates and activates MAPK
           kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. Arabidopsis thaliana
           MEKK1 activates MPK4, a MAPK that regulates systemic
           acquired resistance. MEKK1 also participates in the
           regulation of temperature-sensitive and tissue-specific
           cell death.
          Length = 258

 Score = 37.0 bits (86), Expect = 0.004
 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 2/29 (6%)

Query: 21  DDASQKDFIYTCLNQDPNLRPRAGQLLFH 49
           D+A  KDFI  CL +DP+LRP A +LL H
Sbjct: 229 DEA--KDFILKCLQRDPSLRPTAAELLEH 255


>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-Activated Protein
           Kinase Kinase Kinase.  Serine/threonine kinases (STKs),
           mitogen-activated protein kinase (MAPK) kinase kinase
           (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called
           MAP/ERK kinase kinases (MEKKs) in some cases. They
           phosphorylate and activate MAPK kinases (MAPKKs or MKKs
           or MAP2Ks), which in turn phosphorylate and activate
           MAPKs during signaling cascades that are important in
           mediating cellular responses to extracellular signals.
           This subfamily is composed of the Apoptosis
           Signal-regulating Kinases ASK1 (or MAPKKK5) and ASK2 (or
           MAPKKK6), MEKK1, MEKK2, MEKK3, MEKK4, as well as plant
           and fungal MAPKKKs. Also included in this subfamily are
           the cell division control proteins Schizosaccharomyces
           pombe Cdc7 and Saccharomyces cerevisiae Cdc15.
          Length = 260

 Score = 36.8 bits (86), Expect = 0.005
 Identities = 13/24 (54%), Positives = 16/24 (66%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFH 49
           KDF+  CL +DP  RP A +LL H
Sbjct: 234 KDFLRKCLRRDPKKRPTADELLQH 257


>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, STK25 or Yeast
           Sps1/Ste20-related kinase 1.  Serine/threonine kinases
           (STKs), STK25 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The STK25 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. STK25 is also called Ste20/oxidant stress
           response kinase 1 (SOK1) or yeast Sps1/Ste20-related
           kinase 1 (YSK1). STK25 is localized in the Golgi
           apparatus through its interaction with the Golgi matrix
           protein GM130. It may play a role in the regulation of
           cell migration and polarization. STK25 binds and
           phosphorylates CCM3 (cerebral cavernous malformation 3),
           also called PCD10 (programmed cell death 10), and may
           play a role in apoptosis. Human STK25 is a candidate
           gene responsible for pseudopseudohypoparathyroidism
           (PPHP), a disease that shares features with the Albright
           hereditary osteodystrophy (AHO) phenotype.
          Length = 277

 Score = 36.6 bits (84), Expect = 0.006
 Identities = 13/24 (54%), Positives = 17/24 (70%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFH 49
           K+F+  CLN+DP  RP A +LL H
Sbjct: 230 KEFVEACLNKDPRFRPTAKELLKH 253


>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein
           Serine/Threonine Kinases, Mammalian Ste20-like protein
           kinase 1 and 2.  Serine/threonine kinases (STKs),
           mammalian Ste20-like protein kinase 1 (MST1) and MST2
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MST1/2 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of MST1, MST2, and
           related proteins including Drosophila Hippo and
           Dictyostelium discoideum Krs1 (kinase responsive to
           stress 1). MST1/2 and Hippo are involved in a conserved
           pathway that governs cell contact inhibition, organ size
           control, and tumor development. MST1 activates the
           mitogen-activated protein kinases (MAPKs) p38 and c-Jun
           N-terminal kinase (JNK) through MKK7 (a MAPK kinase) and
           MEKK1 (a MAPK kinase kinase) by acting as a MAPK kinase
           kinase kinase (MAPKKKK). Activation of JNK by MST1 leads
           to caspase activation and apoptosis. MST1 has also been
           implicated in cell proliferation and differentiation.
           Krs1 may regulate cell growth arrest and apoptosis in
           response to cellular stress.
          Length = 256

 Score = 36.5 bits (85), Expect = 0.006
 Identities = 13/23 (56%), Positives = 15/23 (65%)

Query: 27  DFIYTCLNQDPNLRPRAGQLLFH 49
           DF+  CL +DP  RP A QLL H
Sbjct: 231 DFVKKCLVKDPEERPSAIQLLQH 253


>gnl|CDD|181212 PRK08056, PRK08056, threonine-phosphate decarboxylase; Provisional.
          Length = 356

 Score = 36.6 bits (85), Expect = 0.006
 Identities = 19/76 (25%), Positives = 31/76 (40%), Gaps = 12/76 (15%)

Query: 5   GTLVTEDH--IRATIESLDDASQKDFIYTCLNQDPNLR---PRAGQLLFHAVLFEV---H 56
           G ++ +D    +AT + L  A +    Y  L   P L     RA  L       ++    
Sbjct: 252 GEVILQDRAYQQATWQWL--AEEGARFYQALCALPLLTVWPGRANYLFLRCERPDIDLQR 309

Query: 57  ALKLLSAHALVRHCSD 72
           AL  L+   L+R C++
Sbjct: 310 AL--LTQRILIRSCAN 323


>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 4.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4
           (MEKK4) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK4 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK4 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates MAPK kinases (MAPKKs or
           MKKs or MAP2Ks), which in turn phosphorylate and
           activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK4 activates the c-Jun
           N-terminal kinase (JNK) and p38 MAPK signaling pathways
           by directly activating their respective MAPKKs,
           MKK4/MKK7 and MKK3/MKK6. JNK and p38 are collectively
           known as stress-activated MAPKs, as they are activated
           in response to a variety of environmental stresses and
           pro-inflammatory cytokines. MEKK4 also plays roles in
           the re-polarization of the actin cytoskeleton in
           response to osmotic stress, in the proper closure of the
           neural tube, in cardiovascular development, and in
           immune responses.
          Length = 264

 Score = 36.2 bits (84), Expect = 0.009
 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 2/37 (5%)

