Diaphorina citri psyllid: psy2377

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340
MTIVRTRFAPSPTGNLHIGGIRTALFSWAYARHFNGIFILRIEDTDINRSTLSATQTIIDGMKWLGLNYDEGPFYQTKRINRYFEIINYLLSNDYAYYCYSSVEEIESFRKKQRSFGEKPRYNRIWRPEPGKILPSIPINRKPVIRFKNPLYGNITWNDLIKGKITISNKELDDLVIVRADGIPTYNFCAAIDDWDMKITHVIRGDDHINNTPRQINILKALGVTLPFYGHLPMVIDSNKVKISKRKEATDIMYYKKKGFLPEAILNYLARLGWSHGNEEIFSIKQFCYWFNDCKYLSKSPAQFNLKKLEWLNNFYIKSYDDKKLLNLIQPIIKKKKYRI
ccccEEcccccccccccHHcHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHccccccccccccccHHcccHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEECcccccEEEEEEEEEEEEEEEccccccEEEEcccccccccEEEEEEcccccccEEEcccccccccHHHHHHHHHcccccccEEEccccccccccccccccccccHHHHHHccccHHHHHHHHHHHcccccccccccHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccc
*TIVRTRFAPSPTGNLHIGGIRTALFSWAYARHFNGIFILRIEDTDINRSTLSATQTIIDGMKWLGLNYDEGPFYQTKRINRYFEIINYLLSNDYAYYCYSSVEEIESF***********RYNRIWRPEPGKILPSIPINRKPVIRFKNPLYGNITWNDLIKGKITISNKELDDLVIVRADGIPTYNFCAAIDDWDMKITHVIRGDDHINNTPRQINILKALGVTLPFYGHLPMVIDSNKVKISKRKEATDIMYYKKKGFLPEAILNYLARLGWSHGNEEIFSIKQFCYWFNDCKYLSKSPAQFNLKKLEWLNNFYIKSYDDKKLLNLIQPIIKKKKYRI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIVRTRFAPSPTGNLHIGGIRTALFSWAYARHFNGIFILRIEDTDINRSTLSATQTIIDGMKWLGLNYDEGPFYQTKRINRYFEIINYLLSNDYAYYCYSSVEEIESFRKKQRSFGEKPRYNRIWRPEPGKILPSIPINRKPVIRFKNPLYGNITWNDLIKGKITISNKELDDLVIVRADGIPTYNFCAAIDDWDMKITHVIRGDDHINNTPRQINILKALGVTLPFYGHLPMVIDSNKVKISKRKEATDIMYYKKKGFLPEAILNYLARLGWSHGNEEIFSIKQFCYWFNDCKYLSKSPAQFNLKKLEWLNNFYIKSYDDKKLLNLIQPIIKKKKYRI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutamate--tRNA ligase Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).confidentQ12D45
Glutamate--tRNA ligase Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).confidentA1W9F0
Glutamate--tRNA ligase Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).confidentQ39F07

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0004818 [MF]glutamate-tRNA ligase activityprobableGO:0004812, GO:0003824, GO:0003674, GO:0016874, GO:0016875, GO:0016876
GO:0006424 [BP]glutamyl-tRNA aminoacylationprobableGO:0006139, GO:0019752, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:0034645, GO:0034660, GO:1901360, GO:0044267, GO:0044710, GO:0044260, GO:0006520, GO:0071704, GO:0010467, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0043436, GO:0046483, GO:0016070, GO:0044238, GO:1901564, GO:0006082, GO:0019538, GO:0044237, GO:0043170, GO:0006399, GO:0043038, GO:0043039, GO:0006418, GO:0006412
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0070127 [BP]tRNA aminoacylation for mitochondrial protein translationprobableGO:0006139, GO:0019752, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:1901360, GO:0044281, GO:0034645, GO:0034660, GO:0044699, GO:0044267, GO:0044710, GO:0044260, GO:0071840, GO:0006520, GO:0016043, GO:0071704, GO:0010467, GO:0007005, GO:0032543, GO:0016070, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0044763, GO:0008152, GO:0043436, GO:0046483, GO:0006996, GO:0044238, GO:1901564, GO:0006082, GO:0019538, GO:0044237, GO:0043170, GO:0006399, GO:0043038, GO:0043039, GO:0006418, GO:0008150, GO:0006412
GO:0002097 [BP]tRNA wobble base modificationprobableGO:0009451, GO:0090304, GO:0034641, GO:0006807, GO:0008033, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0006400, GO:0034470, GO:0009987, GO:0006725, GO:0043412, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0044237, GO:0043170, GO:0006399, GO:0006396
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0050561 [MF]glutamate-tRNA(Gln) ligase activityprobableGO:0004812, GO:0003824, GO:0003674, GO:0016874, GO:0016875, GO:0016876

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.1.-.-1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol transaminase.probable
6.1.1.-Ligases forming aminoacyl-tRNA and related compounds.probable
6.1.1.17Glutamate--tRNA ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4G6Z, chain A
Confidence level:very confident
Coverage over the Query: 2-101,121-338
View the alignment between query and template
View the model in PyMOL