Query         psy2414
Match_columns 114
No_of_seqs    111 out of 1119
Neff          10.0
Searched_HMMs 46136
Date          Sat Aug 17 00:22:37 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2414.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2414hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 2.1E-23 4.6E-28  135.4   1.8   94   16-112   160-264 (279)
  2 KOG2462|consensus               99.8 4.3E-20 9.4E-25  120.1   1.8   94   16-113   129-237 (279)
  3 KOG3623|consensus               99.4 2.2E-14 4.7E-19  103.9   0.7   78   32-112   890-971 (1007)
  4 KOG3623|consensus               99.3 1.6E-13 3.4E-18   99.6  -1.0   64   18-81    895-971 (1007)
  5 KOG3608|consensus               99.2 8.3E-13 1.8E-17   89.2  -0.8   95   15-112   205-313 (467)
  6 KOG3576|consensus               99.2 6.6E-13 1.4E-17   83.7  -2.6   75   34-111   115-193 (267)
  7 KOG3576|consensus               99.2 1.1E-12 2.4E-17   82.7  -2.8   97   15-111   115-232 (267)
  8 KOG1074|consensus               99.1 3.5E-11 7.5E-16   88.6   1.6   77   35-113   604-690 (958)
  9 KOG3608|consensus               99.1 4.5E-11 9.7E-16   81.0   1.8   96   17-112   263-373 (467)
 10 PHA02768 hypothetical protein;  98.9 7.3E-10 1.6E-14   56.2   2.8   44   60-108     5-48  (55)
 11 PHA00733 hypothetical protein   98.9 8.6E-10 1.9E-14   66.0   3.4   73   34-112    38-120 (128)
 12 PHA00733 hypothetical protein   98.8   1E-09 2.2E-14   65.7  -0.5   79    6-85     29-124 (128)
 13 PLN03086 PRLI-interacting fact  98.7 4.3E-08 9.3E-13   71.0   5.1   95    3-103   440-553 (567)
 14 PHA02768 hypothetical protein;  98.6 1.3E-08 2.8E-13   51.7   1.4   41   36-77      5-48  (55)
 15 PHA00732 hypothetical protein   98.6 5.2E-08 1.1E-12   53.6   2.8   45   60-112     1-45  (79)
 16 KOG1074|consensus               98.5 4.9E-08 1.1E-12   72.5   1.6   50   60-112   353-402 (958)
 17 PLN03086 PRLI-interacting fact  98.4 2.9E-07 6.3E-12   66.8   3.7   88   18-112   434-535 (567)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.3 5.2E-07 1.1E-11   39.2   2.1   26   75-103     1-26  (26)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.1   1E-06 2.2E-11   38.3   1.0   21   52-72      5-26  (26)
 20 PHA00616 hypothetical protein   98.0 3.1E-06 6.8E-11   41.0   1.8   29   60-89      1-29  (44)
 21 PF00096 zf-C2H2:  Zinc finger,  97.9 6.9E-06 1.5E-10   34.4   1.7   22   61-82      1-22  (23)
 22 PF13894 zf-C2H2_4:  C2H2-type   97.8 2.1E-05 4.6E-10   32.9   2.2   24   61-84      1-24  (24)
 23 PHA00732 hypothetical protein   97.7 2.7E-05 5.9E-10   42.8   1.9   42   36-82      1-46  (79)
 24 PHA00616 hypothetical protein   97.7 1.4E-05   3E-10   38.8   0.7   30   36-65      1-34  (44)
 25 PF05605 zf-Di19:  Drought indu  97.6 1.6E-05 3.4E-10   40.6   0.6   47   61-111     3-49  (54)
 26 PF13912 zf-C2H2_6:  C2H2-type   97.6   2E-05 4.4E-10   34.2   0.7   25   60-84      1-25  (27)
 27 PF05605 zf-Di19:  Drought indu  97.4 0.00032 6.9E-09   35.7   3.3   47   36-84      2-53  (54)
 28 smart00355 ZnF_C2H2 zinc finge  97.1 0.00072 1.6E-08   28.3   2.7   22   61-82      1-22  (26)
 29 KOG3993|consensus               97.1 0.00028 6.2E-09   49.6   1.8   28   60-87    356-383 (500)
 30 PF13909 zf-H2C2_5:  C2H2-type   96.9  0.0012 2.7E-08   27.6   2.2   24   61-85      1-24  (24)
 31 PF00096 zf-C2H2:  Zinc finger,  96.6  0.0016 3.4E-08   26.9   1.5   20   37-56      1-23  (23)
 32 PF09237 GAGA:  GAGA factor;  I  96.5  0.0034 7.4E-08   31.3   2.4   26   60-85     24-49  (54)
 33 PF12874 zf-met:  Zinc-finger o  96.4  0.0015 3.2E-08   27.6   0.8   22   61-82      1-22  (25)
 34 PF12756 zf-C2H2_2:  C2H2 type   96.4 9.3E-05   2E-09   41.9  -4.1   68   38-112     1-71  (100)
 35 PRK04860 hypothetical protein;  95.8  0.0071 1.5E-07   37.7   2.2   40   60-106   119-158 (160)
 36 PRK04860 hypothetical protein;  95.8  0.0085 1.8E-07   37.3   2.4   38   35-73    118-156 (160)
 37 COG5189 SFP1 Putative transcri  95.7  0.0072 1.6E-07   41.4   2.0   50   60-111   349-418 (423)
 38 PF13913 zf-C2HC_2:  zinc-finge  95.6   0.017 3.6E-07   24.5   2.2   20   61-81      3-22  (25)
 39 PF12171 zf-C2H2_jaz:  Zinc-fin  95.5  0.0034 7.3E-08   27.1  -0.1   21   61-81      2-22  (27)
 40 KOG3993|consensus               95.5  0.0014   3E-08   46.3  -2.1   47   61-112   268-316 (500)
 41 COG5189 SFP1 Putative transcri  95.2  0.0064 1.4E-07   41.6   0.4   49   33-81    346-419 (423)
 42 smart00451 ZnF_U1 U1-like zinc  94.4   0.032   7E-07   25.3   1.6   22   60-81      3-24  (35)
 43 PF12756 zf-C2H2_2:  C2H2 type   92.3    0.14   3E-06   28.6   2.3   24   60-83     50-73  (100)
 44 PF09538 FYDLN_acid:  Protein o  92.0    0.11 2.5E-06   30.2   1.7   30   18-49     10-39  (108)
 45 KOG2893|consensus               90.6    0.13 2.7E-06   34.2   1.0   11   60-70     34-44  (341)
 46 PF09986 DUF2225:  Uncharacteri  88.5    0.33 7.1E-06   31.7   1.8   16   16-31      4-19  (214)
 47 PF13719 zinc_ribbon_5:  zinc-r  88.4    0.39 8.4E-06   22.3   1.5   29   18-46      3-35  (37)
 48 PRK00398 rpoP DNA-directed RNA  87.7    0.42 9.1E-06   23.2   1.5   28   18-46      4-31  (46)
 49 cd00350 rubredoxin_like Rubred  87.3    0.43 9.3E-06   21.5   1.3   23   18-43      2-24  (33)
 50 PF13717 zinc_ribbon_4:  zinc-r  86.7    0.59 1.3E-05   21.5   1.6   11   19-29      4-14  (36)
 51 COG1592 Rubrerythrin [Energy p  85.8    0.57 1.2E-05   29.4   1.7    8   60-67    149-156 (166)
 52 TIGR02300 FYDLN_acid conserved  85.5    0.65 1.4E-05   27.8   1.7   29   19-49     11-39  (129)
 53 COG4049 Uncharacterized protei  85.5    0.52 1.1E-05   24.0   1.1   29   57-85     13-42  (65)
 54 COG5048 FOG: Zn-finger [Genera  84.6    0.53 1.1E-05   32.9   1.3   51   60-112   289-344 (467)
 55 KOG2186|consensus               84.4    0.45 9.7E-06   31.8   0.8   44   37-81      4-49  (276)
 56 COG2888 Predicted Zn-ribbon RN  83.8       2 4.4E-05   22.2   2.8   27   19-46     11-37  (61)
 57 COG1997 RPL43A Ribosomal prote  83.5    0.88 1.9E-05   25.4   1.6   28   18-46     36-63  (89)
 58 cd00729 rubredoxin_SM Rubredox  83.0    0.76 1.6E-05   20.9   1.0   10   18-27      3-12  (34)
 59 TIGR02098 MJ0042_CXXC MJ0042 f  82.6     0.8 1.7E-05   21.1   1.1    9   19-27      4-12  (38)
 60 COG1198 PriA Primosomal protei  81.4    0.92   2E-05   35.0   1.5   44   16-69    434-484 (730)
 61 PF09723 Zn-ribbon_8:  Zinc rib  80.5    0.61 1.3E-05   22.2   0.2    9   60-68     26-34  (42)
 62 smart00659 RPOLCX RNA polymera  80.3     1.5 3.3E-05   21.2   1.6   24   18-43      3-26  (44)
 63 smart00834 CxxC_CXXC_SSSS Puta  80.2    0.71 1.5E-05   21.5   0.4   10   19-28      7-16  (41)
 64 PF14353 CpXC:  CpXC protein     79.5     1.1 2.3E-05   26.7   1.1   14   18-31      2-15  (128)
 65 smart00734 ZnF_Rad18 Rad18-lik  78.7     2.9 6.4E-05   17.7   2.1   20   61-81      2-21  (26)
 66 PRK00464 nrdR transcriptional   78.5     1.2 2.5E-05   27.7   1.1   14   36-49     28-41  (154)
 67 TIGR02605 CxxC_CxxC_SSSS putat  77.1       1 2.3E-05   22.2   0.5   10   37-46      6-15  (52)
 68 PF04959 ARS2:  Arsenite-resist  76.4     2.1 4.6E-05   28.1   1.9   26   60-85     77-102 (214)
 69 smart00614 ZnF_BED BED zinc fi  76.1     3.2 6.9E-05   20.4   2.1   22   61-82     19-45  (50)
 70 PF10571 UPF0547:  Uncharacteri  76.0     2.4 5.1E-05   18.1   1.4    6   39-44     17-22  (26)
 71 PHA00626 hypothetical protein   75.3     2.8   6E-05   21.4   1.7   12   61-72     24-35  (59)
 72 KOG2186|consensus               75.1       2 4.4E-05   28.8   1.6   42   17-58      3-53  (276)
 73 PF04810 zf-Sec23_Sec24:  Sec23  75.1     3.6 7.9E-05   19.3   2.1   28   18-45      3-33  (40)
 74 PF02892 zf-BED:  BED zinc fing  73.5     2.5 5.4E-05   20.1   1.3   22   60-81     16-41  (45)
 75 COG3357 Predicted transcriptio  73.4     2.6 5.6E-05   23.8   1.5   27   17-44     58-84  (97)
 76 smart00661 RPOL9 RNA polymeras  72.5     4.9 0.00011   19.6   2.3   27   20-46      3-30  (52)
 77 KOG1146|consensus               70.6    0.57 1.2E-05   38.1  -2.0   53   60-112   465-539 (1406)
 78 PF12013 DUF3505:  Protein of u  70.4     4.6 9.9E-05   23.3   2.2   25   61-85     81-109 (109)
 79 COG1996 RPC10 DNA-directed RNA  69.5     2.9 6.3E-05   20.8   1.0   25   18-43      7-31  (49)
 80 KOG1146|consensus               69.0     4.1 8.8E-05   33.6   2.2   48   34-81    463-539 (1406)
 81 PF11781 RRN7:  RNA polymerase   68.8     3.4 7.4E-05   19.0   1.1   27   16-44      7-33  (36)
 82 PF03604 DNA_RNApol_7kD:  DNA d  68.7       4 8.7E-05   18.3   1.3    8   60-67     17-24  (32)
 83 TIGR00622 ssl1 transcription f  65.7     7.8 0.00017   22.8   2.4   18   92-109    82-99  (112)
 84 PRK14890 putative Zn-ribbon RN  65.0      18 0.00039   18.7   3.7   10   36-45     25-34  (59)
 85 smart00531 TFIIE Transcription  63.8     1.7 3.8E-05   26.6  -0.5   39   33-72     96-135 (147)
 86 PF05191 ADK_lid:  Adenylate ki  63.4       3 6.5E-05   19.2   0.4   25   20-44      4-29  (36)
 87 PF01927 Mut7-C:  Mut7-C RNAse   63.3     5.6 0.00012   24.3   1.7   13   61-73    125-137 (147)
 88 PTZ00255 60S ribosomal protein  62.0     4.8  0.0001   22.7   1.1   29   17-46     36-64  (90)
 89 PF11238 DUF3039:  Protein of u  60.3     3.9 8.4E-05   21.0   0.5   27   20-46     28-54  (58)
 90 TIGR00595 priA primosomal prot  59.8      11 0.00025   27.9   3.0    9   60-68    253-261 (505)
 91 PF08274 PhnA_Zn_Ribbon:  PhnA   59.2     4.3 9.3E-05   17.9   0.5   24   19-44      4-27  (30)
 92 PF01286 XPA_N:  XPA protein N-  58.9     6.3 0.00014   18.0   1.0   13   19-31      5-17  (34)
 93 PF01363 FYVE:  FYVE zinc finge  58.0       7 0.00015   20.4   1.3   29   17-48      9-37  (69)
 94 TIGR00280 L37a ribosomal prote  57.7     4.9 0.00011   22.7   0.6   28   18-46     36-63  (91)
 95 KOG3214|consensus               57.6     1.9 4.2E-05   24.7  -1.0   22   92-113    48-70  (109)
 96 PRK09678 DNA-binding transcrip  57.3     4.2 9.2E-05   21.9   0.3    7   19-25      3-9   (72)
 97 PF11494 Ta0938:  Ta0938;  Inte  56.5     9.8 0.00021   21.7   1.7   34   16-49     13-50  (105)
 98 KOG4173|consensus               56.3     1.9   4E-05   28.2  -1.3   51   61-111   107-166 (253)
 99 KOG4167|consensus               55.9     2.6 5.6E-05   32.6  -0.8   26   60-85    792-817 (907)
100 PF14803 Nudix_N_2:  Nudix N-te  55.8     4.3 9.2E-05   18.5   0.2   25   20-44      3-30  (34)
101 PRK06266 transcription initiat  55.5     2.4 5.2E-05   27.0  -1.0   33   34-72    115-148 (178)
102 PRK14873 primosome assembly pr  55.1      12 0.00027   28.8   2.5   10   60-69    422-431 (665)
103 COG4530 Uncharacterized protei  55.0     8.1 0.00017   22.6   1.2   28   20-49     12-39  (129)
104 PF07754 DUF1610:  Domain of un  54.5      17 0.00037   15.1   1.9    7   37-43     17-23  (24)
105 cd00065 FYVE FYVE domain; Zinc  53.6      11 0.00024   18.7   1.5   26   19-47      4-29  (57)
106 PRK00432 30S ribosomal protein  53.5      13 0.00029   18.4   1.7   25   19-45     22-46  (50)
107 COG1571 Predicted DNA-binding   53.4     9.9 0.00021   27.6   1.7   30   19-50    352-381 (421)
108 PF09845 DUF2072:  Zn-ribbon co  52.7     7.3 0.00016   23.5   0.9   26   18-44      2-27  (131)
109 PF08271 TF_Zn_Ribbon:  TFIIB z  52.6     5.3 0.00011   18.9   0.2   27   19-45      2-28  (43)
110 PRK00564 hypA hydrogenase nick  52.4      11 0.00023   22.3   1.5   26   16-44     70-96  (117)
111 PRK03976 rpl37ae 50S ribosomal  51.9     6.6 0.00014   22.2   0.5   28   18-46     37-64  (90)
112 COG0068 HypF Hydrogenase matur  51.5     7.8 0.00017   30.0   1.0   14   16-29    122-135 (750)
113 TIGR00373 conserved hypothetic  50.8       3 6.5E-05   25.9  -1.0   34   33-71    106-139 (158)
