Diaphorina citri psyllid: psy2399


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MKKHDSEFKDVRRIFVTTALPYANGELHIGHIMEYIQADIWVRFQCMQQDNGKSRQVYFICADDAHGAAIMIAAEKAGMTPKEFINNISSNRKKYLDGFYIKFDNWYSTDSIENIDLVQKIYDTLYNKAKLIINKKINQFFDPIKNIFLPDRYIKGECPICNAKDQYGDFCECCSSIYTPTKLINPYSILSGTKPIIKSSKHFFFKLSDKRCIDFLRKWAIHDKRLQPEIFF
ccccccccccccEEEEEEccccccccccccHHccHHcHHHHHHHHcccccccccccEEEEEccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEEEEcccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEEccEEEEEcccHHHHHHHHHHHHccccccccccc
*********DVRRIFVTTALPYANGELHIGHIMEYIQADIWVRFQCMQQDNGKSRQVYFICADDAHGAAIMIAAEKAGMTPKEFINNISSNRKKYLDGFYIKFDNWYSTDSIENIDLVQKIYDTLYNKAKLIINKKINQFFDPIKNIFLPDRYIKGECPICNAKDQYGDFCECCSSIYTPTKLINPYSILSGTKPIIKSSKHFFFKLSDKRCIDFLRKWAIHDKRLQPEIFF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKHDSEFKDVRRIFVTTALPYANGELHIGHIMEYIQADIWVRFQCMQQDNGKSRQVYFICADDAHGAAIMIAAEKAGMTPKEFINNISSNRKKYLDGFYIKFDNWYSTDSIENIDLVQKIYDTLYNKAKLIINKKINQFFDPIKNIFLPDRYIKGECPICNAKDQYGDFCECCSSIYTPTKLINPYSILSGTKPIIKSSKHFFFKLSDKRCIDFLRKWAIHDKRLQPEIFF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Methionine--tRNA ligase Is required not only for elongation of protein synthesis but also for the initiation of all mRNA translation through initiator tRNA(fMet) aminoacylation.confidentB9MEX0
Methionine--tRNA ligase Is required not only for elongation of protein synthesis but also for the initiation of all mRNA translation through initiator tRNA(fMet) aminoacylation.confidentA1WBH1
Methionine--tRNA ligase Is required not only for elongation of protein synthesis but also for the initiation of all mRNA translation through initiator tRNA(fMet) aminoacylation.confidentQ63W90

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H99, chain A
Confidence level:very confident
Coverage over the Query: 11-229
View the alignment between query and template
View the model in PyMOL