Query         psy2364
Match_columns 119
No_of_seqs    39 out of 41
Neff          2.8 
Searched_HMMs 46136
Date          Fri Aug 16 23:05:18 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2364.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2364hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09596 MamL-1:  MamL-1 domain 100.0   9E-37   2E-41  204.8   1.6   61    6-66      1-61  (61)
  2 PF04508 Pox_A_type_inc:  Viral  60.9     5.1 0.00011   22.7   1.1   19   13-31      3-21  (23)
  3 cd04446 DEP_DEPDC4 DEP (Dishev  21.9      86  0.0019   22.5   2.3   51   10-60      2-68  (95)
  4 PF06441 EHN:  Epoxide hydrolas  21.3      77  0.0017   22.8   2.0   20    8-27      7-26  (112)
  5 cd04447 DEP_BRCC3 DEP (Disheve  20.4 1.4E+02  0.0029   21.7   3.1   51   10-60      4-69  (92)
  6 PF11498 Activator_LAG-3:  Tran  16.2 1.1E+02  0.0024   27.8   2.3   44   21-64     46-90  (468)
  7 PRK12423 LexA repressor; Provi  15.8 1.2E+02  0.0026   23.1   2.1   19    5-23      4-22  (202)
  8 PF06945 DUF1289:  Protein of u  13.7      88  0.0019   19.6   0.7   17    5-21     34-50  (51)
  9 COG2333 ComEC Predicted hydrol  13.5      65  0.0014   27.0   0.1   22    7-28    247-269 (293)
 10 KOG3314|consensus               12.3      81  0.0018   25.8   0.3   17   16-33    139-155 (194)

No 1  
>PF09596 MamL-1:  MamL-1 domain;  InterPro: IPR019082 This entry represents the N-terminal domain found in a family of neurogenic mastermind-like proteins (MAMLs), which act as critical transcriptional co-activators for Notch signaling [, ]. Notch receptors are cleaved upon ligand engagement and the intracellular domain of Notch shuttles to the nucleus. MAMLs form a functional DNA-binding complex with the cleaved Notch receptor and the transcription factor CSL, thereby regulating transcriptional events that are specific to the Notch pathway. MAML proteins may also play roles as key transcriptional co-activators in other signal transduction pathways as well, including: muscle differentiation and myopathies (MEF2C) [], tumour suppressor pathway (p53) [] and colon carcinoma survival (beta-catenin) []. MAML proteins could mediate cross-talk among the various signaling pathways and the diverse activities of the MAML proteins converge to impact normal biological processes and human diseases, including cancers. The N-terminal domain of MAML proteins adopt an elongated kinked helix that wraps around ANK and CSL forming one of the complexes in the build-up of the Notch transcriptional complex for recruiting general transcription factors. This N-terminal domain is responsible for its interaction with the ankyrin repeat region of the Notch proteins NOTCH1 [], NOTCH2 [], NOTCH3 [] and NOTCH4. It forms a DNA-binding complex with Notch proteins and RBPSUH/RBP-J kappa/CBF1, and also binds CREBBP/CBP [] and CDK8 []. The C-terminal region is required for transcriptional activation.; GO: 0003713 transcription coactivator activity, 0007219 Notch signaling pathway, 0045944 positive regulation of transcription from RNA polymerase II promoter, 0016607 nuclear speck; PDB: 3NBN_F 2F8X_M 3V79_M.
Probab=100.00  E-value=9e-37  Score=204.82  Aligned_cols=61  Identities=56%  Similarity=0.831  Sum_probs=53.0