114 PRK03681 hypA hydrogenase nick  50.5      10 0.00022   22.3   1.2   25   18-44     71-95  (114)
115 cd00730 rubredoxin Rubredoxin;  49.6      13 0.00028   18.4   1.4    8   60-67     34-41  (50)
116 TIGR00686 phnA alkylphosphonat  49.2      12 0.00027   21.8   1.4   29   19-49      4-32  (109)
117 KOG2593|consensus               49.1      10 0.00023   27.5   1.3   14   36-49    128-141 (436)
118 CHL00174 accD acetyl-CoA carbo  48.7     5.9 0.00013   27.4   0.0   34   17-50     38-71  (296)
119 KOG2231|consensus               48.4     7.9 0.00017   29.8   0.7   12   18-29    100-111 (669)
120 KOG2041|consensus               48.2      11 0.00024   29.6   1.3   80    2-99   1102-1182(1189)
121 PF05443 ROS_MUCR:  ROS/MUCR tr  48.2      12 0.00027   22.6   1.4   24   35-58     71-94  (132)
122 PF07282 OrfB_Zn_ribbon:  Putat  48.0      17 0.00037   18.8   1.8   25   20-45     31-55  (69)
123 PF04780 DUF629:  Protein of un  47.6      19 0.00041   26.6   2.4   30   60-89     57-86  (466)
124 PRK03564 formate dehydrogenase  47.4      19 0.00041   25.1   2.3   42   17-68    187-234 (309)
125 PF14446 Prok-RING_1:  Prokaryo  47.1      18 0.00039   18.3   1.6   27   17-46      5-31  (54)
126 TIGR01562 FdhE formate dehydro  46.8      19 0.00041   25.0   2.3   43   17-69    184-233 (305)
127 PF15135 UPF0515:  Uncharacteri  46.6      19 0.00041   24.4   2.1   32   16-47    131-166 (278)
128 PRK03824 hypA hydrogenase nick  46.5      11 0.00024   22.8   1.0    9   60-68    107-115 (135)
129 PF01780 Ribosomal_L37ae:  Ribo  46.5     5.1 0.00011   22.6  -0.4   28   18-46     36-63  (90)
130 PRK10220 hypothetical protein;  46.5      19  0.0004   21.1   1.8   29   19-49      5-33  (111)
131 COG1656 Uncharacterized conser  46.4      16 0.00034   23.0   1.7   18   61-78    131-148 (165)
132 PF00301 Rubredoxin:  Rubredoxi  45.7     9.6 0.00021   18.7   0.5   13   37-49      2-14  (47)
133 PRK12380 hydrogenase nickel in  45.3      12 0.00027   21.8   1.0   24   17-43     70-93  (113)
134 COG5236 Uncharacterized conser  45.1      17 0.00036   25.9   1.7   34   60-100   220-253 (493)
135 KOG2893|consensus               44.9     6.1 0.00013   26.5  -0.3   42   63-111    13-54  (341)
136 PRK05580 primosome assembly pr  44.5      28 0.00062   26.9   3.1   10   60-69    421-430 (679)
137 COG1773 Rubredoxin [Energy pro  44.4      17 0.00037   18.5   1.3    8   60-67     36-43  (55)
138 PF15269 zf-C2H2_7:  Zinc-finge  44.4      25 0.00053   17.1   1.8   23   60-82     20-42  (54)
139 PRK01343 zinc-binding protein;  44.0      28 0.00061   17.8   2.1   17   13-29      5-21  (57)
140 TIGR01206 lysW lysine biosynth  43.9      23 0.00049   17.9   1.7   27   19-45      4-31  (54)
141 PRK12496 hypothetical protein;  43.7      22 0.00047   22.3   2.0   24   19-45    129-152 (164)
142 TIGR00100 hypA hydrogenase nic  42.3      15 0.00032   21.6   1.0   24   18-44     71-94  (115)
143 KOG2482|consensus               41.4      17 0.00036   25.8   1.3   23   60-82    195-217 (423)
144 PF13878 zf-C2H2_3:  zinc-finge  41.1      18 0.00039   17.0   1.0   12   38-49     15-26  (41)
145 TIGR00515 accD acetyl-CoA carb  40.1     5.6 0.00012   27.3  -1.1   34   17-50     26-59  (285)
146 smart00154 ZnF_AN1 AN1-like Zi  40.1      15 0.00033   17.1   0.7   14   60-73     12-25  (39)
147 PF08394 Arc_trans_TRASH:  Arch  39.8     9.1  0.0002   17.8  -0.1   10   20-29      1-10  (37)
148 PF04216 FdhE:  Protein involve  39.0     6.4 0.00014   26.9  -1.0   42   18-69    173-220 (290)
149 COG1379 PHP family phosphoeste  38.6      15 0.00032   26.0   0.7   28   19-46    248-275 (403)
150 smart00064 FYVE Protein presen  38.4      24 0.00053   18.2   1.4   26   19-47     12-37  (68)
151 PF12907 zf-met2:  Zinc-binding  37.8      21 0.00045   16.9   1.0   26   61-86      2-30  (40)
152 KOG1842|consensus               37.8      21 0.00046   26.2   1.4   14   36-49     15-28  (505)
153 PF07649 C1_3:  C1-like domain;  37.7      24 0.00051   15.1   1.1   23   19-45      2-24  (30)
154 PF14369 zf-RING_3:  zinc-finge  37.6      28  0.0006   15.8   1.4    8   39-46     24-31  (35)
155 PRK05654 acetyl-CoA carboxylas  37.5     6.3 0.00014   27.2  -1.2   32   18-49     28-59  (292)
156 PF07975 C1_4:  TFIIH C1-like d  37.3      13 0.00029   18.5   0.3   14   35-48     20-33  (51)
157 PF01155 HypA:  Hydrogenase exp  37.0     5.9 0.00013   23.2  -1.2   24   18-44     71-94  (113)
158 COG3091 SprT Zn-dependent meta  36.5      19  0.0004   22.5   0.9   33   60-100   117-149 (156)
159 COG5048 FOG: Zn-finger [Genera  36.1      24 0.00053   24.5   1.5   52   34-85     31-88  (467)
160 COG3677 Transposase and inacti  35.8      24 0.00052   21.2   1.3   32   18-49     31-66  (129)
161 PF12760 Zn_Tnp_IS1595:  Transp  35.7      31 0.00067   16.5   1.5   10   34-43     35-44  (46)
162 PF00130 C1_1:  Phorbol esters/  35.7      44 0.00096   16.1   2.1   29   16-46     10-38  (53)
163 PF03811 Zn_Tnp_IS1:  InsA N-te  35.6      39 0.00085   15.5   1.7    9   18-26      6-14  (36)
164 PF03107 C1_2:  C1 domain;  Int  34.8      39 0.00085   14.5   1.6   21   19-43      2-22  (30)
165 PF05290 Baculo_IE-1:  Baculovi  34.3      29 0.00062   21.2   1.4   54   16-74     79-135 (140)
166 PF06689 zf-C4_ClpX:  ClpX C4-t  34.0      13 0.00029   17.4  -0.0   25   19-43      3-31  (41)
167 cd02342 ZZ_UBA_plant Zinc fing  33.9      42 0.00092   16.1   1.7   20   19-42      2-21  (43)
168 cd02335 ZZ_ADA2 Zinc finger, Z  33.8      48   0.001   16.1   2.0   21   19-43      2-22  (49)
169 PF00628 PHD:  PHD-finger;  Int  33.3      58  0.0013   15.5   2.3   24   20-47      2-25  (51)
170 PRK00762 hypA hydrogenase nick  33.0      28  0.0006   20.7   1.2   11   18-29     71-81  (124)
171 PF13824 zf-Mss51:  Zinc-finger  32.9      63  0.0014   16.5   2.3   17   33-49     11-27  (55)
172 PLN02294 cytochrome c oxidase   32.3      15 0.00033   23.3   0.0   21   52-72    133-153 (174)
173 COG4647 AcxC Acetone carboxyla  31.9      13 0.00028   22.5  -0.3   16   15-31     68-83  (165)
174 PF10263 SprT-like:  SprT-like   31.8      26 0.00057   21.3   1.0   11   36-46    123-133 (157)
175 TIGR00416 sms DNA repair prote  30.9      43 0.00094   24.6   2.1   25   15-44      5-29  (454)
176 TIGR01053 LSD1 zinc finger dom  30.9      58  0.0013   14.4   1.9   24   19-43      3-26  (31)
177 KOG2907|consensus               30.7      42 0.00091   19.8   1.6   42   60-104    74-115 (116)
178 COG1327 Predicted transcriptio  30.7      29 0.00064   21.6   1.1   11   37-47     29-39  (156)
179 PRK12722 transcriptional activ  30.0      44 0.00096   21.6   1.8    8   60-67    154-161 (187)
180 PRK11823 DNA repair protein Ra  29.8      47   0.001   24.3   2.2   25   15-44      5-29  (446)
181 PF06170 DUF983:  Protein of un  29.8      50  0.0011   18.4   1.8   23   14-36      5-27  (86)
182 COG4640 Predicted membrane pro  29.7      41 0.00089   24.5   1.8   13   61-73     16-28  (465)
183 TIGR00244 transcriptional regu  29.4      30 0.00066   21.4   1.0   12   37-48     29-40  (147)
184 PRK00420 hypothetical protein;  29.3      55  0.0012   19.3   2.0   28   18-47     24-51  (112)
185 PF04606 Ogr_Delta:  Ogr/Delta-  29.2      13 0.00028   18.0  -0.5    6   97-102    33-38  (47)
186 cd00924 Cyt_c_Oxidase_Vb Cytoc  29.0      17 0.00037   20.8  -0.1   21   52-72     71-91  (97)
187 COG1779 C4-type Zn-finger prot  28.9      17 0.00037   23.6  -0.2   30   17-46     14-53  (201)
188 KOG2071|consensus               28.8      42  0.0009   25.6   1.7   23   60-82    418-440 (579)
189 KOG2785|consensus               28.5      20 0.00044   25.7   0.1   21   92-112   218-241 (390)
190 PRK12860 transcriptional activ  28.2      50  0.0011   21.4   1.8   10   19-28    136-145 (189)
191 cd02339 ZZ_Mind_bomb Zinc fing  27.3      74  0.0016   15.3   2.0   21   19-43      2-22  (45)
192 smart00290 ZnF_UBP Ubiquitin C  27.1      74  0.0016   15.1   2.0   13   36-48     11-23  (50)
193 PF00569 ZZ:  Zinc finger, ZZ t  27.1      49  0.0011   15.8   1.3   24   16-43      3-26  (46)
194 COG4306 Uncharacterized protei  27.0      46   0.001   20.1   1.4   11   19-29     70-80  (160)
195 PRK04351 hypothetical protein;  26.9      47   0.001   20.5   1.5   32   36-71    112-143 (149)
196 PF02150 RNA_POL_M_15KD:  RNA p  26.6      16 0.00035   16.6  -0.4    6   38-43     22-27  (35)
197 TIGR00270 conserved hypothetic  26.5      33 0.00071   21.3   0.8   25   19-43      2-31  (154)
198 PF13451 zf-trcl:  Probable zin  26.4      35 0.00076   16.9   0.7   18   34-51      2-19  (49)
199 PF01428 zf-AN1:  AN1-like Zinc  26.2      30 0.00066   16.3   0.5   14   35-48     12-25  (43)
200 KOG3408|consensus               25.9      39 0.00084   20.2   1.0   22   60-81     57-78  (129)
201 PF06827 zf-FPG_IleRS:  Zinc fi  25.1      18  0.0004   15.5  -0.4   24   19-42      3-27  (30)
202 cd02344 ZZ_HERC2 Zinc finger,   25.0      87  0.0019   15.1   2.0   21   19-43      2-22  (45)
203 cd02337 ZZ_CBP Zinc finger, ZZ  25.0      80  0.0017   14.8   1.8   19   19-43      2-20  (41)
204 PF06397 Desulfoferrod_N:  Desu  25.0      36 0.00077   15.7   0.6   12   35-46      5-16  (36)
205 KOG0717|consensus               24.9      44 0.00095   24.8   1.3   22   61-82    293-314 (508)
206 COG3024 Uncharacterized protei  24.8      63  0.0014   17.0   1.5   27   16-42      6-33  (65)
207 smart00731 SprT SprT homologue  24.7      67  0.0014   19.5   1.9   32   36-70    112-143 (146)
208 PF08790 zf-LYAR:  LYAR-type C2  24.6      50  0.0011   14.3   0.9    9   38-46      2-10  (28)
209 PF04423 Rad50_zn_hook:  Rad50   24.5      26 0.00057   17.3   0.1   10   93-102    22-31  (54)
210 PF13248 zf-ribbon_3:  zinc-rib  24.3      61  0.0013   13.4   1.2    7   19-25      4-10  (26)
211 COG4332 Uncharacterized protei  24.1      59  0.0013   21.0   1.6   33   15-47     15-60  (203)
212 TIGR03831 YgiT_finger YgiT-typ  23.8      36 0.00078   15.7   0.5   13   16-28     31-43  (46)
213 PRK06424 transcription factor;  23.2      30 0.00064   21.3   0.2   25   19-43      2-30  (144)
214 KOG0782|consensus               23.2      20 0.00043   27.4  -0.7   32   19-50    255-290 (1004)
215 PF10013 DUF2256:  Uncharacteri  22.4      48   0.001   15.9   0.7   12   18-29      9-20  (42)
216 PF06524 NOA36:  NOA36 protein;  22.2 1.2E+02  0.0027   20.8   2.9   81   32-112   138-230 (314)
217 PF14311 DUF4379:  Domain of un  22.0      50  0.0011   16.3   0.8   13   36-48     28-40  (55)
218 cd00029 C1 Protein kinase C co  21.9      74  0.0016   14.8   1.4   26   18-45     12-37  (50)
219 smart00249 PHD PHD zinc finger  21.7      97  0.0021   13.8   2.0   12   35-46     13-24  (47)
220 PF05180 zf-DNL:  DNL zinc fing  21.5      18 0.00039   19.1  -0.9   33   37-69      5-38  (66)
221 smart00109 C1 Protein kinase C  21.4      80  0.0017   14.5   1.5   26   17-45     11-36  (49)
222 COG4888 Uncharacterized Zn rib  21.2      72  0.0016   18.4   1.4   13   15-27     20-32  (104)
223 cd02249 ZZ Zinc finger, ZZ typ  21.1 1.1E+02  0.0023   14.5   1.9   20   19-43      2-21  (46)
224 cd02341 ZZ_ZZZ3 Zinc finger, Z  21.0   1E+02  0.0022   15.0   1.8    7   19-25      2-8   (48)
225 smart00440 ZnF_C2C2 C2C2 Zinc   21.0      51  0.0011   15.3   0.7   15   13-27     24-38  (40)
226 PF08209 Sgf11:  Sgf11 (transcr  20.4      72  0.0016   14.3   1.1   11   37-47      5-15  (33)
227 COG4957 Predicted transcriptio  20.1      49  0.0011   20.3   0.6   22   37-58     77-98  (148)
228 COG3364 Zn-ribbon containing p  20.0      52  0.0011   19.1   0.7   15   60-74      2-16  (112)