Query: 16  TIESLDDASQ--KDFIYTCLNQDPNLRPRAGQLLFHA 50
            I      S   KDF+  CL  DP  RP A +LL H 
Sbjct: 226 PIPDSLQLSPEGKDFLDRCLESDPKKRPTASELLQHP 262


>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases.
           Protein Kinases (PKs), STE family, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The STE family is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases (STKs), protein
           tyrosine kinases (PTKs), RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This family is composed of STKs, and
           some dual-specificity PKs that phosphorylate both
           threonine and tyrosine residues of target proteins. Most
           members are kinases involved in mitogen-activated
           protein kinase (MAPK) signaling cascades, acting as MAPK
           kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK
           kinase kinase kinases (MAP4Ks). The MAPK signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAPK, which is
           phosphorylated and activated by a MAPKK, which itself is
           phosphorylated and activated by a MAPKKK. Each MAPK
           cascade is activated either by a small GTP-binding
           protein or by an adaptor protein, which transmits the
           signal either directly to a MAPKKK to start the triple
           kinase core cascade or indirectly through a mediator
           kinase, a MAP4K. Other STE family members include
           p21-activated kinases (PAKs) and class III myosins,
           among others. PAKs are Rho family GTPase-regulated
           kinases that serve as important mediators in the
           function of Cdc42 (cell division cycle 42) and Rac.
           Class III myosins are motor proteins containing an
           N-terminal kinase catalytic domain and a C-terminal
           actin-binding domain, which can phosphorylate several
           cytoskeletal proteins, conventional myosin regulatory
           light chains, as well as autophosphorylate the
           C-terminal motor domain. They play an important role in
           maintaining the structural integrity of photoreceptor
           cell microvilli.
          Length = 253

 Score = 35.3 bits (82), Expect = 0.017
 Identities = 13/24 (54%), Positives = 16/24 (66%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFH 49
           KDF+  CL ++P  RP A QLL H
Sbjct: 228 KDFLKKCLQKNPEKRPTAEQLLKH 251


>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine
           Kinase, p21-activated kinase.  Serine/threonine kinases
           (STKs), p21-activated kinase (PAK) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PAK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PAKs are Rho
           family GTPase-regulated kinases that serve as important
           mediators in the function of Cdc42 (cell division cycle
           42) and Rac. PAKs are implicated in the regulation of
           many cellular processes including growth factor
           receptor-mediated proliferation, cell polarity, cell
           motility, cell death and survival, and actin
           cytoskeleton organization. PAK deregulation is
           associated with tumor development. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs contain a PBD (p21-binding domain)
           overlapping with an AID (autoinhibitory domain), a
           C-terminal catalytic domain, SH3 binding sites and a
           non-classical SH3 binding site for PIX (PAK-interacting
           exchange factor). Group II PAKs contain a PBD and a
           catalytic domain, but lack other motifs found in group I
           PAKs. Since group II PAKs do not contain an obvious AID,
           they may be regulated differently from group I PAKs.
           Group I PAKs interact with the SH3 containing proteins
           Nck, Grb2 and PIX; no such binding has been demonstrated
           for group II PAKs.
          Length = 286

 Score = 35.3 bits (82), Expect = 0.018
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFHAVL 52
           KDF+  CL +DP  RP A +LL H  L
Sbjct: 247 KDFLNKCLVKDPEKRPSAEELLQHPFL 273


>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mammalian Ste20-like protein
           kinase 4.  Serine/threonine kinases (STKs), mammalian
           Ste20-like protein kinase 4 (MST4) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MST4 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MST4 is sometimes
           referred to as MASK (MST3 and SOK1-related kinase). It
           plays a role in mitogen-activated protein kinase (MAPK)
           signaling during cytoskeletal rearrangement,
           morphogenesis, and apoptosis. It influences cell growth
           and transformation by modulating the extracellular
           signal-regulated kinase (ERK) pathway. MST4 may also
           play a role in tumor formation and progression. It
           localizes in the Golgi apparatus by interacting with the
           Golgi matrix protein GM130 and may play a role in cell
           migration.
          Length = 277

 Score = 34.6 bits (79), Expect = 0.025
 Identities = 14/24 (58%), Positives = 18/24 (75%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFH 49
           K+FI  CLN+DP+ RP A +LL H
Sbjct: 230 KEFIDACLNKDPSFRPTAKELLKH 253


>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase (MAPKK) subfamily, fungal
           PBS2-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Polymyxin B
           resistance protein 2 (PBS2) from Saccharomyces
           cerevisiae, Wis1 from Schizosaccharomyces pombe, and
           related proteins. PBS2 and Wis1 are components of
           stress-activated MAPK cascades in budding and fission
           yeast, respectively. PBS2 is the specific activator of
           the MAPK Hog1, which plays a central role in the
           response of budding yeast to stress including exposure
           to arsenite and hyperosmotic environments. Wis1
           phosphorylates and activates the MAPK Sty1 (also called
           Spc1 or Phh1), which stimulates a transcriptional
           response to a wide range of cellular insults through the
           bZip transcription factors Atf1, Pcr1, and Pap1.
          Length = 286

 Score = 34.1 bits (78), Expect = 0.041
 Identities = 17/32 (53%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 21  DDASQKDFIYTCLNQDPNLRPRAGQLLFHAVL 52
           DDA  +DF+  CLN+ PN RP   QLL H  L
Sbjct: 236 DDA--QDFVAKCLNKIPNRRPTYAQLLEHPWL 265