Q ss_pred             CCchhHHHHHHHHHHHHhhhhcCCcchhhhhhhhhhHHHHHHHHHHHHHHHhhhhhhhccC
Q psy2364           6 PPKRQAVVDRLRRRIENYRRHQSDCVPRYDHSFNGLVERDIQETLLLKQKYLESKAKRSKN   66 (119)
Q Consensus         6 ~pkhsaVVeRLRrRIE~cRrHh~~Ce~RYeq~~ae~~EqerqeT~~L~QR~le~KaKKs~K   66 (119)
                      ||+|||||||||+|||+||+||+||++||+++++++||+|||+|++|+||||++||||++|
T Consensus         1 P~kh~avveRLRrRIE~~Rrhh~~C~~Rye~~~~~~~E~erq~T~~L~qr~l~~kakr~~k   61 (61)
T PF09596_consen    1 PPKHSAVVERLRRRIELCRRHHNDCESRYEQTQAERCEQERQETLALHQRVLEGKAKRSAK   61 (61)
T ss_dssp             ----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCCCC----
T ss_pred             CcchhHHHHHHHHHHHHHHhhhccchhHHHHHhHHHHHHHHHHHHHHHHHHHHhhcccccC
Confidence            7999999999999999999999999999999999999999999999999999999999886


No 2  
>PF04508 Pox_A_type_inc:  Viral A-type inclusion protein repeat ;  InterPro: IPR007596 The repeat is found in the A-type inclusion protein of the Poxvirus family [].; GO: 0016032 viral reproduction
Probab=60.94  E-value=5.1  Score=22.67  Aligned_cols=19  Identities=42%  Similarity=0.837  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHhhhhcCCcc
Q psy2364          13 VDRLRRRIENYRRHQSDCV   31 (119)
Q Consensus        13 VeRLRrRIE~cRrHh~~Ce   31 (119)
                      |+|||.||..--+--++|.
T Consensus         3 ~~rlr~rI~dLer~L~~C~   21 (23)
T PF04508_consen    3 MNRLRNRISDLERQLSECR   21 (23)
T ss_pred             HHHHHHHHHHHHHHHHHHh
Confidence            7899999987766666653


No 3  
>cd04446 DEP_DEPDC4 DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in DEPDC4-like proteins. DEPDC4 is a DEP domain containing protein of unknown function.
Probab=21.90  E-value=86  Score=22.50  Aligned_cols=51  Identities=18%  Similarity=0.278  Sum_probs=38.4

Q ss_pred             hHHHHHHHHHHHHhhhhc-----CCcchhhhhhhhh-----------hHHHHHHHHHHHHHHHhhhh
Q psy2364          10 QAVVDRLRRRIENYRRHQ-----SDCVPRYDHSFNG-----------LVERDIQETLLLKQKYLESK   60 (119)
Q Consensus        10 saVVeRLRrRIE~cRrHh-----~~Ce~RYeq~~ae-----------~~EqerqeT~~L~QR~le~K   60 (119)
                      +.||+.||..|+.=+|.+     .+|..=.|.+-=.           -++..|++++.|-|.+++.+
T Consensus         2 n~ii~~~r~~v~ikdRr~~lk~y~~CF~GsEaVDwL~~~l~~n~~f~~~~~tR~~Av~l~q~Ll~~g   68 (95)
T cd04446           2 NSIIDALQTQVEVKKRRHNLKSYHDCFLGSEAVDVVLAHLMQNKYFGDVDVPRAKAVRLCQALMDCR   68 (95)
T ss_pred             hHHHHHHHhcCcccceeeeceecccccchHHHHHHHHHHHhhccccCcccCCHHHHHHHHHHHHHcC
Confidence            468999999999876654     6787766665411           23668999999999999764