No 1  
>KOG2462|consensus
Probab=99.87  E-value=2.1e-23  Score=135.44  Aligned_cols=94  Identities=17%  Similarity=0.293  Sum_probs=82.0

Q ss_pred             CccccCCCCCCCCCCC-------CCCCceecccccccccChhh---HHhhhcCC-CccCCCCcCcccChhHHHHHHHHHh
Q psy2414          16 PFITRNNTDSIFYPDP-------ASPGMYKCVICLKSVRSRWH---HLQTHFSR-NHKCPYCESVYSRVDTLKLHAKRVH   84 (114)
Q Consensus        16 ~~~~c~~c~~~f~~~~-------~~~~~~~C~~C~~~f~~~~~---h~~~h~~~-~~~c~~C~~~f~~~~~l~~H~~~~~   84 (114)
                      +...|+.|||++.+..       +..-+++|..||+.|...|-   |+|+|+|| ||.|..|+++|.+.+||+.||++ |
T Consensus       160 ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQT-H  238 (279)
T KOG2462|consen  160 KAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQT-H  238 (279)
T ss_pred             ccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHh-h
Confidence            4456777777776654       56678999999999998886   99999999 99999999999999999999998 6


Q ss_pred             CCCCCCccccCCCCCccCCCCCCCCCCC
Q psy2414          85 GLGISRYIHGLIPQLLFPTPHAKTSPVD  112 (114)
Q Consensus        85 ~~~~~~~~~c~~c~~~f~~~~~L~~h~~  112 (114)
                      .+.++  |.|..|+|.|+..+-|.+|.+
T Consensus       239 S~~K~--~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  239 SDVKK--HQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             cCCcc--ccCcchhhHHHHHHHHHHhhh
Confidence            66666  899999999999999999875


No 2  
>KOG2462|consensus
Probab=99.78  E-value=4.3e-20  Score=120.14  Aligned_cols=94  Identities=18%  Similarity=0.198  Sum_probs=83.5

Q ss_pred             CccccCCCCCCCCCCC------------CCCCceecccccccccChhh---HHhhhcCCCccCCCCcCcccChhHHHHHH
Q psy2414          16 PFITRNNTDSIFYPDP------------ASPGMYKCVICLKSVRSRWH---HLQTHFSRNHKCPYCESVYSRVDTLKLHA   80 (114)
Q Consensus        16 ~~~~c~~c~~~f~~~~------------~~~~~~~C~~C~~~f~~~~~---h~~~h~~~~~~c~~C~~~f~~~~~l~~H~   80 (114)
                      +-++|++||+.+.+.+            ...+.+.|.+|++.+.+-..   |+++|+- +++|.+|||.|..++-|+-|+
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l-~c~C~iCGKaFSRPWLLQGHi  207 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTL-PCECGICGKAFSRPWLLQGHI  207 (279)
T ss_pred             CceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCC-CcccccccccccchHHhhccc
Confidence            6678999999998876            23567899999999988776   8888853 799999999999999999999


Q ss_pred             HHHhCCCCCCccccCCCCCccCCCCCCCCCCCC
Q psy2414          81 KRVHGLGISRYIHGLIPQLLFPTPHAKTSPVDR  113 (114)
Q Consensus        81 ~~~~~~~~~~~~~c~~c~~~f~~~~~L~~h~~~  113 (114)
                      |+ |+||++  |.|..|+|.|...++|+-|+++
T Consensus       208 RT-HTGEKP--F~C~hC~kAFADRSNLRAHmQT  237 (279)
T KOG2462|consen  208 RT-HTGEKP--FSCPHCGKAFADRSNLRAHMQT  237 (279)
T ss_pred             cc-ccCCCC--ccCCcccchhcchHHHHHHHHh
Confidence            98 899998  9999999999999999999875


No 3  
>KOG3623|consensus
Probab=99.43  E-value=2.2e-14  Score=103.90  Aligned_cols=78  Identities=18%  Similarity=0.296  Sum_probs=69.7

Q ss_pred             CCCCceecccccccccChhh---HHhhhcCC-CccCCCCcCcccChhHHHHHHHHHhCCCCCCccccCCCCCccCCCCCC
Q psy2414          32 ASPGMYKCVICLKSVRSRWH---HLQTHFSR-NHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFPTPHAK  107 (114)
Q Consensus        32 ~~~~~~~C~~C~~~f~~~~~---h~~~h~~~-~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~c~~c~~~f~~~~~L  107 (114)
                      +.+.+|.|+.|+++|.-.+.   |.--|+|+ ||+|.+|.|.|..+..|.-|+|. |.|+++  |.|+.|+|.|++....
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRL-HSGEKP--fQCdKClKRFSHSGSY  966 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRL-HSGEKP--FQCDKCLKRFSHSGSY  966 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhh-ccCCCc--chhhhhhhhcccccch
Confidence            44567999999999977665   88889999 99999999999999999999996 888988  9999999999999999


Q ss_pred             CCCCC
Q psy2414         108 TSPVD  112 (114)
Q Consensus       108 ~~h~~  112 (114)
                      .+|++
T Consensus       967 SQHMN  971 (1007)
T KOG3623|consen  967 SQHMN  971 (1007)
T ss_pred             Hhhhc
Confidence            99986


No 4  
>KOG3623|consensus
Probab=99.32  E-value=1.6e-13  Score=99.58  Aligned_cols=64  Identities=22%  Similarity=0.508  Sum_probs=60.0

Q ss_pred             cccCCCCCCCCCCC---------CCCCceecccccccccChhh---HHhhhcCC-CccCCCCcCcccChhHHHHHHH
Q psy2414          18 ITRNNTDSIFYPDP---------ASPGMYKCVICLKSVRSRWH---HLQTHFSR-NHKCPYCESVYSRVDTLKLHAK   81 (114)
Q Consensus        18 ~~c~~c~~~f~~~~---------~~~~~~~C~~C~~~f~~~~~---h~~~h~~~-~~~c~~C~~~f~~~~~l~~H~~   81 (114)
                      +.|+.|+|+|...+         +|.+||+|.+|.++|+.+-+   |.|.|.|+ ||+|..|+|+|+...+..+||.
T Consensus       895 yaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  895 YACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             chHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhhc
Confidence            67999999998776         89999999999999988865   99999999 9999999999999999999986