>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated
           protein kinase kinase kinase kinase-like Protein
           Serine/Threonine Kinases.  Serine/threonine kinases
           (STKs), mitogen-activated protein kinase (MAPK) kinase
           kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAP4K3-like
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily includes MAP4K3, MAP4K1,
           MAP4K2, MAP4K5, and related proteins. Vertebrate members
           contain an N-terminal catalytic domain and a C-terminal
           citron homology (CNH) regulatory domain, similar to
           MAP4K4/6. MAP4Ks are involved in some MAPK signaling
           pathways that are important in mediating cellular
           responses to extracellular signals by activating a MAPK
           kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK
           cascade is activated either by a small GTP-binding
           protein or by an adaptor protein, which transmits the
           signal either directly to a MAP3K to start the triple
           kinase core cascade or indirectly through a mediator
           kinase, a MAP4K. MAP4K1, also called haematopoietic
           progenitor kinase 1 (HPK1), is a hematopoietic-specific
           STK involved in many cellular signaling cascades
           including MAPK, antigen receptor, apoptosis, growth
           factor, and cytokine signaling. It participates in the
           regulation of T cell receptor signaling and T
           cell-mediated immune responses. MAP4K2 was referred to
           as germinal center (GC) kinase because of its preferred
           location in GC B cells. MAP4K3 plays a role in the
           nutrient-responsive pathway of mTOR (mammalian target of
           rapamycin) signaling. It is required in the activation
           of S6 kinase by amino acids and for the phosphorylation
           of the mTOR-regulated inhibitor of eukaryotic initiation
           factor 4E. MAP4K5, also called germinal center
           kinase-related enzyme (GCKR), has been shown to activate
           the MAPK c-Jun N-terminal kinase (JNK).
          Length = 262

 Score = 33.8 bits (78), Expect = 0.044
 Identities = 13/23 (56%), Positives = 15/23 (65%)

Query: 27  DFIYTCLNQDPNLRPRAGQLLFH 49
           DFI  CL +DP  RP A +LL H
Sbjct: 238 DFIKKCLTKDPKKRPTATKLLQH 260


>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase
           4.  Serine/threonine kinases (STKs), yeast
           Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The YSK4 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. YSK4 is a
           putative MAPKKK, whose mammalian gene has been isolated.
           MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals.
          Length = 265

 Score = 33.7 bits (77), Expect = 0.049
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 14  RATIESLDD---ASQKDFIYTCLNQDPNLRPRAGQLLFHAVL 52
           R  +  L D   A+  DF+ +CL +D + RP A QLL H  L
Sbjct: 224 RGLMPRLPDSFSAAAIDFVTSCLTRDQHERPSALQLLRHDFL 265


>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity
           Protein Kinases, MAP kinase kinases 3 and 6.  Protein
           kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6
           subfamily, catalytic (c) domain. PKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MKK3 and MKK6 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MKK3 and MKK6 are dual-specificity PKs that
           phosphorylate and activate their downstream target, p38
           MAPK, on specific threonine and tyrosine residues.
           MKK3/6 plays roles in the regulation of cell cycle
           progression, cytokine- and stress-induced apoptosis,
           oncogenic transformation, and adult tissue regeneration.
           In addition, MKK6 plays a critical role in osteoclast
           survival in inflammatory disease while MKK3 is
           associated with tumor invasion, progression, and poor
           patient survival in glioma.
          Length = 283

 Score = 33.6 bits (77), Expect = 0.054
 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 1/42 (2%)

Query: 27  DFIYTCLNQDPNLRPRAGQLLFHAVLFEVHALKLLSAHALVR 68
           DF+  CL ++   RP   +LL H   FE+H  K     + V 
Sbjct: 239 DFVNKCLKKNYKERPNYPELLQH-PFFELHLSKNTDVASFVS 279


>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein
           Serine/Threonine Kinases, Oxidative stress response
           kinase and Ste20-related proline alanine-rich kinase.
           Serine/threonine kinases (STKs), oxidative stress
           response kinase (OSR1) and Ste20-related proline
           alanine-rich kinase (SPAK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The OSR1 and SPAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. SPAK is also referred to as STK39 or PASK
           (proline-alanine-rich STE20-related kinase). OSR1 and
           SPAK regulate the activity of cation-chloride
           cotransporters through direct interaction and
           phosphorylation. They are also implicated in
           cytoskeletal rearrangement, cell differentiation,
           transformation and proliferation. OSR1 and SPAK contain
           a conserved C-terminal (CCT) domain, which recognizes a
           unique motif ([RK]FX[VI]) present in their activating
           kinases (WNK1/WNK4) and their substrates.
          Length = 267

 Score = 33.5 bits (77), Expect = 0.062
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 23  ASQKDFIYTCLNQDPNLRPRAGQLLFHAV 51
            S +  I  CL +DP+ RP A +LL H  
Sbjct: 238 KSFRKMISLCLQKDPSKRPTAEELLKHKF 266


>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mammalian Ste20-like protein
           kinase 3.  Serine/threonine kinases (STKs), mammalian
           Ste20-like protein kinase 3 (MST3) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MST3 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MST3
           phosphorylates the STK NDR and may play a role in cell
           cycle progression and cell morphology. It may also
           regulate paxillin and consequently, cell migration. MST3
           is present in human placenta, where it plays an
           essential role in the oxidative stress-induced apoptosis
           of trophoblasts in normal spontaneous delivery.
           Dysregulation of trophoblast apoptosis may result in
           pregnancy complications such as preeclampsia and
           intrauterine growth retardation.
          Length = 277

 Score = 33.1 bits (75), Expect = 0.088
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 16  TIESLDDASQKDFIYTCLNQDPNLRPRAGQLLFHAVLF 53
           T+E       K+F+  CLN++P+ RP A +LL H  + 
Sbjct: 220 TLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFIV 257