No 4  
>PF06441 EHN:  Epoxide hydrolase N terminus;  InterPro: IPR010497 This entry represents the N-terminal region of the eukaryotic epoxide hydrolase protein. Epoxide hydrolases (3.3.2.3 from EC) comprise a group of functionally related enzymes that catalyse the addition of water to oxirane compounds (epoxides), thereby usually generating vicinal trans-diols. EHs have been found in all types of living organisms, including mammals, invertebrates, plants, fungi and bacteria. In animals, the major interest in EH is directed towards their detoxification capacity for epoxides since they are important safeguards against the cytotoxic and genotoxic potential of oxirane derivatives that are often reactive electrophiles because of the high tension of the three-membered ring system and the strong polarisation of the C--O bonds. This is of significant relevance because epoxides are frequent intermediary metabolites, which arise during the biotransformation of foreign compounds []. This domain is often found in conjunction with IPR000073 from INTERPRO.; GO: 0004301 epoxide hydrolase activity, 0009636 response to toxin, 0016020 membrane; PDB: 3G0I_B 3G02_A 1QO7_A.
Probab=21.28  E-value=77  Score=22.82  Aligned_cols=20  Identities=25%  Similarity=0.348  Sum_probs=13.1

Q ss_pred             chhHHHHHHHHHHHHhhhhc
Q psy2364           8 KRQAVVDRLRRRIENYRRHQ   27 (119)
Q Consensus         8 khsaVVeRLRrRIE~cRrHh   27 (119)
                      --++.++.|++|++.+|-=.
T Consensus         7 v~~~~l~~l~~rl~~~r~p~   26 (112)
T PF06441_consen    7 VPDEELDDLRQRLRATRLPD   26 (112)
T ss_dssp             --HHHHHHHHHHHHHS----
T ss_pred             CCHHHHHHHHHHHhccCCCC
Confidence            34688999999999999643


No 5  
>cd04447 DEP_BRCC3 DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in BBRC3-like proteins. BBRC3, also known as DEPDC1B, is a DEP containing protein of unknown function.
Probab=20.43  E-value=1.4e+02  Score=21.69  Aligned_cols=51  Identities=22%  Similarity=0.313  Sum_probs=33.1

Q ss_pred             hHHHHHHHHHHHHhhhhc-----CCcchhhhhhhh--hhH--------HHHHHHHHHHHHHHhhhh
Q psy2364          10 QAVVDRLRRRIENYRRHQ-----SDCVPRYDHSFN--GLV--------ERDIQETLLLKQKYLESK   60 (119)
Q Consensus        10 saVVeRLRrRIE~cRrHh-----~~Ce~RYeq~~a--e~~--------EqerqeT~~L~QR~le~K   60 (119)
                      ..||+.||..++.=||++     .+|..==|++-=  +.+        |..|++|+.|.|++|+..
T Consensus         4 n~ii~~~r~g~~vk~rR~~lr~y~~CF~gsEAVDwL~~~l~~n~~fg~~vtR~~av~l~qkll~~h   69 (92)
T cd04447           4 NEVTELFRAGMPLRKHRQHFKSYENCFTASEAVDWLHELLRSNSNFGPEVTRQQTVQLLKKFLKNH   69 (92)
T ss_pred             HHHHHHHHccCChHHHHHhcccCccccchHHHHHHHHHHHHhccccCCCCCHHHHHHHHHHHHHcC
Confidence            468899998888776543     455433222211  111        558999999999988654


No 6  
>PF11498 Activator_LAG-3:  Transcriptional activator LAG-3;  InterPro: IPR021587  The C.elegans Notch pathway, involved in the control of growth, differentiation and patterning in animal development, relies on either of the receptors GLP-1 or LIN-12 []. Both these receptors promote signalling by the recruitment of LAG-3 to target promoters, where it then acts as a transcriptional activator. LAG-3 works as a ternary complex together with the DNA binding protein, LAG-1 []. ; PDB: 2FO1_D.
Probab=16.24  E-value=1.1e+02  Score=27.77  Aligned_cols=44  Identities=18%  Similarity=0.241  Sum_probs=35.2