No 5  
>KOG3608|consensus
Probab=99.24  E-value=8.3e-13  Score=89.21  Aligned_cols=95  Identities=16%  Similarity=0.288  Sum_probs=82.7

Q ss_pred             CCccccCCCCCCCCCCC-----------CCCCceecccccccccChhh---HHhhhcCCCccCCCCcCcccChhHHHHHH
Q psy2414          15 QPFITRNNTDSIFYPDP-----------ASPGMYKCVICLKSVRSRWH---HLQTHFSRNHKCPYCESVYSRVDTLKLHA   80 (114)
Q Consensus        15 ~~~~~c~~c~~~f~~~~-----------~~~~~~~C~~C~~~f~~~~~---h~~~h~~~~~~c~~C~~~f~~~~~l~~H~   80 (114)
                      .+.+.|..||.-|.++.           ....+|.|..|.+.|.....   |+..|.. -|+|+.|......++.|..|+
T Consensus       205 eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn-~ykCplCdmtc~~~ssL~~H~  283 (467)
T KOG3608|consen  205 EKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVN-CYKCPLCDMTCSSASSLTTHI  283 (467)
T ss_pred             CeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhh-cccccccccCCCChHHHHHHH
Confidence            45677999999998877           45568999999999987764   7777754 599999999999999999999


Q ss_pred             HHHhCCCCCCccccCCCCCccCCCCCCCCCCC
Q psy2414          81 KRVHGLGISRYIHGLIPQLLFPTPHAKTSPVD  112 (114)
Q Consensus        81 ~~~~~~~~~~~~~c~~c~~~f~~~~~L~~h~~  112 (114)
                      +..|..+++  ++|+.|++.|.+.++|.+|++
T Consensus       284 r~rHs~dkp--fKCd~Cd~~c~~esdL~kH~~  313 (467)
T KOG3608|consen  284 RYRHSKDKP--FKCDECDTRCVRESDLAKHVQ  313 (467)
T ss_pred             HhhhccCCC--ccccchhhhhccHHHHHHHHH
Confidence            999998888  999999999999999999986


No 6  
>KOG3576|consensus
Probab=99.20  E-value=6.6e-13  Score=83.73  Aligned_cols=75  Identities=20%  Similarity=0.332  Sum_probs=45.3

Q ss_pred             CCceecccccccccChhh---HHhhhcCC-CccCCCCcCcccChhHHHHHHHHHhCCCCCCccccCCCCCccCCCCCCCC
Q psy2414          34 PGMYKCVICLKSVRSRWH---HLQTHFSR-NHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFPTPHAKTS  109 (114)
Q Consensus        34 ~~~~~C~~C~~~f~~~~~---h~~~h~~~-~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~c~~c~~~f~~~~~L~~  109 (114)
                      ...+.|..|++.|....-   |++.|..- .+-|..||+.|.+.-+|.+|+++ |+|.++  |.|..|+|.|++...|..
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rt-htgvrp--ykc~~c~kaftqrcsles  191 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRT-HTGVRP--YKCSLCEKAFTQRCSLES  191 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhcc-ccCccc--cchhhhhHHHHhhccHHH
Confidence            344666666666654432   66666554 56666666666666666666665 555555  666666666666665554


Q ss_pred             CC
Q psy2414         110 PV  111 (114)
Q Consensus       110 h~  111 (114)
                      |+
T Consensus       192 hl  193 (267)
T KOG3576|consen  192 HL  193 (267)
T ss_pred             HH
Confidence            43


No 7  
>KOG3576|consensus
Probab=99.16  E-value=1.1e-12  Score=82.74  Aligned_cols=97  Identities=21%  Similarity=0.259  Sum_probs=74.9

Q ss_pred             CCccccCCCCCCCCCCC---------CCCCceecccccccccChhh---HHhhhcCC-CccCCCCcCcccChhHHHHHHH
Q psy2414          15 QPFITRNNTDSIFYPDP---------ASPGMYKCVICLKSVRSRWH---HLQTHFSR-NHKCPYCESVYSRVDTLKLHAK   81 (114)
Q Consensus        15 ~~~~~c~~c~~~f~~~~---------~~~~~~~C~~C~~~f~~~~~---h~~~h~~~-~~~c~~C~~~f~~~~~l~~H~~   81 (114)
                      +....|.+|+|.|.-..         ...+.+.|..||+.|.....   |+++|+|- ||+|..|+++|.+..+|..|.+
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHH
Confidence            34567999999998765         45677899999999977754   99999999 9999999999999999999998


Q ss_pred             HHhCCCC--------CCccccCCCCCccCCCCCCCCCC
Q psy2414          82 RVHGLGI--------SRYIHGLIPQLLFPTPHAKTSPV  111 (114)
Q Consensus        82 ~~~~~~~--------~~~~~c~~c~~~f~~~~~L~~h~  111 (114)
                      .+|+...        ...|-|+.||.+-..+..+..|+
T Consensus       195 kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~  232 (267)
T KOG3576|consen  195 KVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHL  232 (267)
T ss_pred             HHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHH
Confidence            7666322        23356888886655544444443


No 8  
>KOG1074|consensus
Probab=99.08  E-value=3.5e-11  Score=88.60  Aligned_cols=77  Identities=22%  Similarity=0.351  Sum_probs=65.3

Q ss_pred             CceecccccccccChhh---HHhhhcCC-CccCCCCcCcccChhHHHHHHHHHhCCCCC---CccccC---CCCCccCCC
Q psy2414          35 GMYKCVICLKSVRSRWH---HLQTHFSR-NHKCPYCESVYSRVDTLKLHAKRVHGLGIS---RYIHGL---IPQLLFPTP  104 (114)
Q Consensus        35 ~~~~C~~C~~~f~~~~~---h~~~h~~~-~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~---~~~~c~---~c~~~f~~~  104 (114)
                      .|..|..|.+...-.+.   |.+.|+|| ||+|.+||+.|.++.+|+.|+.+ |.. ++   --+.|+   +|.+.|+..
T Consensus       604 dPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~v-Hka-~p~~R~q~ScP~~~ic~~kftn~  681 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSV-HKA-KPPARVQFSCPSTFICQKKFTNA  681 (958)
T ss_pred             CccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccc-ccc-CccccccccCCchhhhccccccc
Confidence            46889999998877766   99999999 99999999999999999999986 442 12   125688   999999999


Q ss_pred             CCCCCCCCC
Q psy2414         105 HAKTSPVDR  113 (114)
Q Consensus       105 ~~L~~h~~~  113 (114)
                      ..|.+||+.
T Consensus       682 V~lpQhIri  690 (958)
T KOG1074|consen  682 VTLPQHIRI  690 (958)
T ss_pred             ccccceEEe
Confidence            999999964


No 9  
>KOG3608|consensus
Probab=99.08  E-value=4.5e-11  Score=80.98  Aligned_cols=96  Identities=14%  Similarity=0.125  Sum_probs=80.0

Q ss_pred             ccccCCCCCCCCCCC----------CCCCceecccccccccChhh---HHhhhcCCCccCCC--CcCcccChhHHHHHHH
Q psy2414          17 FITRNNTDSIFYPDP----------ASPGMYKCVICLKSVRSRWH---HLQTHFSRNHKCPY--CESVYSRVDTLKLHAK   81 (114)
Q Consensus        17 ~~~c~~c~~~f~~~~----------~~~~~~~C~~C~~~f~~~~~---h~~~h~~~~~~c~~--C~~~f~~~~~l~~H~~   81 (114)
                      .++|..|+-+.+..+          +..+|++|+.|.+.+...+.   |...|++.-|+|..  |..++.+...+.+|++
T Consensus       263 ~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS~~~y~C~h~~C~~s~r~~~q~~~H~~  342 (467)
T KOG3608|consen  263 CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHSKTVYQCEHPDCHYSVRTYTQMRRHFL  342 (467)
T ss_pred             cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhccccceecCCCCCcHHHHHHHHHHHHHH
Confidence            356666666655544          56899999999999988875   88888733788877  9999999999999999


Q ss_pred             HHhCCCCCCccccCCCCCccCCCCCCCCCCC
Q psy2414          82 RVHGLGISRYIHGLIPQLLFPTPHAKTSPVD  112 (114)
Q Consensus        82 ~~~~~~~~~~~~c~~c~~~f~~~~~L~~h~~  112 (114)
                      .+|-|..++.|.|-+|++.|++-.+|.+|++
T Consensus       343 evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~  373 (467)
T KOG3608|consen  343 EVHEGNNPILYACHCCDRFFTSGKSLSAHLM  373 (467)
T ss_pred             HhccCCCCCceeeecchhhhccchhHHHHHH
Confidence            8888888888999999999999999999875


No 10 
>PHA02768 hypothetical protein; Provisional
Probab=98.95  E-value=7.3e-10  Score=56.22  Aligned_cols=44  Identities=11%  Similarity=0.255  Sum_probs=38.3

Q ss_pred             CccCCCCcCcccChhHHHHHHHHHhCCCCCCccccCCCCCccCCCCCCC
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFPTPHAKT  108 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~c~~c~~~f~~~~~L~  108 (114)
                      .|+|+.||+.|...++|..|+++|.   ++  +.|..|++.|.+.+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~---k~--~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN---TN--LKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC---Cc--ccCCcccceecccceeE
Confidence            4899999999999999999999854   23  68899999999988875


No 11 
>PHA00733 hypothetical protein
Probab=98.94  E-value=8.6e-10  Score=66.02  Aligned_cols=73  Identities=15%  Similarity=0.090  Sum_probs=51.1

Q ss_pred             CCceecccccccccChhh---------HHhhhcCC-CccCCCCcCcccChhHHHHHHHHHhCCCCCCccccCCCCCccCC
Q psy2414          34 PGMYKCVICLKSVRSRWH---------HLQTHFSR-NHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFPT  103 (114)
Q Consensus        34 ~~~~~C~~C~~~f~~~~~---------h~~~h~~~-~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~c~~c~~~f~~  103 (114)
                      .+++.|+.|...|.....         |+..+ ++ ||.|..|++.|.....|..|+++ +.  .+  +.|..|++.|..
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~-~~kPy~C~~Cgk~Fss~s~L~~H~r~-h~--~~--~~C~~CgK~F~~  111 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSK-AVSPYVCPLCLMPFSSSVSLKQHIRY-TE--HS--KVCPVCGKEFRN  111 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccC-CCCCccCCCCCCcCCCHHHHHHHHhc-CC--cC--ccCCCCCCccCC
Confidence            455666666665554432         22222 34 89999999999999999988875 32  23  678889999999


Q ss_pred             CCCCCCCCC
Q psy2414         104 PHAKTSPVD  112 (114)
Q Consensus       104 ~~~L~~h~~  112 (114)
                      ...|.+|+.
T Consensus       112 ~~sL~~H~~  120 (128)
T PHA00733        112 TDSTLDHVC  120 (128)
T ss_pred             HHHHHHHHH
Confidence            888888864


No 12 
>PHA00733 hypothetical protein
Probab=98.76  E-value=1e-09  Score=65.72  Aligned_cols=79  Identities=23%  Similarity=0.454  Sum_probs=63.3

Q ss_pred             CCCCCCCCCCCccccCCCCCCCCCCC--------------CCCCceecccccccccChhh---HHhhhcCCCccCCCCcC
Q psy2414           6 SRYPPTSPIQPFITRNNTDSIFYPDP--------------ASPGMYKCVICLKSVRSRWH---HLQTHFSRNHKCPYCES   68 (114)
Q Consensus         6 ~~~~~~~~~~~~~~c~~c~~~f~~~~--------------~~~~~~~C~~C~~~f~~~~~---h~~~h~~~~~~c~~C~~   68 (114)
                      .||....+=|+.+.|.+|.+.|....              .+++||.|+.|++.|.....   |++.+. .++.|..|++
T Consensus        29 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h~-~~~~C~~CgK  107 (128)
T PHA00733         29 KRYHSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYTE-HSKVCPVCGK  107 (128)
T ss_pred             hhhhcCChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcCC-cCccCCCCCC
Confidence            35666666677788999998887765              34679999999999988875   776652 2899999999