>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase
           adapter protein.  Protein Kinase family, STE20-related
           kinase adapter protein (STRAD) subfamily, pseudokinase
           domain. The STRAD subfamily is part of a larger
           superfamily that includes the catalytic domains of
           serine/threonine kinases (STKs), protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           pseudokinase domain shows similarity to protein kinases
           but lacks crucial residues for catalytic activity. STRAD
           forms a complex with the scaffolding protein MO25, and
           the STK, LKB1, resulting in the activation of the
           kinase. In the complex, LKB1 phosphorylates and
           activates adenosine monophosphate-activated protein
           kinases (AMPKs), which regulate cell energy metabolism
           and cell polarity. LKB1 is a tumor suppressor linked to
           the rare inherited disease, Peutz-Jeghers syndrome,
           which is characterized by a predisposition to benign
           polyps and hyperpigmentation of the buccal mucosa. There
           are two forms of STRAD, alpha and beta, that complex
           with LKB1 and MO25. The structure of STRAD-alpha is
           available and shows that this protein binds ATP, has an
           ordered activation loop, and adopts a closed
           conformation typical of fully active protein kinases. It
           does not possess activity due to nonconservative
           substitutions of essential catalytic residues. ATP
           binding enhances the affinity of STRAD for MO25.  The
           conformation of STRAD-alpha stabilized through ATP and
           MO25 may be needed to activate LKB1.
          Length = 314

 Score = 32.7 bits (75), Expect = 0.12
 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 7/40 (17%)

Query: 18  ESLDDASQK-------DFIYTCLNQDPNLRPRAGQLLFHA 50
           +S+D    +        F+  CL +DP  RP A QLL H+
Sbjct: 257 DSVDHPYTRTFSEHFHQFVELCLQRDPESRPSASQLLNHS 296


>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain. 
          Length = 260

 Score = 32.6 bits (75), Expect = 0.13
 Identities = 13/24 (54%), Positives = 17/24 (70%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFH 49
           KD I  CLN+DP+ RP A ++L H
Sbjct: 234 KDLIKKCLNKDPSKRPTAEEILQH 257


>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like
           Protein Serine/Threonine Kinases.  Serine/threonine
           kinases (STKs), Ste20-like kinase (SLK)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The SLK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of the subfamily include SLK, STK10
           (also called LOK for lymphocyte-oriented kinase), SmSLK
           (Schistosoma mansoni SLK), and related proteins. SLK
           promotes apoptosis through apoptosis signal-regulating
           kinase 1 (ASK1) and the mitogen-activated protein kinase
           (MAPK) p38. It also plays a role in mediating actin
           reorganization. STK10 is responsible in regulating the
           CD28 responsive element in T cells, as well as leukocyte
           function associated antigen (LFA-1)-mediated lymphocyte
           adhesion. SmSLK is capable of activating the MAPK Jun
           N-terminal kinase (JNK) pathway in human embryonic
           kidney (HEK) cells as well as in Xenopus oocytes. It may
           participate in regulating MAPK cascades during
           host-parasite interactions.
          Length = 280

 Score = 32.4 bits (74), Expect = 0.13
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFHA 50
            DF+ +CL +DP+ RP A +LL H 
Sbjct: 239 NDFLKSCLVKDPDDRPTAAELLKHP 263


>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine
           Kinases, Cyclin-Dependent protein Kinase Like 2 and 3.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase like 2 (CDKL2) and CDKL3 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDKL2 and CDKL3
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKL2, also called
           p56 KKIAMRE, is expressed in testis, kidney, lung, and
           brain. It functions mainly in mature neurons and plays
           an important role in learning and memory. Inactivation
           of CDKL3, also called NKIAMRE (NKIATRE in rat), by
           translocation is associated with mild mental
           retardation. It has been reported that CDKL3 is lost in
           leukemic cells having a chromosome arm 5q deletion, and
           may contribute to the transformed phenotype.
          Length = 286

 Score = 32.4 bits (74), Expect = 0.16
 Identities = 11/23 (47%), Positives = 13/23 (56%)

Query: 27  DFIYTCLNQDPNLRPRAGQLLFH 49
           D    CL  DP+ RP + QLL H
Sbjct: 261 DLAKQCLRIDPDDRPSSSQLLHH 283


>gnl|CDD|173766 cd08226, PK_STRAD_beta, Pseudokinase domain of STE20-related kinase
           adapter protein beta.  Protein Kinase family,
           STE20-related kinase adapter protein (STRAD) beta
           subfamily, pseudokinase domain. The STRAD-beta subfamily
           is part of a larger superfamily that includes the
           catalytic domains of serine/threonine kinases (STKs),
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The pseudokinase domain shows similarity to
           protein kinases but lacks crucial residues for catalytic
           activity. STRAD forms a complex with the scaffolding
           protein MO25, and the STK, LKB1, resulting in the
           activation of the kinase. In the complex, LKB1
           phosphorylates and activates adenosine
           monophosphate-activated protein kinases (AMPKs), which
           regulate cell energy metabolism and cell polarity. LKB1
           is a tumor suppressor linked to the rare inherited
           disease, Peutz-Jeghers syndrome, which is characterized
           by a predisposition to benign polyps and
           hyperpigmentation of the buccal mucosa. There are two
           forms of STRAD, alpha and beta, that complex with LKB1
           and MO25. STRAD-beta is also referred to as ALS2CR2
           (Amyotrophic lateral sclerosis 2 chromosomal region
           candidate gene 2 protein), since the human gene encoding
           it is located within the juvenile ALS2 critical region
           on chromosome 2q33-q34. It is not linked to the
           development of ALS2.
          Length = 328

 Score = 31.5 bits (71), Expect = 0.29
 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 7/47 (14%)

Query: 16  TIESLDDASQKDF-------IYTCLNQDPNLRPRAGQLLFHAVLFEV 55
           T E L   S K F       +  CL QDP  RP A  LL HA   +V
Sbjct: 268 TSERLRTPSSKTFSPAFQNLVELCLQQDPEKRPSASSLLSHAFFKQV 314


>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase;
           Provisional.
          Length = 353

 Score = 31.7 bits (72), Expect = 0.30
 Identities = 11/24 (45%), Positives = 14/24 (58%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFH 49
           + FI  CL ++P  R  A QLL H
Sbjct: 305 RHFISCCLQREPAKRWSAMQLLQH 328