Q ss_pred             HHhhhhcCCcchhhhhhhhhhHHHHHHHHHHHHHHHhh-hhhhhc
Q psy2364          21 ENYRRHQSDCVPRYDHSFNGLVERDIQETLLLKQKYLE-SKAKRS   64 (119)
Q Consensus        21 E~cRrHh~~Ce~RYeq~~ae~~EqerqeT~~L~QR~le-~KaKKs   64 (119)
                      |++|..-.---.||..+.+|...-+|--|..|.-||-| .+.||.
T Consensus        46 Elhrq~SqlA~e~y~~a~pemi~~~R~vta~Lf~RfTEdeeRKr~   90 (468)
T PF11498_consen   46 ELHRQQSQLAKEKYAIALPEMINAQRAVTAELFTRFTEDEERKRA   90 (468)
T ss_dssp             HHHHHHHHHHHHHHHHSHHHHHHHHHHHHHHTHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHhhHHHHhhhhHHHHHHHHhhchHHHHHHH
Confidence            55666666666899999999999999999999999994 444443


No 7  
>PRK12423 LexA repressor; Provisional
Probab=15.83  E-value=1.2e+02  Score=23.12  Aligned_cols=19  Identities=42%  Similarity=0.672  Sum_probs=17.2

Q ss_pred             CCCchhHHHHHHHHHHHHh
Q psy2364           5 LPPKRQAVVDRLRRRIENY   23 (119)
Q Consensus         5 ~~pkhsaVVeRLRrRIE~c   23 (119)
                      ++|++..|+++|+..|+..
T Consensus         4 lt~~q~~il~~l~~~i~~~   22 (202)
T PRK12423          4 LTPKRAAILAFIRERIAQA   22 (202)
T ss_pred             CCHHHHHHHHHHHHHHHHc
Confidence            6899999999999998865


No 8  
>PF06945 DUF1289:  Protein of unknown function (DUF1289);  InterPro: IPR010710 This family consists of a number of hypothetical bacterial proteins. The aligned region spans around 56 residues and contains 4 highly conserved cysteine residues towards the N terminus. The function of this family is unknown.
Probab=13.74  E-value=88  Score=19.63  Aligned_cols=17  Identities=35%  Similarity=0.511  Sum_probs=13.5

Q ss_pred             CCCchhHHHHHHHHHHH
Q psy2364           5 LPPKRQAVVDRLRRRIE   21 (119)
Q Consensus         5 ~~pkhsaVVeRLRrRIE   21 (119)
                      -+..+++|+.+|+.|..
T Consensus        34 s~~er~~i~~~l~~R~~   50 (51)
T PF06945_consen   34 SDDERRAILARLRARRA   50 (51)
T ss_pred             CHHHHHHHHHHHHHHhc
Confidence            35568999999999864


No 9  
>COG2333 ComEC Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only]
Probab=13.49  E-value=65  Score=26.99  Aligned_cols=22  Identities=41%  Similarity=0.693  Sum_probs=18.2

Q ss_pred             CchhHHHHHHHHH-HHHhhhhcC
Q psy2364           7 PKRQAVVDRLRRR-IENYRRHQS   28 (119)
Q Consensus         7 pkhsaVVeRLRrR-IE~cRrHh~   28 (119)
                      +-|++|++||.++ |..||--++
T Consensus       247 hPh~~Vl~rl~~~~~~v~rTd~~  269 (293)
T COG2333         247 HPHQEVLERLQKRGIKVYRTDQQ  269 (293)
T ss_pred             CCcHHHHHHHHhcCCeEEecCCC
Confidence            4589999999998 888887665


No 10 
>KOG3314|consensus
Probab=12.30  E-value=81  Score=25.81  Aligned_cols=17  Identities=47%  Similarity=0.774  Sum_probs=12.1

Q ss_pred             HHHHHHHhhhhcCCcchh
Q psy2364          16 LRRRIENYRRHQSDCVPR   33 (119)
Q Consensus        16 LRrRIE~cRrHh~~Ce~R   33 (119)
                      +|.=|-+ |+||++|+-|
T Consensus       139 ~r~~~k~-r~hhQeCVkr  155 (194)
T KOG3314|consen  139 LRGFIKL-RGHHQECVKR  155 (194)
T ss_pred             Hhhhccc-chhhHHHHHH
Confidence            4444444 9999999866


Done!