Q ss_pred             cccChhHHHHHHHHHhC
Q psy2414          69 VYSRVDTLKLHAKRVHG   85 (114)
Q Consensus        69 ~f~~~~~l~~H~~~~~~   85 (114)
                      .|.....|..|+...|.
T Consensus       108 ~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733        108 EFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             ccCCHHHHHHHHHHhcC
Confidence            99999999999986553


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.66  E-value=4.3e-08  Score=70.97  Aligned_cols=95  Identities=9%  Similarity=0.063  Sum_probs=57.0

Q ss_pred             CcCCCCCCCCCCCCccccCCCCCCCCCCC------CCCCceecccccccccChhh--HHhhhcCC-CccCCCCcCccc--
Q psy2414           3 GFKSRYPPTSPIQPFITRNNTDSIFYPDP------ASPGMYKCVICLKSVRSRWH--HLQTHFSR-NHKCPYCESVYS--   71 (114)
Q Consensus         3 ~~~~~~~~~~~~~~~~~c~~c~~~f~~~~------~~~~~~~C~~C~~~f~~~~~--h~~~h~~~-~~~c~~C~~~f~--   71 (114)
                      ||+..+.. .-++.++.|+.|++.|....      .-.+++.|+ |+..+....-  |+..|.++ ++.|+.|+..+.  
T Consensus       440 ~Cg~v~~r-~el~~H~~C~~Cgk~f~~s~LekH~~~~Hkpv~Cp-Cg~~~~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g  517 (567)
T PLN03086        440 GCGIVLRV-EEAKNHVHCEKCGQAFQQGEMEKHMKVFHEPLQCP-CGVVLEKEQMVQHQASTCPLRLITCRFCGDMVQAG  517 (567)
T ss_pred             cccceeec-cccccCccCCCCCCccchHHHHHHHHhcCCCccCC-CCCCcchhHHHhhhhccCCCCceeCCCCCCccccC
Confidence            45555543 33456677888877775322      113567777 7754422211  76667766 788888877774  


Q ss_pred             --------ChhHHHHHHHHHhCCCCCCccccCCCCCccCC
Q psy2414          72 --------RVDTLKLHAKRVHGLGISRYIHGLIPQLLFPT  103 (114)
Q Consensus        72 --------~~~~l~~H~~~~~~~~~~~~~~c~~c~~~f~~  103 (114)
                              ....|..|... . |.++  +.|..|++.+..
T Consensus       518 ~~~~d~~d~~s~Lt~HE~~-C-G~rt--~~C~~Cgk~Vrl  553 (567)
T PLN03086        518 GSAMDVRDRLRGMSEHESI-C-GSRT--APCDSCGRSVML  553 (567)
T ss_pred             ccccchhhhhhhHHHHHHh-c-CCcc--eEccccCCeeee
Confidence                    13467777765 2 4444  667778776654


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=98.64  E-value=1.3e-08  Score=51.68  Aligned_cols=41  Identities=29%  Similarity=0.443  Sum_probs=34.5

Q ss_pred             ceecccccccccChhh---HHhhhcCCCccCCCCcCcccChhHHH
Q psy2414          36 MYKCVICLKSVRSRWH---HLQTHFSRNHKCPYCESVYSRVDTLK   77 (114)
Q Consensus        36 ~~~C~~C~~~f~~~~~---h~~~h~~~~~~c~~C~~~f~~~~~l~   77 (114)
                      -|+|+.|++.|....+   |+++|+ .+++|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~-k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN-TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC-CcccCCcccceecccceeE
Confidence            3789999999988876   999998 4799999999999877663


No 15 
>PHA00732 hypothetical protein
Probab=98.58  E-value=5.2e-08  Score=53.55  Aligned_cols=45  Identities=24%  Similarity=0.303  Sum_probs=32.6

Q ss_pred             CccCCCCcCcccChhHHHHHHHHHhCCCCCCccccCCCCCccCCCCCCCCCCC
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFPTPHAKTSPVD  112 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~c~~c~~~f~~~~~L~~h~~  112 (114)
                      ||.|..|++.|....+|..|++.+|.+     +.|..|++.|.   .|.+|++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~-----~~C~~CgKsF~---~l~~H~~   45 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL-----TKCPVCNKSYR---RLNQHFY   45 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC-----CccCCCCCEeC---Chhhhhc
Confidence            577888888888888888887743442     35788888887   4667764


No 16 
>KOG1074|consensus
Probab=98.49  E-value=4.9e-08  Score=72.48  Aligned_cols=50  Identities=20%  Similarity=0.355  Sum_probs=34.7

Q ss_pred             CccCCCCcCcccChhHHHHHHHHHhCCCCCCccccCCCCCccCCCCCCCCCCC
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFPTPHAKTSPVD  112 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~c~~c~~~f~~~~~L~~h~~  112 (114)
                      +.+|.+|.+.|...+.|+.|.|. |+|+++  |+|.+||..|+++.+|+-|+.
T Consensus       353 khkCr~CakvfgS~SaLqiHlRS-HTGERP--fqCnvCG~~FSTkGNLKvH~~  402 (958)
T KOG1074|consen  353 KHKCRFCAKVFGSDSALQIHLRS-HTGERP--FQCNVCGNRFSTKGNLKVHFQ  402 (958)
T ss_pred             cchhhhhHhhcCchhhhhhhhhc-cCCCCC--eeecccccccccccceeeeee
Confidence            46677777777777777777775 666666  677777777777777766654


No 17 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.40  E-value=2.9e-07  Score=66.77  Aligned_cols=88  Identities=10%  Similarity=0.154  Sum_probs=64.4

Q ss_pred             cccC--CCCCCCCCCCCCCCceecccccccccChhh--HHhhhcCCCccCCCCcCcccChhHHHHHHHHHhCCCCCCccc
Q psy2414          18 ITRN--NTDSIFYPDPASPGMYKCVICLKSVRSRWH--HLQTHFSRNHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIH   93 (114)
Q Consensus        18 ~~c~--~c~~~f~~~~~~~~~~~C~~C~~~f~~~~~--h~~~h~~~~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~   93 (114)
                      +.|+  .|+..|... ..++.+.|+.|++.|....-  |+..+. .++.|+ ||+.+ ....|..|+++ +-..++  +.
T Consensus       434 V~Cp~~~Cg~v~~r~-el~~H~~C~~Cgk~f~~s~LekH~~~~H-kpv~Cp-Cg~~~-~R~~L~~H~~t-hCp~Kp--i~  506 (567)
T PLN03086        434 VVCPHDGCGIVLRVE-EAKNHVHCEKCGQAFQQGEMEKHMKVFH-EPLQCP-CGVVL-EKEQMVQHQAS-TCPLRL--IT  506 (567)
T ss_pred             eeCCcccccceeecc-ccccCccCCCCCCccchHHHHHHHHhcC-CCccCC-CCCCc-chhHHHhhhhc-cCCCCc--ee
Confidence            4565  488888554 55778999999999864322  887763 489999 99755 66899999886 555666  78


Q ss_pred             cCCCCCccCC----------CCCCCCCCC
Q psy2414          94 GLIPQLLFPT----------PHAKTSPVD  112 (114)
Q Consensus        94 c~~c~~~f~~----------~~~L~~h~~  112 (114)
                      |..|++.|+.          .+.|+.|.+
T Consensus       507 C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~  535 (567)
T PLN03086        507 CRFCGDMVQAGGSAMDVRDRLRGMSEHES  535 (567)
T ss_pred             CCCCCCccccCccccchhhhhhhHHHHHH
Confidence            9999999963          236777753


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.32  E-value=5.2e-07  Score=39.18  Aligned_cols=26  Identities=15%  Similarity=0.070  Sum_probs=17.9

Q ss_pred             HHHHHHHHHhCCCCCCccccCCCCCccCC
Q psy2414          75 TLKLHAKRVHGLGISRYIHGLIPQLLFPT  103 (114)
Q Consensus        75 ~l~~H~~~~~~~~~~~~~~c~~c~~~f~~  103 (114)
                      +|.+|+++ |+|+++  +.|+.|++.|.+
T Consensus         1 ~l~~H~~~-H~~~k~--~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRT-HTGEKP--YKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHH-HSSSSS--EEESSSSEEESS
T ss_pred             CHHHHhhh-cCCCCC--CCCCCCcCeeCc
Confidence            46777775 666666  777777777753


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.13  E-value=1e-06  Score=38.26  Aligned_cols=21  Identities=43%  Similarity=0.980  Sum_probs=19.0

Q ss_pred             HHhhhcCC-CccCCCCcCcccC
Q psy2414          52 HLQTHFSR-NHKCPYCESVYSR   72 (114)
Q Consensus        52 h~~~h~~~-~~~c~~C~~~f~~   72 (114)
                      |++.|+++ ||.|+.|++.|..
T Consensus         5 H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    5 HMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHSSSSSEEESSSSEEESS
T ss_pred             HhhhcCCCCCCCCCCCcCeeCc
Confidence            89999999 9999999998863


No 20 
>PHA00616 hypothetical protein
Probab=98.04  E-value=3.1e-06  Score=41.03  Aligned_cols=29  Identities=17%  Similarity=0.335  Sum_probs=24.5

Q ss_pred             CccCCCCcCcccChhHHHHHHHHHhCCCCC
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKRVHGLGIS   89 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~   89 (114)
                      ||+|..||+.|...++|..|++.+|+ +++
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg-~~~   29 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHK-QNK   29 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcC-CCc
Confidence            68999999999999999999997555 444


No 21 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.93  E-value=6.9e-06  Score=34.36  Aligned_cols=22  Identities=41%  Similarity=0.807  Sum_probs=19.9

Q ss_pred             ccCCCCcCcccChhHHHHHHHH
Q psy2414          61 HKCPYCESVYSRVDTLKLHAKR   82 (114)
Q Consensus        61 ~~c~~C~~~f~~~~~l~~H~~~   82 (114)
                      |.|+.|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5789999999999999999986


No 22 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.80  E-value=2.1e-05  Score=32.85  Aligned_cols=24  Identities=25%  Similarity=0.693  Sum_probs=19.2

Q ss_pred             ccCCCCcCcccChhHHHHHHHHHh
Q psy2414          61 HKCPYCESVYSRVDTLKLHAKRVH   84 (114)
Q Consensus        61 ~~c~~C~~~f~~~~~l~~H~~~~~   84 (114)
                      |.|+.|++.|.....|..|+.++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            579999999999999999998754


No 23 
>PHA00732 hypothetical protein
Probab=97.68  E-value=2.7e-05  Score=42.81  Aligned_cols=42  Identities=33%  Similarity=0.659  Sum_probs=30.1

Q ss_pred             ceecccccccccChhh---HHhh-hcCCCccCCCCcCcccChhHHHHHHHH
Q psy2414          36 MYKCVICLKSVRSRWH---HLQT-HFSRNHKCPYCESVYSRVDTLKLHAKR   82 (114)
Q Consensus        36 ~~~C~~C~~~f~~~~~---h~~~-h~~~~~~c~~C~~~f~~~~~l~~H~~~   82 (114)
                      ||.|+.|++.|.....   |++. |.  ++.|+.|++.|.   .+..|+++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~--~~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT--LTKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC--CCccCCCCCEeC---Chhhhhcc
Confidence            4678888888877664   6653 43  468889999887   47777754


No 24 
>PHA00616 hypothetical protein
Probab=97.68  E-value=1.4e-05  Score=38.77  Aligned_cols=30  Identities=27%  Similarity=0.527  Sum_probs=26.0

Q ss_pred             ceecccccccccChhh---HHhhhcCC-CccCCC
Q psy2414          36 MYKCVICLKSVRSRWH---HLQTHFSR-NHKCPY   65 (114)
Q Consensus        36 ~~~C~~C~~~f~~~~~---h~~~h~~~-~~~c~~   65 (114)
                      ||.|..||+.|...+.   |++.|+++ ++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            6899999999998876   99999998 887654


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.64  E-value=1.6e-05  Score=40.56  Aligned_cols=47  Identities=17%  Similarity=0.187  Sum_probs=23.5