>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III
           myosin-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), Class III myosin-like
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           class III myosin-like subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Class III myosins are motor
           proteins with an N-terminal kinase catalytic domain and
           a C-terminal actin-binding motor domain. Class III
           myosins are present in the photoreceptors of
           invertebrates and vertebrates and in the auditory hair
           cells of mammals. The kinase domain of myosin III can
           phosphorylate several cytoskeletal proteins,
           conventional myosin regulatory light chains, and can
           autophosphorylate the C-terminal motor domain. Myosin
           III may play an important role in maintaining the
           structural integrity of photoreceptor cell microvilli.
           It may also function as a cargo carrier during
           light-dependent translocation, in photoreceptor cells,
           of proteins such as transducin and arrestin. The
           Drosophila class III myosin, called NinaC (Neither
           inactivation nor afterpotential protein C), is critical
           in normal adaptation and termination of photoresponse.
           Vertebrates contain two isoforms of class III myosin,
           IIIA and IIIB. This subfamily also includes mammalian
           NIK-like embryo-specific kinase (NESK), Traf2- and
           Nck-interacting kinase (TNIK), mitogen-activated protein
           kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or
           MAP4K4) and MAPKKKK6 (or MAP4K6). MAP4Ks are involved in
           some MAPK signaling pathways by activating a MAPK kinase
           kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
           activated either by a small GTP-binding protein or by an
           adaptor protein, which transmits the signal either
           directly to a MAP3K to start the triple kinase core
           cascade or indirectly through a mediator kinase, a
           MAP4K. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
          Length = 275

 Score = 31.1 bits (71), Expect = 0.38
 Identities = 10/26 (38%), Positives = 14/26 (53%)

Query: 27  DFIYTCLNQDPNLRPRAGQLLFHAVL 52
           DFI  CL ++   RP   +LL H  +
Sbjct: 250 DFISECLIKNYEQRPFMEELLEHPFI 275


>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine
           Kinase, Never In Mitosis gene A-related kinase.
           Serine/Threonine Kinases (STKs), Never In Mitosis gene A
           (NIMA)-related kinase (Nek) family, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek family is
           composed of 11 different mammalian members (Nek1-11)
           with similarity to the catalytic domain of Aspergillus
           nidulans NIMA kinase, the founding member of the Nek
           family which was identified in a screen for cell cycle
           mutants that were prevented from entering mitosis. Neks
           contain a conserved N-terminal catalytic domain and a
           more divergent C-terminal regulatory region of various
           sizes and structures. They are involved in the
           regulation of downstream processes following the
           activation of Cdc2, and many of their functions are cell
           cycle-related. They play critical roles in microtubule
           dynamics during ciliogenesis and mitosis.
          Length = 258

 Score = 30.5 bits (70), Expect = 0.63
 Identities = 7/22 (31%), Positives = 13/22 (59%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLL 47
           ++ + + L +DP  RP   Q+L
Sbjct: 232 RNLVSSLLQKDPEERPSIAQIL 253


>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein
           Serine/Threonine Kinase, STK10 or Lymphocyte-oriented
           kinase.  Serine/threonine kinases (STKs), STK10
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           STK10 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Other names for STK10 include
           lymphocyte-oriented kinase (LOK) and Xenopus polo-like
           kinase kinase 1 (xPlkk1). STK10 is highly expressed in
           lymphocytes and is responsible in regulating leukocyte
           function associated antigen (LFA-1)-mediated lymphocyte
           adhesion. It plays a role in regulating the CD28
           responsive element in T cells, and may also function as
           a regulator of polo-like kinase 1 (Plk1), a protein
           which is overexpressed in multiple tumor types.
          Length = 292

 Score = 30.4 bits (68), Expect = 0.64
 Identities = 14/36 (38%), Positives = 21/36 (58%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFHAVLFEVHALKLL 61
           +DF+ T L++ P  RP A QLL H  +  V + + L
Sbjct: 246 RDFLKTALDKHPETRPSAAQLLEHPFVSSVTSNRPL 281


>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
           domain.  Phosphotransferases. Serine or
           threonine-specific kinase subfamily.
          Length = 254

 Score = 30.2 bits (69), Expect = 0.71
 Identities = 10/24 (41%), Positives = 12/24 (50%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFH 49
           KD I   L +DP  R  A + L H
Sbjct: 228 KDLIRKLLVKDPEKRLTAEEALQH 251


>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase(MAPKK) subfamily, fungal
           Pek1-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Pek1/Skh1 from
           Schizosaccharomyces pombe and MKK2 from Saccharomyces
           cerevisiae, and related proteins. Both fission yeast
           Pek1 and baker's yeast MKK2 are components of the cell
           integrity MAPK pathway. In fission yeast, Pek1
           phosphorylates and activates the MAPK Pmk1/Spm1 and is
           regulated by the MAPKKK Mkh1. In baker's yeast, the
           pathway involves the MAPK Slt2, the MAPKKs MKK1 and
           MKK2, and the MAPKKK Bck1. The cell integrity MAPK
           cascade is activated by multiple stress conditions, and
           is essential  in cell wall construction, morphogenesis,
           cytokinesis, and ion homeostasis.
          Length = 287

 Score = 30.1 bits (68), Expect = 0.74
 Identities = 12/24 (50%), Positives = 14/24 (58%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFH 49
           KDFI  CL +DP  RP    +L H
Sbjct: 243 KDFIKQCLEKDPTRRPTPWDMLEH 266


>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity
           Protein Kinase, Mitogen-Activated Protein Kinase Kinase.
            Protein kinases (PKs), MAP kinase kinase (MAPKK)
           subfamily, catalytic (c) domain. PKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK or MAP2K), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK or
           MAP3K). MAPKKs are dual-specificity PKs that
           phosphorylate their downstream targets, MAPKs, at
           specific threonine and tyrosine residues. There are
           three MAPK subfamilies: extracellular signal-regulated
           kinase (ERK), c-Jun N-terminal kinase (JNK), and p38. In
           mammalian cells, there are seven MAPKKs (named MKK1-7)
           and 20 MAPKKKs. Each MAPK subfamily can be activated by
           at least two cognate MAPKKs and by multiple MAPKKKs.
          Length = 265

