Diaphorina citri psyllid: psy2364


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MTEALPPKRQAVVDRLRRRIENYRRHQSDCVPRYDHSFNGLVERDIQETLLLKQKYLESKAKRSKNKPEKKLPSQLDSGLHNASLPYHKAVSTHIDDIDSMCGHSLEPMRQKVLFCMLK
ccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcc
******P*RQAVVDRLRRRIENYRRHQSDCVPRYDHSFNGLVERDIQETLLLKQK*****************************************D*DSMCGHSLEPMRQKVLFCMLK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTEALPPKRQAVVDRLRRRIENYRRHQSDCVPRYDHSFNGLVERDIQETLLLKQKYLESKAKRSKNKPEKKLPSQLDSGLHNASLPYHKAVSTHIDDIDSMCGHSLEPMRQKVLFCMLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Neurogenic protein mastermind May have a regulatory function possibly in association with the Notch gene product.confidentP21519

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005703 [CC]polytene chromosome puffprobableGO:0005575, GO:0043232, GO:0044464, GO:0005700, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0005623, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F8X, chain M
Confidence level:very confident
Coverage over the Query: 9-63
View the alignment between query and template
View the model in PyMOL