Q ss_pred             ccCCCCcCcccChhHHHHHHHHHhCCCCCCccccCCCCCccCCCCCCCCCC
Q psy2414          61 HKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFPTPHAKTSPV  111 (114)
Q Consensus        61 ~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~c~~c~~~f~~~~~L~~h~  111 (114)
                      |.|++|++ -.+...|..|+...|..+.. .+.|++|...++.  +|.+|+
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~-~v~CPiC~~~~~~--~l~~Hl   49 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESK-NVVCPICSSRVTD--NLIRHL   49 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCC-CccCCCchhhhhh--HHHHHH
Confidence            55666666 33345566665555554322 2445666554332  454444


No 26 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.62  E-value=2e-05  Score=34.21  Aligned_cols=25  Identities=20%  Similarity=0.505  Sum_probs=21.1

Q ss_pred             CccCCCCcCcccChhHHHHHHHHHh
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKRVH   84 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~~~   84 (114)
                      ||+|..|++.|....+|..|++.++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5789999999999999999987643


No 27 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.36  E-value=0.00032  Score=35.69  Aligned_cols=47  Identities=32%  Similarity=0.535  Sum_probs=33.5

Q ss_pred             ceecccccccccChhh--HHh-hhcCC--CccCCCCcCcccChhHHHHHHHHHh
Q psy2414          36 MYKCVICLKSVRSRWH--HLQ-THFSR--NHKCPYCESVYSRVDTLKLHAKRVH   84 (114)
Q Consensus        36 ~~~C~~C~~~f~~~~~--h~~-~h~~~--~~~c~~C~~~f~~~~~l~~H~~~~~   84 (114)
                      .|.|+.|++.|....-  |.. .|..+  .+.|+.|...+.  .+|..|+..+|
T Consensus         2 ~f~CP~C~~~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGKGFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCCccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            4789999995543322  644 46554  799999998654  48999998765


No 28 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.12  E-value=0.00072  Score=28.35  Aligned_cols=22  Identities=32%  Similarity=0.723  Sum_probs=19.5

Q ss_pred             ccCCCCcCcccChhHHHHHHHH
Q psy2414          61 HKCPYCESVYSRVDTLKLHAKR   82 (114)
Q Consensus        61 ~~c~~C~~~f~~~~~l~~H~~~   82 (114)
                      ++|..|++.|.....|..|++.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~   22 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRT   22 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHH
Confidence            5788999999999999999885


No 29 
>KOG3993|consensus
Probab=97.09  E-value=0.00028  Score=49.59  Aligned_cols=28  Identities=18%  Similarity=0.290  Sum_probs=19.7

Q ss_pred             CccCCCCcCcccChhHHHHHHHHHhCCC
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKRVHGLG   87 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~~~~~~   87 (114)
                      -|.|..|++.|.....|+.|+-+|+..+
T Consensus       356 i~~C~~C~KkFrRqAYLrKHqlthq~~~  383 (500)
T KOG3993|consen  356 IFSCHTCGKKFRRQAYLRKHQLTHQRAP  383 (500)
T ss_pred             eeecHHhhhhhHHHHHHHHhHHhhhccc
Confidence            4677778888888878877766655543


No 30 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.88  E-value=0.0012  Score=27.62  Aligned_cols=24  Identities=46%  Similarity=0.645  Sum_probs=18.5

Q ss_pred             ccCCCCcCcccChhHHHHHHHHHhC
Q psy2414          61 HKCPYCESVYSRVDTLKLHAKRVHG   85 (114)
Q Consensus        61 ~~c~~C~~~f~~~~~l~~H~~~~~~   85 (114)
                      |+|+.|..... ...|..|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            57899998888 8899999988663


No 31 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=96.61  E-value=0.0016  Score=26.90  Aligned_cols=20  Identities=50%  Similarity=0.932  Sum_probs=15.5

Q ss_pred             eecccccccccChhh---HHhhh
Q psy2414          37 YKCVICLKSVRSRWH---HLQTH   56 (114)
Q Consensus        37 ~~C~~C~~~f~~~~~---h~~~h   56 (114)
                      |.|+.|++.|.....   |++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            678999999988865   76653


No 32 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.46  E-value=0.0034  Score=31.31  Aligned_cols=26  Identities=27%  Similarity=0.497  Sum_probs=20.3

Q ss_pred             CccCCCCcCcccChhHHHHHHHHHhC
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKRVHG   85 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~~~~   85 (114)
                      |-.|+.|+..+....+|.+|+.+.|.
T Consensus        24 PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   24 PATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             -EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             CCCCCcchhhccchhhHHHHHHHHhc
Confidence            89999999999999999999988665


No 33 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.41  E-value=0.0015  Score=27.56  Aligned_cols=22  Identities=23%  Similarity=0.617  Sum_probs=18.6

Q ss_pred             ccCCCCcCcccChhHHHHHHHH
Q psy2414          61 HKCPYCESVYSRVDTLKLHAKR   82 (114)
Q Consensus        61 ~~c~~C~~~f~~~~~l~~H~~~   82 (114)
                      |.|..|++.|.....|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            5688899999999999988764


No 34 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.37  E-value=9.3e-05  Score=41.88  Aligned_cols=68  Identities=15%  Similarity=0.147  Sum_probs=16.2

Q ss_pred             ecccccccccChhh---HHhhhcCCCccCCCCcCcccChhHHHHHHHHHhCCCCCCccccCCCCCccCCCCCCCCCCC
Q psy2414          38 KCVICLKSVRSRWH---HLQTHFSRNHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFPTPHAKTSPVD  112 (114)
Q Consensus        38 ~C~~C~~~f~~~~~---h~~~h~~~~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~c~~c~~~f~~~~~L~~h~~  112 (114)
                      +|..|+..|.+...   |+....+-  ... ....+.....+..+++. .... .  +.|..|++.|....+|..|++
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~--~~~-~~~~l~~~~~~~~~~~~-~~~~-~--~~C~~C~~~f~s~~~l~~Hm~   71 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGF--DIP-DQKYLVDPNRLLNYLRK-KVKE-S--FRCPYCNKTFRSREALQEHMR   71 (100)
T ss_dssp             ----------------------------------------------------S-S--EEBSSSS-EESSHHHHHHHHH
T ss_pred             Ccccccccccccccccccccccccc--ccc-ccccccccccccccccc-ccCC-C--CCCCccCCCCcCHHHHHHHHc
Confidence            47788888766543   65432221  100 11112233333334332 1111 2  678888888888888877764


No 35 
>PRK04860 hypothetical protein; Provisional
Probab=95.84  E-value=0.0071  Score=37.67  Aligned_cols=40  Identities=10%  Similarity=0.013  Sum_probs=26.7

Q ss_pred             CccCCCCcCcccChhHHHHHHHHHhCCCCCCccccCCCCCccCCCCC
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFPTPHA  106 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~c~~c~~~f~~~~~  106 (114)
                      +|.|. |+.   ....+.+|.++ +.++++  +.|..|+..|....+
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri-~~g~~~--YrC~~C~~~l~~~~~  158 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRV-VRGEAV--YRCRRCGETLVFKGE  158 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHH-hcCCcc--EECCCCCceeEEecc
Confidence            67776 776   55667777776 555555  677778777765443


No 36 
>PRK04860 hypothetical protein; Provisional
Probab=95.78  E-value=0.0085  Score=37.33  Aligned_cols=38  Identities=16%  Similarity=0.270  Sum_probs=29.6

Q ss_pred             CceecccccccccChhhHHhhhcCC-CccCCCCcCcccCh
Q psy2414          35 GMYKCVICLKSVRSRWHHLQTHFSR-NHKCPYCESVYSRV   73 (114)
Q Consensus        35 ~~~~C~~C~~~f~~~~~h~~~h~~~-~~~c~~C~~~f~~~   73 (114)
                      -+|.|. |+....+...|.++|+++ +|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQEHQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCCeeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            379998 988433333499999999 99999999887654


No 37 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=95.73  E-value=0.0072  Score=41.40  Aligned_cols=50  Identities=18%  Similarity=0.244  Sum_probs=34.5

Q ss_pred             CccCCC--CcCcccChhHHHHHHHHHh------------------CCCCCCccccCCCCCccCCCCCCCCCC
Q psy2414          60 NHKCPY--CESVYSRVDTLKLHAKRVH------------------GLGISRYIHGLIPQLLFPTPHAKTSPV  111 (114)
Q Consensus        60 ~~~c~~--C~~~f~~~~~l~~H~~~~~------------------~~~~~~~~~c~~c~~~f~~~~~L~~h~  111 (114)
                      ||+|++  |.|.+.....|.-|+---|                  ...++  |.|++|+|.|..-..|.=|+
T Consensus       349 pykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KP--YrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         349 PYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKP--YRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             eecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCc--eeccccchhhccCccceecc
Confidence            777766  7777777777776653111                  11234  67999999999999998776


No 38 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.57  E-value=0.017  Score=24.53  Aligned_cols=20  Identities=35%  Similarity=0.750  Sum_probs=15.1

Q ss_pred             ccCCCCcCcccChhHHHHHHH
Q psy2414          61 HKCPYCESVYSRVDTLKLHAK   81 (114)
Q Consensus        61 ~~c~~C~~~f~~~~~l~~H~~   81 (114)
                      ..|+.||+.| .+..|..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            4688888888 5677777765


No 39 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.52  E-value=0.0034  Score=27.09  Aligned_cols=21  Identities=33%  Similarity=0.653  Sum_probs=15.5

Q ss_pred             ccCCCCcCcccChhHHHHHHH
Q psy2414          61 HKCPYCESVYSRVDTLKLHAK   81 (114)
Q Consensus        61 ~~c~~C~~~f~~~~~l~~H~~   81 (114)
                      |.|..|++.|.....+..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            567778888887777777654


No 40 
>KOG3993|consensus
Probab=95.49  E-value=0.0014  Score=46.28  Aligned_cols=47  Identities=21%  Similarity=0.265  Sum_probs=28.7

Q ss_pred             ccCCCCcCcccChhHHHHHH--HHHhCCCCCCccccCCCCCccCCCCCCCCCCC
Q psy2414          61 HKCPYCESVYSRVDTLKLHA--KRVHGLGISRYIHGLIPQLLFPTPHAKTSPVD  112 (114)
Q Consensus        61 ~~c~~C~~~f~~~~~l~~H~--~~~~~~~~~~~~~c~~c~~~f~~~~~L~~h~~  112 (114)
                      |.|++|.-.|.+.-.|.+|.  +++|.   .  |+|..|+|.|.=+.+|-.|.+
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~v---E--YrCPEC~KVFsCPANLASHRR  316 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHV---E--YRCPECDKVFSCPANLASHRR  316 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEe---e--ecCCcccccccCchhhhhhhc
Confidence            66666666666666666664  33343   2  666666666666666666653


No 41 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=95.20  E-value=0.0064  Score=41.64  Aligned_cols=49  Identities=29%  Similarity=0.600  Sum_probs=36.7

Q ss_pred             CCCceeccc--ccccccChhh---HHh-------hh------------cCC-CccCCCCcCcccChhHHHHHHH
Q psy2414          33 SPGMYKCVI--CLKSVRSRWH---HLQ-------TH------------FSR-NHKCPYCESVYSRVDTLKLHAK   81 (114)
Q Consensus        33 ~~~~~~C~~--C~~~f~~~~~---h~~-------~h------------~~~-~~~c~~C~~~f~~~~~l~~H~~   81 (114)
                      +++||+|+.  |++.++....   |+.       +|            .+. ||.|++|+|.+.....|.-|..
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            469999997  9999887643   321       11            123 9999999999999999887754


No 42 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.38  E-value=0.032  Score=25.26  Aligned_cols=22  Identities=18%  Similarity=0.492  Sum_probs=18.6

Q ss_pred             CccCCCCcCcccChhHHHHHHH
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAK   81 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~   81 (114)
                      +|.|..|++.|.....+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            5789999999998888888875


No 43 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=92.27  E-value=0.14  Score=28.60  Aligned_cols=24  Identities=25%  Similarity=0.801  Sum_probs=21.3

Q ss_pred             CccCCCCcCcccChhHHHHHHHHH
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKRV   83 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~~   83 (114)
                      .+.|..|++.|.....|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            599999999999999999999864


No 44 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=92.01  E-value=0.11  Score=30.22  Aligned_cols=30  Identities=17%  Similarity=0.224  Sum_probs=19.8