 Score = 30.0 bits (68), Expect = 0.97
 Identities = 11/23 (47%), Positives = 14/23 (60%)

Query: 27  DFIYTCLNQDPNLRPRAGQLLFH 49
           DF+  CL +DP  RP   +LL H
Sbjct: 235 DFVNLCLIKDPRERPSYKELLEH 257


>gnl|CDD|173767 cd08227, PK_STRAD_alpha, Pseudokinase domain of STE20-related
           kinase adapter protein alpha.  Protein Kinase family,
           STE20-related kinase adapter protein (STRAD) alpha
           subfamily, pseudokinase domain. The STRAD alpha
           subfamily is part of a larger superfamily that includes
           the catalytic domains of serine/threonine kinases
           (STKs), protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The pseudokinase domain shows
           similarity to protein kinases but lacks crucial residues
           for catalytic activity. STRAD forms a complex with the
           scaffolding protein MO25, and the STK, LKB1, resulting
           in the activation of the kinase. In the complex, LKB1
           phosphorylates and activates adenosine
           monophosphate-activated protein kinases (AMPKs), which
           regulate cell energy metabolism and cell polarity. LKB1
           is a tumor suppressor linked to the rare inherited
           disease, Peutz-Jeghers syndrome, which is characterized
           by a predisposition to benign polyps and
           hyperpigmentation of the buccal mucosa. There are two
           forms of STRAD, alpha and beta, that complex with LKB1
           and MO25. The structure of STRAD-alpha is available and
           shows that this protein binds ATP, has an ordered
           activation loop, and adopts a closed conformation
           typical of fully active protein kinases. It does not
           possess activity due to nonconservative substitutions of
           essential catalytic residues. ATP binding enhances the
           affinity of STRAD for MO25.  The conformation of
           STRAD-alpha, stabilized through ATP and MO25, may be
           needed to activate LKB1. A mutation which results in a
           truncation of a C-terminal part of the human STRAD-alpha
           pseudokinase domain and disrupts its association with
           LKB1, leads to PMSE (polyhydramnios, megalencephaly,
           symptomatic epilepsy) syndrome. Several splice variants
           of STRAD-alpha exist which exhibit different effects on
           the localization and activation of LKB1.
          Length = 327

 Score = 29.9 bits (67), Expect = 1.1
 Identities = 10/22 (45%), Positives = 14/22 (63%)

Query: 28  FIYTCLNQDPNLRPRAGQLLFH 49
           F+  CL ++P+ RP A  LL H
Sbjct: 286 FVEQCLQRNPDARPSASTLLNH 307


>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases.  Protein Kinases
           (PKs), catalytic (c) domain. PKs catalyze the transfer
           of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The PK family is part of a larger
           superfamily that includes the catalytic domains of RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, phosphoinositide 3-kinase (PI3K), and
           actin-fragmin kinase. PKs make up a large family of
           serine/threonine kinases, protein tyrosine kinases
           (PTKs), and dual-specificity PKs that phosphorylate both
           serine/threonine and tyrosine residues of target
           proteins. Majority of protein phosphorylation, about
           95%, occurs on serine residues while only 1% occurs on
           tyrosine residues. Protein phosphorylation is a
           mechanism by which a wide variety of cellular proteins,
           such as enzymes and membrane channels, are reversibly
           regulated in response to certain stimuli. PKs often
           function as components of signal transduction pathways
           in which one kinase activates a second kinase, which in
           turn, may act on other kinases; this sequential action
           transmits a signal from the cell surface to target
           proteins, which results in cellular responses. The PK
           family is one of the largest known protein families with
           more than 100 homologous yeast enzymes and 550 human
           proteins. A fraction of PK family members are
           pseudokinases that lack crucial residues for catalytic
           activity. The mutiplicity of kinases allows for specific
           regulation according to substrate, tissue distribution,
           and cellular localization. PKs regulate many cellular
           processes including proliferation, division,
           differentiation, motility, survival, metabolism,
           cell-cycle progression, cytoskeletal rearrangement,
           immunity, and neuronal functions. Many kinases are
           implicated in the development of various human diseases
           including different types of cancer.
          Length = 215

 Score = 29.1 bits (66), Expect = 1.5
 Identities = 11/24 (45%), Positives = 14/24 (58%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFH 49
           KD I   L +DP  RP A ++L H
Sbjct: 191 KDLIRKMLQKDPEKRPSAKEILEH 214


>gnl|CDD|106962 PHA00649, PHA00649, hypothetical protein.
          Length = 83

 Score = 27.0 bits (59), Expect = 2.7
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 6/43 (13%)

Query: 68  RHCSDPS----NPNRVKYVFKM--CHVHVAEKLEKFVEDVKYG 104
           +HC  P+        VK VF +    V V E++E+F ED+++G
Sbjct: 4   QHCDTPACQEAADRAVKKVFAILGVDVDVPEQVEEFREDLRFG 46


>gnl|CDD|205431 pfam13251, DUF4042, Domain of unknown function (DUF4042).  This
          presumed domain is functionally uncharacterized. This
          domain family is found in eukaryotes, and is
          approximately 180 amino acids in length.
          Length = 182

 Score = 28.0 bits (63), Expect = 2.7
 Identities = 14/47 (29%), Positives = 19/47 (40%)

Query: 18 ESLDDASQKDFIYTCLNQDPNLRPRAGQLLFHAVLFEVHALKLLSAH 64
            L    Q   + TCL  DP+ + RA  L   A + +   L L  A 
Sbjct: 33 NVLQGRKQTATLLTCLLFDPSPKVRAAALQVLAQMLDGSKLFLSQAS 79


