Diaphorina citri psyllid: psy2394


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570
MKHLMLSKLEKFSKRLKELDFLLTQKEVHNNIKDYCKKVREHSFLYPIVELYNNYKKINEDIITAKEMLNDLEMRNFALDEINLAKKRIFDIELEIKKLILPKDKNDKRNIFIEIRAGTGGDESALFVNDLLRMYIRFSERNYWKFEIISRSLSEIGGYKEIIARIIGLNVYSKLKFESGVHRVQRVPKTETQGRIHTSACTVAVIPEADEIEDININPADLRIDTYRASGAGGQHINKTDSAVRITHIPTGIVVQCQNDRSQHKNKAFALKILLARIKDSKLREQQSNTAKMRRLLIGSVQKKSPLNIFETNILLKYVTRLSDVELIINNEKKLHKQEINILNKLIQRRILGEPIAYIIGKKEFYGLVLNITSDVLIPRPETELLVDLIVKKTFEKKIKLLEMGTGSGAIAIAIAIYSKNKIEIIATDISKFALKIAKKNAKKKLTKYNIPIKFIKSNWYNNLQNYKKLFNIIVANPPYIPKGDIHLNKGDLRFEPINALTDYSNGLSSIKEIVKNASKYLVKNGLLLIEHGYNQSNLVRKLLFKYGFSDIKSWRDLSGIERVTQGKIS
ccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccEEEEEEEEEEccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccEEEEEEcccccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHcccccccEEEECccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccEEEEEEHHHHHHHHHHHHHHHHHHccccccccEEcccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHcccccccccccccccHHcccccc
***LMLSKLEKFSKRLKELDFLLTQKEVHNNIKDYCKKVREHSFLYPIVELYNNYKKINEDIITAKEMLNDLEMRNFALDEINLAKKRIFDIELEIKKLILPKDKNDKRNIFIEIRAGTGGDESALFVNDLLRMYIRFSERNYWKFEIISRSLSEIGGYKEIIARIIGLNVYSKLKFESGVHRVQRVPKTETQGRIHTSACTVAVIPEADEIEDININPADLRIDTYRASGAGGQHINKTDSAVRITHIPTGIVVQCQNDRSQHKNKAFALKILLARIK**********************QKKSPLNIFETNILLKYVTRLSDVELIINNEKKLHKQEINILNKLIQRRILGEPIAYIIGKKEFYGLVLNITSDVLIPRPETELLVDLIVKKTFEKKIKLLEMGTGSGAIAIAIAIYSKNKIEIIATDISKFALKIAKKNAKKKLTKYNIPIKFIKSNWYNNLQNYKKLFNIIVANPPYIPKGDIHLNKGDLRFEPINALTDYSNGLSSIKEIVKNASKYLVKNGLLLIEHGYNQSNLVRKLLFKYGFSDIKSWRDLSGIERVTQG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKHLMLSKLEKFSKRLKELDFLLTQKEVHNNIKDYCKKVREHSFLYPIVELYNNxxxxxxxxxxxxxxxxxxxxxNFALDEINLAKKRIFDIELEIKKLILPKDKNDKRNIFIEIRAGTGGDESALFVNDLLRMYIRFSERNYWKFEIISRSLSEIGGYKEIIARIIGLNVYSKLKFESGVHRVQRVPKTETQGRIHTSACTVAVIPEADEIEDININPADLRIDTYRASGAGGQHINKTDSAVRITHIPTGIVVQCQNDRSQHKNKAFALKILLARIKDSKLREQQSNTAKMRRLLIGSVQKKSPLNIFETNILLKYVTRLSDVELIINNEKKLHKQEINILNKLIQRRILGEPIAYIIGKKEFYGLVLNITSDVLIPRPETELLVDLIVKKTFEKKIKLLEMGTGSGAIAIAIAIYSKNKIEIIATDISKFALKIAKKNAKKKLTKYNIPIKFIKSNWYNNLQNYKKLFNIIVANPPYIPKGDIHLNKGDLRFEPINALTDYSNGLSSIKEIVKNASKYLVKNGLLLIEHGYNQSNLVRKLLFKYGFSDIKSWRDLSGIERVTQGKIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptide chain release factor 1 Peptide chain release factor 1 directs the termination of translation in response to the peptide chain termination codons UAG and UAA.confidentB2JHK8
Peptide chain release factor 1 Peptide chain release factor 1 directs the termination of translation in response to the peptide chain termination codons UAG and UAA.confidentQ2Y5P3
Peptide chain release factor 1 Peptide chain release factor 1 directs the termination of translation in response to the peptide chain termination codons UAG and UAA.confidentQ7W023

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043022 [MF]ribosome bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B3T, chain B
Confidence level:very confident
Coverage over the Query: 7-69,101-314
View the alignment between query and template
View the model in PyMOL
Template: 2B3T, chain A
Confidence level:very confident
Coverage over the Query: 310-569
View the alignment between query and template
View the model in PyMOL