Q ss_pred             cccCCCCCCCCCCCCCCCceecccccccccCh
Q psy2414          18 ITRNNTDSIFYPDPASPGMYKCVICLKSVRSR   49 (114)
Q Consensus        18 ~~c~~c~~~f~~~~~~~~~~~C~~C~~~f~~~   49 (114)
                      ..|..||+.|-.  .++.|-.|+.||..|...
T Consensus        10 R~Cp~CG~kFYD--Lnk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYD--LNKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhcc--CCCCCccCCCCCCccCcc
Confidence            347777777755  555677777777666444


No 45 
>KOG2893|consensus
Probab=90.59  E-value=0.13  Score=34.19  Aligned_cols=11  Identities=27%  Similarity=0.736  Sum_probs=5.5

Q ss_pred             CccCCCCcCcc
Q psy2414          60 NHKCPYCESVY   70 (114)
Q Consensus        60 ~~~c~~C~~~f   70 (114)
                      .|+|.+|.+.+
T Consensus        34 hfkchichkkl   44 (341)
T KOG2893|consen   34 HFKCHICHKKL   44 (341)
T ss_pred             cceeeeehhhh
Confidence            45555554433


No 46 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=88.51  E-value=0.33  Score=31.73  Aligned_cols=16  Identities=19%  Similarity=-0.014  Sum_probs=12.5

Q ss_pred             CccccCCCCCCCCCCC
Q psy2414          16 PFITRNNTDSIFYPDP   31 (114)
Q Consensus        16 ~~~~c~~c~~~f~~~~   31 (114)
                      ..+.|++|++.|..+.
T Consensus         4 k~~~CPvC~~~F~~~~   19 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKK   19 (214)
T ss_pred             CceECCCCCCeeeeeE
Confidence            4577899998888764


No 47 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=88.39  E-value=0.39  Score=22.28  Aligned_cols=29  Identities=24%  Similarity=0.272  Sum_probs=12.8

Q ss_pred             cccCCCCCCCCCCC----CCCCceecccccccc
Q psy2414          18 ITRNNTDSIFYPDP----ASPGMYKCVICLKSV   46 (114)
Q Consensus        18 ~~c~~c~~~f~~~~----~~~~~~~C~~C~~~f   46 (114)
                      +.|+.|+..|.-..    .+.....|+.|+..|
T Consensus         3 i~CP~C~~~f~v~~~~l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDKLPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             EECCCCCceEEcCHHHcccCCcEEECCCCCcEe
Confidence            34555555554332    122344455554443


No 48 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=87.74  E-value=0.42  Score=23.19  Aligned_cols=28  Identities=11%  Similarity=0.065  Sum_probs=16.3

Q ss_pred             cccCCCCCCCCCCCCCCCceecccccccc
Q psy2414          18 ITRNNTDSIFYPDPASPGMYKCVICLKSV   46 (114)
Q Consensus        18 ~~c~~c~~~f~~~~~~~~~~~C~~C~~~f   46 (114)
                      +.|..||..|.-.... ....|+.||..+
T Consensus         4 y~C~~CG~~~~~~~~~-~~~~Cp~CG~~~   31 (46)
T PRK00398          4 YKCARCGREVELDEYG-TGVRCPYCGYRI   31 (46)
T ss_pred             EECCCCCCEEEECCCC-CceECCCCCCeE
Confidence            5677777766554222 256777777543


No 49 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=87.25  E-value=0.43  Score=21.48  Aligned_cols=23  Identities=13%  Similarity=0.241  Sum_probs=11.2

Q ss_pred             cccCCCCCCCCCCCCCCCceeccccc
Q psy2414          18 ITRNNTDSIFYPDPASPGMYKCVICL   43 (114)
Q Consensus        18 ~~c~~c~~~f~~~~~~~~~~~C~~C~   43 (114)
                      +.|..||..+..   .+.++.|+.|+
T Consensus         2 ~~C~~CGy~y~~---~~~~~~CP~Cg   24 (33)
T cd00350           2 YVCPVCGYIYDG---EEAPWVCPVCG   24 (33)
T ss_pred             EECCCCCCEECC---CcCCCcCcCCC
Confidence            345566554421   12455566655


No 50 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=86.73  E-value=0.59  Score=21.53  Aligned_cols=11  Identities=18%  Similarity=0.075  Sum_probs=5.3

Q ss_pred             ccCCCCCCCCC
Q psy2414          19 TRNNTDSIFYP   29 (114)
Q Consensus        19 ~c~~c~~~f~~   29 (114)
                      .|+.|+..|.-
T Consensus         4 ~Cp~C~~~y~i   14 (36)
T PF13717_consen    4 TCPNCQAKYEI   14 (36)
T ss_pred             ECCCCCCEEeC
Confidence            45555554443


No 51 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=85.82  E-value=0.57  Score=29.44  Aligned_cols=8  Identities=38%  Similarity=1.119  Sum_probs=4.3

Q ss_pred             CccCCCCc
Q psy2414          60 NHKCPYCE   67 (114)
Q Consensus        60 ~~~c~~C~   67 (114)
                      |..|+.||
T Consensus       149 P~~CPiCg  156 (166)
T COG1592         149 PEVCPICG  156 (166)
T ss_pred             CCcCCCCC
Confidence            55555554


No 52 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=85.51  E-value=0.65  Score=27.79  Aligned_cols=29  Identities=17%  Similarity=0.031  Sum_probs=18.5

Q ss_pred             ccCCCCCCCCCCCCCCCceecccccccccCh
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICLKSVRSR   49 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~~~f~~~   49 (114)
                      .|..||+.|..  .++.|-.|+.||..|...
T Consensus        11 ~Cp~cg~kFYD--Lnk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        11 ICPNTGSKFYD--LNRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             cCCCcCccccc--cCCCCccCCCcCCccCcc
Confidence            47777777755  455667777777665433


No 53 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=85.46  E-value=0.52  Score=24.01  Aligned_cols=29  Identities=28%  Similarity=0.576  Sum_probs=21.3

Q ss_pred             cCC-CccCCCCcCcccChhHHHHHHHHHhC
Q psy2414          57 FSR-NHKCPYCESVYSRVDTLKLHAKRVHG   85 (114)
Q Consensus        57 ~~~-~~~c~~C~~~f~~~~~l~~H~~~~~~   85 (114)
                      .|+ -+.|+-|+..|....+..+|+...|+
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            355 67888888888888888888765454


No 54 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=84.63  E-value=0.53  Score=32.87  Aligned_cols=51  Identities=20%  Similarity=0.182  Sum_probs=38.8

Q ss_pred             CccCCCCcCcccChhHHHHHHHH-HhCCC--CCCccccC--CCCCccCCCCCCCCCCC
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKR-VHGLG--ISRYIHGL--IPQLLFPTPHAKTSPVD  112 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~-~~~~~--~~~~~~c~--~c~~~f~~~~~L~~h~~  112 (114)
                      ++.|..|...|.....|..|.+. .|.++  ++  +.|.  .|++.|.....|.+|..
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~--~~~p~~~~~~~~~~~~~~~~~~~  344 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKP--FSCPYSLCGKLFSRNDALKRHIL  344 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCc--eeeeccCCCccccccccccCCcc
Confidence            46777788888888888888883 46666  55  6666  68888888888888874


No 55 
>KOG2186|consensus
Probab=84.39  E-value=0.45  Score=31.82  Aligned_cols=44  Identities=25%  Similarity=0.511  Sum_probs=25.8

Q ss_pred             eecccccccccChhh--HHhhhcCCCccCCCCcCcccChhHHHHHHH
Q psy2414          37 YKCVICLKSVRSRWH--HLQTHFSRNHKCPYCESVYSRVDTLKLHAK   81 (114)
Q Consensus        37 ~~C~~C~~~f~~~~~--h~~~h~~~~~~c~~C~~~f~~~~~l~~H~~   81 (114)
                      |.|..||....-..-  |+..-.+.-|.|-.|++.|.. .....|..
T Consensus         4 FtCnvCgEsvKKp~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             EehhhhhhhccccchHHHHHhccCCeeEEeeccccccc-chhhhhhh
Confidence            567777766544432  554444445777777777776 44555554


No 56 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=83.81  E-value=2  Score=22.18  Aligned_cols=27  Identities=11%  Similarity=0.203  Sum_probs=12.8

Q ss_pred             ccCCCCCCCCCCCCCCCceecccccccc
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICLKSV   46 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~~~f   46 (114)
                      .|..||...... .+--.|.|+.||+..
T Consensus        11 ~CtSCg~~i~p~-e~~v~F~CPnCGe~~   37 (61)
T COG2888          11 VCTSCGREIAPG-ETAVKFPCPNCGEVE   37 (61)
T ss_pred             eeccCCCEeccC-CceeEeeCCCCCcee
Confidence            455555544221 222346666666443


No 57 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=83.49  E-value=0.88  Score=25.38  Aligned_cols=28  Identities=14%  Similarity=0.209  Sum_probs=13.3

Q ss_pred             cccCCCCCCCCCCCCCCCceecccccccc
Q psy2414          18 ITRNNTDSIFYPDPASPGMYKCVICLKSV   46 (114)
Q Consensus        18 ~~c~~c~~~f~~~~~~~~~~~C~~C~~~f   46 (114)
                      +.|+.|++. .-+..+..-|.|..|+..|
T Consensus        36 ~~Cp~C~~~-~VkR~a~GIW~C~kCg~~f   63 (89)
T COG1997          36 HVCPFCGRT-TVKRIATGIWKCRKCGAKF   63 (89)
T ss_pred             CcCCCCCCc-ceeeeccCeEEcCCCCCee
Confidence            345555554 2222344445555555554


No 58 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=82.99  E-value=0.76  Score=20.89  Aligned_cols=10  Identities=10%  Similarity=-0.180  Sum_probs=5.1

Q ss_pred             cccCCCCCCC
Q psy2414          18 ITRNNTDSIF   27 (114)
Q Consensus        18 ~~c~~c~~~f   27 (114)
                      +.|..||..+
T Consensus         3 ~~C~~CG~i~   12 (34)
T cd00729           3 WVCPVCGYIH   12 (34)
T ss_pred             EECCCCCCEe
Confidence            4455555443


No 59 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=82.63  E-value=0.8  Score=21.09  Aligned_cols=9  Identities=22%  Similarity=0.276  Sum_probs=4.2

Q ss_pred             ccCCCCCCC
Q psy2414          19 TRNNTDSIF   27 (114)
Q Consensus        19 ~c~~c~~~f   27 (114)
                      .|+.|+..|
T Consensus         4 ~CP~C~~~~   12 (38)
T TIGR02098         4 QCPNCKTSF   12 (38)
T ss_pred             ECCCCCCEE
Confidence            344554444


No 60 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=81.35  E-value=0.92  Score=35.01  Aligned_cols=44  Identities=20%  Similarity=0.357  Sum_probs=22.6

Q ss_pred             CccccCCCCCCCCCCCCCCCceecccccccccChh--h----HHhhhcCC-CccCCCCcCc
Q psy2414          16 PFITRNNTDSIFYPDPASPGMYKCVICLKSVRSRW--H----HLQTHFSR-NHKCPYCESV   69 (114)
Q Consensus        16 ~~~~c~~c~~~f~~~~~~~~~~~C~~C~~~f~~~~--~----h~~~h~~~-~~~c~~C~~~   69 (114)
                      +...|..||..+          +|+.|+-.+....  +    |..-+... |..|+.||..
T Consensus       434 ~~l~C~~Cg~v~----------~Cp~Cd~~lt~H~~~~~L~CH~Cg~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         434 PLLLCRDCGYIA----------ECPNCDSPLTLHKATGQLRCHYCGYQEPIPQSCPECGSE  484 (730)
T ss_pred             ceeecccCCCcc----------cCCCCCcceEEecCCCeeEeCCCCCCCCCCCCCCCCCCC
Confidence            445677777755          3444443221111  1    33333344 7788888765


No 61 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=80.45  E-value=0.61  Score=22.23  Aligned_cols=9  Identities=44%  Similarity=0.955  Sum_probs=4.3

Q ss_pred             CccCCCCcC
Q psy2414          60 NHKCPYCES   68 (114)
Q Consensus        60 ~~~c~~C~~   68 (114)
                      +..|+.||.
T Consensus        26 ~~~CP~Cg~   34 (42)
T PF09723_consen   26 PVPCPECGS   34 (42)
T ss_pred             CCcCCCCCC
Confidence            444555543