>gnl|CDD|238246 cd00432, Ribosomal_L18_L5e, Ribosomal L18/L5e:  L18 (L5e) is a
           ribosomal protein found in the central protuberance (CP)
           of the large subunit. L18 binds 5S rRNA and induces a
           conformational change that stimulates the binding of L5
           to 5S rRNA. Association of 5S rRNA with 23S rRNA depends
           on the binding of L18 and L5 to 5S rRNA. L18/L5e is
           generally described as L18 in prokaryotes and archaea,
           and as L5e (or L5) in eukaryotes. In bacteria, the CP
           proteins L5, L18, and L25 are required for the ribosome
           to incorporate 5S rRNA into the large subunit, one of
           the last steps in ribosome assembly. In archaea, both
           L18 and L5 bind 5S rRNA; in eukaryotes, only the L18
           homolog (L5e) binds 5S rRNA but a homolog to L5 is also
           identified.
          Length = 103

 Score = 27.1 bits (61), Expect = 3.5
 Identities = 6/20 (30%), Positives = 9/20 (45%)

Query: 172 KMNRQLTCNIVDSDNGSTLA 191
           K N+ +   I+D     TL 
Sbjct: 18  KSNKHIYAQIIDDSGDKTLV 37


>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein
           Kinase Like Serine/Threonine Kinases.  Serine/Threonine
           Kinases (STKs), Cyclin-dependent protein kinase like
           (CDKL) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CDKL subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. This subfamily is
           composed of CDKL1-5 and similar proteins. Some CDKLs,
           like CDKL1 and CDKL3, may be implicated in
           transformation and others, like CDKL3 and CDKL5, are
           associated with mental retardation when impaired. CDKL2
           plays a role in learning and memory.
          Length = 288

 Score = 27.7 bits (62), Expect = 4.4
 Identities = 10/24 (41%), Positives = 12/24 (50%)

Query: 27  DFIYTCLNQDPNLRPRAGQLLFHA 50
           DF+  CL  DP  R    +LL H 
Sbjct: 263 DFLKACLRMDPKERLTCDELLQHP 286


>gnl|CDD|99871 cd06118, citrate_synt_like_1, Citrate synthase (CS) catalyzes the
           condensation of acetyl coenzyme A (AcCoA) and
           oxalacetate (OAA) to form citrate and coenzyme A (CoA),
           the first step in the oxidative citric acid cycle (TCA
           or Krebs cycle). Peroxisomal CS is involved in the
           glyoxylate cycle. This group also includes CS proteins
           which functions as a 2-methylcitrate synthase (2MCS).
           2MCS catalyzes the condensation of propionyl-CoA (PrCoA)
           and OAA to form 2-methylcitrate and CoA during
           propionate metabolism. This group contains proteins
           which functions exclusively as either a CS or a 2MCS, as
           well as those with relaxed specificity which have dual
           functions as both a CS and a 2MCS. The overall CS
           reaction is thought to proceed through three partial
           reactions and involves both closed and open
           conformational forms of the enzyme: a) the carbanion or
           equivalent is generated from AcCoA by base abstraction
           of a proton, b) the nucleophilic attack of this
           carbanion on OAA to generate citryl-CoA, and c) the
           hydrolysis of citryl-CoA to produce citrate and CoA.
           There are two types of CSs: type I CS and type II CSs.
           Type I CSs are found in eukarya, gram-positive bacteria,
           archaea, and in some gram-negative bacteria and are
           homodimers with both subunits participating in the
           active site.  Type II CSs are unique to gram-negative
           bacteria and are homohexamers of identical subunits
           (approximated as a trimer of dimers).  Some type II CSs
           are strongly and specifically inhibited by NADH through
           an allosteric mechanism.
          Length = 358

 Score = 27.6 bits (62), Expect = 5.5
 Identities = 9/21 (42%), Positives = 13/21 (61%), Gaps = 2/21 (9%)

Query: 89  HVAEKLEKFVEDVKY--GIYP 107
            +AE+LE+   +V    GIYP
Sbjct: 285 EIAEELEEIALEVLGEKGIYP 305


>gnl|CDD|215304 PLN02554, PLN02554, UDP-glycosyltransferase family protein.
          Length = 481

 Score = 27.8 bits (62), Expect = 5.6
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 10/37 (27%)

Query: 77  NRVKYVFKMCHV--------HVAEKLEKFVEDVKYGI 105
            RVK + + CHV        H A  L+KF++DV   I
Sbjct: 446 KRVKEMSEKCHVALMDGGSSHTA--LKKFIQDVTKNI 480


>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 1.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1
           (MEKK1) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK1 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates MAPK kinases (MAPKKs or
           MKKs or MAP2Ks), which in turn phosphorylate and
           activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK1 activates the extracellular
           signal-regulated kinase 1/2 (ERK1/2) and c-Jun
           N-terminal kinase (JNK) pathways by activating their
           respective MAPKKs, MEK1/2 and MKK4/MKK7, respectively.
           MEKK1 is important in regulating cell survival and
           apoptosis. MEKK1 also plays a role in cell migration,
           tissue maintenance and homeostasis, and wound healing.
          Length = 268

 Score = 27.5 bits (61), Expect = 5.9
 Identities = 10/26 (38%), Positives = 13/26 (50%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFHAV 51
           +D    CL   P  RP + +LL H V
Sbjct: 241 RDVTLRCLELQPEDRPPSRELLKHPV 266


>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein
           Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2
           and similar domains.  Serine/Threonine Kinases (STKs),
           Chlamydomonas reinhardtii FA2-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Chlamydomonas
           reinhardtii FA2-like subfamily belongs to the
           (NIMA)-related kinase (Nek) family. The Nek family
           includes seven different Chlamydomonas Neks (CNKs 1-6
           and Fa2). This subfamily includes FA2 and CNK4.  The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase.  Chlamydomonas reinhardtii FA2 was discovered
           in a genetic screen for deflagellation-defective
           mutants. It is essential for
           basal-body/centriole-associated microtubule severing,
           and plays a role in cell cycle progression. No cellular
           function has yet been ascribed to CNK4.
          Length = 256

 Score = 27.5 bits (61), Expect = 6.0
 Identities = 9/21 (42%), Positives = 10/21 (47%)

Query: 27  DFIYTCLNQDPNLRPRAGQLL 47
             I  CL +D   RP   QLL
Sbjct: 231 QLIDQCLTKDYRQRPDTFQLL 251


>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ
           cell-Associated Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Male germ
           cell-Associated Kinase (MAK)-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of human MAK and
           MAK-related kinase (MRK), Saccharomyces cerevisiae
           Ime2p, Schizosaccharomyces pombe Mei4-dependent protein
           3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5,
           Arabidopsis thaliana MHK, and similar proteins. These
           proteins play important roles during meiosis. MAK is
           highly expressed in testicular cells specifically in the
           meiotic phase, but is not essential for spermatogenesis
           and fertility. It functions as a coactivator of the
           androgen receptor in prostate cells. MRK, also called
           Intestinal Cell Kinase (ICK), is expressed ubiquitously,
           with highest expression in the ovary and uterus. A
           missense mutation in MRK causes
           endocrine-cerebro-osteodysplasia (ECO), suggesting that
           this protein plays an important role in the development
           of many organs. MAK and MRK may be involved in
           regulating cell cycle and cell fate. Ime2p is a
           meiosis-specific kinase that is important during meiotic
           initiation and during the later stages of meiosis. Mde3
           functions downstream of the transcription factor Mei-4
           which is essential for meiotic prophase I.
          Length = 283

 Score = 27.5 bits (62), Expect = 6.1
 Identities = 11/23 (47%), Positives = 11/23 (47%)

Query: 27  DFIYTCLNQDPNLRPRAGQLLFH 49
           D I   L  DP  RP A Q L H
Sbjct: 258 DLIKDMLRWDPKKRPTASQALQH 280


>gnl|CDD|215329 PLN02610, PLN02610, probable methionyl-tRNA synthetase.
          Length = 801

 Score = 27.4 bits (61), Expect = 6.7
 Identities = 10/16 (62%), Positives = 14/16 (87%), Gaps = 1/16 (6%)

Query: 141 EVENRKVVNMMCNLKP 156
           E++NRKV  ++CNLKP
Sbjct: 689 EMQNRKVC-VLCNLKP 703


>gnl|CDD|216589 pfam01588, tRNA_bind, Putative tRNA binding domain.  This domain is
           found in prokaryotic methionyl-tRNA synthetases,
           prokaryotic phenylalanyl tRNA synthetases the yeast GU4
           nucleic-binding protein (G4p1 or p42, ARC1), human
           tyrosyl-tRNA synthetase, and endothelial-monocyte
           activating polypeptide II. G4p1 binds specifically to
           tRNA form a complex with methionyl-tRNA synthetases. In
           human tyrosyl-tRNA synthetase this domain may direct
           tRNA to the active site of the enzyme. This domain may
           perform a common function in tRNA aminoacylation.
          Length = 95

 Score = 26.0 bits (58), Expect = 8.0
 Identities = 8/21 (38%), Positives = 13/21 (61%), Gaps = 1/21 (4%)

Query: 138 EPFEVENRKVVNMMCNLKPKE 158
            P E+  + VV ++ NLKP +
Sbjct: 41  PPEELVGKLVV-VVANLKPAK 60


>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein
           Kinase, MAP kinase kinase 4.  Protein kinases (PKs), MAP
           kinase kinase 4 (MKK4) subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MKK4 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising of the MAP
           kinase (MAPK), which is phosphorylated and activated by
           a MAPK kinase (MAPKK or MKK), which itself is
           phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). MKK4 is a dual-specificity PK that
           phosphorylates and activates the downstream targets,
           c-Jun N-terminal kinase (JNK) and p38 MAPK, on specific
           threonine and tyrosine residues. JNK and p38 are
           collectively known as stress-activated MAPKs, as they
           are activated in response to a variety of environmental
           stresses and pro-inflammatory cytokines. Their
           activation is associated with the induction of cell
           death. Mice deficient in MKK4 die during embryogenesis
           and display anemia, severe liver hemorrhage, and
           abnormal hepatogenesis. MKK4 may also play roles in the
           immune system and in cardiac hypertrophy. It plays a
           major role in cancer as a tumor and metastasis
           suppressor. Under certain conditions, MKK4 is
           pro-oncogenic.
          Length = 288

 Score = 26.9 bits (60), Expect = 8.8
 Identities = 10/24 (41%), Positives = 15/24 (62%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLLFH 49
            +FI  CL +D + RP+  +LL H
Sbjct: 244 VNFINLCLIKDESKRPKYKELLEH 267


>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 9.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek9 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek9, also called
           Nercc1, is primarily a cytoplasmic protein but can also
           localize in the nucleus. It is involved in modulating
           chromosome alignment and splitting during mitosis. It
           interacts with the gamma-tubulin ring complex and the
           Ran GTPase, and is implicated in microtubule
           organization. Nek9 associates with FACT (FAcilitates
           Chromatin Transcription) and modulates interphase
           progression. It also interacts with Nek6, and Nek7,
           during mitosis, resulting in their activation.
          Length = 256

 Score = 26.6 bits (59), Expect = 9.4
 Identities = 8/22 (36%), Positives = 13/22 (59%)

Query: 26  KDFIYTCLNQDPNLRPRAGQLL 47
              +++ L QDP  RP A ++L
Sbjct: 230 ISLVHSLLQQDPEKRPTADEVL 251


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.318    0.133    0.386 

Gapped
Lambda     K      H
   0.267   0.0818    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 11,198,226
Number of extensions: 1031280
Number of successful extensions: 920
Number of sequences better than 10.0: 1
Number of HSP's gapped: 920
Number of HSP's successfully gapped: 55
Length of query: 226
Length of database: 10,937,602
Length adjustment: 93
Effective length of query: 133
Effective length of database: 6,812,680
Effective search space: 906086440
Effective search space used: 906086440
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 57 (25.6 bits)