No 62 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=80.33  E-value=1.5  Score=21.17  Aligned_cols=24  Identities=13%  Similarity=0.077  Sum_probs=12.2

Q ss_pred             cccCCCCCCCCCCCCCCCceeccccc
Q psy2414          18 ITRNNTDSIFYPDPASPGMYKCVICL   43 (114)
Q Consensus        18 ~~c~~c~~~f~~~~~~~~~~~C~~C~   43 (114)
                      +.|..||..|.-.  ...+..|+.||
T Consensus         3 Y~C~~Cg~~~~~~--~~~~irC~~CG   26 (44)
T smart00659        3 YICGECGRENEIK--SKDVVRCRECG   26 (44)
T ss_pred             EECCCCCCEeecC--CCCceECCCCC
Confidence            4455666555443  22345555555


No 63 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=80.15  E-value=0.71  Score=21.48  Aligned_cols=10  Identities=10%  Similarity=0.129  Sum_probs=5.2

Q ss_pred             ccCCCCCCCC
Q psy2414          19 TRNNTDSIFY   28 (114)
Q Consensus        19 ~c~~c~~~f~   28 (114)
                      +|..||..|.
T Consensus         7 ~C~~Cg~~fe   16 (41)
T smart00834        7 RCEDCGHTFE   16 (41)
T ss_pred             EcCCCCCEEE
Confidence            4555555543


No 64 
>PF14353 CpXC:  CpXC protein
Probab=79.46  E-value=1.1  Score=26.73  Aligned_cols=14  Identities=21%  Similarity=0.067  Sum_probs=9.2

Q ss_pred             cccCCCCCCCCCCC
Q psy2414          18 ITRNNTDSIFYPDP   31 (114)
Q Consensus        18 ~~c~~c~~~f~~~~   31 (114)
                      +.|+.|+..|.-..
T Consensus         2 itCP~C~~~~~~~v   15 (128)
T PF14353_consen    2 ITCPHCGHEFEFEV   15 (128)
T ss_pred             cCCCCCCCeeEEEE
Confidence            46777777776543


No 65 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=78.66  E-value=2.9  Score=17.69  Aligned_cols=20  Identities=20%  Similarity=0.448  Sum_probs=13.8

Q ss_pred             ccCCCCcCcccChhHHHHHHH
Q psy2414          61 HKCPYCESVYSRVDTLKLHAK   81 (114)
Q Consensus        61 ~~c~~C~~~f~~~~~l~~H~~   81 (114)
                      ..|+.|++.+ ....++.|+.
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            3577888777 5567777765


No 66 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=78.46  E-value=1.2  Score=27.74  Aligned_cols=14  Identities=21%  Similarity=0.441  Sum_probs=8.9

Q ss_pred             ceecccccccccCh
Q psy2414          36 MYKCVICLKSVRSR   49 (114)
Q Consensus        36 ~~~C~~C~~~f~~~   49 (114)
                      .+.|+.|+..|..-
T Consensus        28 ~~~c~~c~~~f~~~   41 (154)
T PRK00464         28 RRECLACGKRFTTF   41 (154)
T ss_pred             eeeccccCCcceEe
Confidence            36777777776543


No 67 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=77.08  E-value=1  Score=22.23  Aligned_cols=10  Identities=30%  Similarity=0.959  Sum_probs=4.8

Q ss_pred             eecccccccc
Q psy2414          37 YKCVICLKSV   46 (114)
Q Consensus        37 ~~C~~C~~~f   46 (114)
                      |.|..|+..|
T Consensus         6 y~C~~Cg~~f   15 (52)
T TIGR02605         6 YRCTACGHRF   15 (52)
T ss_pred             EEeCCCCCEe
Confidence            4455555444


No 68 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=76.45  E-value=2.1  Score=28.06  Aligned_cols=26  Identities=19%  Similarity=0.572  Sum_probs=20.6

Q ss_pred             CccCCCCcCcccChhHHHHHHHHHhC
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKRVHG   85 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~~~~   85 (114)
                      -|.|..|+|.|.-......||...|.
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCH
Confidence            79999999999999999999987665


No 69 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=76.14  E-value=3.2  Score=20.38  Aligned_cols=22  Identities=41%  Similarity=0.815  Sum_probs=14.3

Q ss_pred             ccCCCCcCcccCh-----hHHHHHHHH
Q psy2414          61 HKCPYCESVYSRV-----DTLKLHAKR   82 (114)
Q Consensus        61 ~~c~~C~~~f~~~-----~~l~~H~~~   82 (114)
                      -.|..|++.+...     ++|.+|+..
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~   45 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRR   45 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHh
Confidence            4566666666543     688888773


No 70 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=75.98  E-value=2.4  Score=18.06  Aligned_cols=6  Identities=33%  Similarity=0.695  Sum_probs=2.3

Q ss_pred             cccccc
Q psy2414          39 CVICLK   44 (114)
Q Consensus        39 C~~C~~   44 (114)
                      |+.||.
T Consensus        17 Cp~CG~   22 (26)
T PF10571_consen   17 CPHCGY   22 (26)
T ss_pred             CCCCCC
Confidence            333333


No 71 
>PHA00626 hypothetical protein
Probab=75.35  E-value=2.8  Score=21.43  Aligned_cols=12  Identities=25%  Similarity=0.290  Sum_probs=5.5

Q ss_pred             ccCCCCcCcccC
Q psy2414          61 HKCPYCESVYSR   72 (114)
Q Consensus        61 ~~c~~C~~~f~~   72 (114)
                      |.|..||..|+.
T Consensus        24 YkCkdCGY~ft~   35 (59)
T PHA00626         24 YVCCDCGYNDSK   35 (59)
T ss_pred             eEcCCCCCeech
Confidence            444444444443


No 72 
>KOG2186|consensus
Probab=75.14  E-value=2  Score=28.81  Aligned_cols=42  Identities=17%  Similarity=0.210  Sum_probs=26.3

Q ss_pred             ccccCCCCCCCCCCC-------CCCCceecccccccccChhh--HHhhhcC
Q psy2414          17 FITRNNTDSIFYPDP-------ASPGMYKCVICLKSVRSRWH--HLQTHFS   58 (114)
Q Consensus        17 ~~~c~~c~~~f~~~~-------~~~~~~~C~~C~~~f~~~~~--h~~~h~~   58 (114)
                      ...|+.||.+..-+.       -....|.|..|++.|-...-  |..-.++
T Consensus         3 ~FtCnvCgEsvKKp~vekH~srCrn~~fSCIDC~k~F~~~sYknH~kCITE   53 (276)
T KOG2186|consen    3 FFTCNVCGESVKKPQVEKHMSRCRNAYFSCIDCGKTFERVSYKNHTKCITE   53 (276)
T ss_pred             EEehhhhhhhccccchHHHHHhccCCeeEEeecccccccchhhhhhhhcch
Confidence            356888887766554       12256788889888865432  5554444


No 73 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=75.12  E-value=3.6  Score=19.28  Aligned_cols=28  Identities=11%  Similarity=0.215  Sum_probs=13.2

Q ss_pred             cccCCCCCCCCCCC---CCCCceeccccccc
Q psy2414          18 ITRNNTDSIFYPDP---ASPGMYKCVICLKS   45 (114)
Q Consensus        18 ~~c~~c~~~f~~~~---~~~~~~~C~~C~~~   45 (114)
                      ++|..|+.-++.-.   .+.+.|.|..|+..
T Consensus         3 ~rC~~C~aylNp~~~~~~~~~~w~C~~C~~~   33 (40)
T PF04810_consen    3 VRCRRCRAYLNPFCQFDDGGKTWICNFCGTK   33 (40)
T ss_dssp             -B-TTT--BS-TTSEEETTTTEEEETTT--E
T ss_pred             cccCCCCCEECCcceEcCCCCEEECcCCCCc
Confidence            46777766555443   45567788877743


No 74 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=73.51  E-value=2.5  Score=20.06  Aligned_cols=22  Identities=41%  Similarity=0.723  Sum_probs=12.2

Q ss_pred             CccCCCCcCcccC----hhHHHHHHH
Q psy2414          60 NHKCPYCESVYSR----VDTLKLHAK   81 (114)
Q Consensus        60 ~~~c~~C~~~f~~----~~~l~~H~~   81 (114)
                      -..|..|++.+..    .++|..|++
T Consensus        16 ~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   16 KAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             -EEETTTTEE-----SSTHHHHHHHH
T ss_pred             eEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            4567777766654    367777774


No 75 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=73.43  E-value=2.6  Score=23.76  Aligned_cols=27  Identities=11%  Similarity=0.053  Sum_probs=18.2

Q ss_pred             ccccCCCCCCCCCCCCCCCceecccccc
Q psy2414          17 FITRNNTDSIFYPDPASPGMYKCVICLK   44 (114)
Q Consensus        17 ~~~c~~c~~~f~~~~~~~~~~~C~~C~~   44 (114)
                      .-.|..||..|.. ..-.+|..|+.|..
T Consensus        58 Pa~CkkCGfef~~-~~ik~pSRCP~CKS   84 (97)
T COG3357          58 PARCKKCGFEFRD-DKIKKPSRCPKCKS   84 (97)
T ss_pred             ChhhcccCccccc-cccCCcccCCcchh
Confidence            3468888888866 23455777887753


No 76 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=72.50  E-value=4.9  Score=19.61  Aligned_cols=27  Identities=11%  Similarity=0.262  Sum_probs=15.6

Q ss_pred             cCCCCCCCCCCCCCC-Cceecccccccc
Q psy2414          20 RNNTDSIFYPDPASP-GMYKCVICLKSV   46 (114)
Q Consensus        20 c~~c~~~f~~~~~~~-~~~~C~~C~~~f   46 (114)
                      |+.||.......... ..+.|+.|+..+
T Consensus         3 Cp~Cg~~l~~~~~~~~~~~vC~~Cg~~~   30 (52)
T smart00661        3 CPKCGNMLIPKEGKEKRRFVCRKCGYEE   30 (52)
T ss_pred             CCCCCCccccccCCCCCEEECCcCCCeE
Confidence            667776554442222 367777777554


No 77 
>KOG1146|consensus
Probab=70.63  E-value=0.57  Score=38.10  Aligned_cols=53  Identities=19%  Similarity=0.201  Sum_probs=36.5

Q ss_pred             CccCCCCcCcccChhHHHHHHHHHhCCCC----------------------CCccccCCCCCccCCCCCCCCCCC
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKRVHGLGI----------------------SRYIHGLIPQLLFPTPHAKTSPVD  112 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~~~~~~~----------------------~~~~~c~~c~~~f~~~~~L~~h~~  112 (114)
                      .+.|+.|+..+.....|-.|+|..|...+                      ..-+.|..|.-.+++..+|.+|++
T Consensus       465 t~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  465 TLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             cccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            67777787777777777777775222111                      011457889999999999988874


No 78 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=70.38  E-value=4.6  Score=23.28  Aligned_cols=25  Identities=28%  Similarity=0.669  Sum_probs=22.1

Q ss_pred             ccC----CCCcCcccChhHHHHHHHHHhC
Q psy2414          61 HKC----PYCESVYSRVDTLKLHAKRVHG   85 (114)
Q Consensus        61 ~~c----~~C~~~f~~~~~l~~H~~~~~~   85 (114)
                      |.|    ..|+..+.....+.+|.+.+|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    8899999999999999987663


No 79 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=69.52  E-value=2.9  Score=20.75  Aligned_cols=25  Identities=12%  Similarity=0.101  Sum_probs=11.0

Q ss_pred             cccCCCCCCCCCCCCCCCceeccccc
Q psy2414          18 ITRNNTDSIFYPDPASPGMYKCVICL   43 (114)
Q Consensus        18 ~~c~~c~~~f~~~~~~~~~~~C~~C~   43 (114)
                      +.|..||+.|... .......|+.|+
T Consensus         7 Y~C~~Cg~~~~~~-~~~~~irCp~Cg   31 (49)
T COG1996           7 YKCARCGREVELD-QETRGIRCPYCG   31 (49)
T ss_pred             EEhhhcCCeeehh-hccCceeCCCCC
Confidence            4455555555211 222334455554


No 80 
>KOG1146|consensus
Probab=68.98  E-value=4.1  Score=33.61  Aligned_cols=48  Identities=19%  Similarity=0.315  Sum_probs=37.0

Q ss_pred             CCceecccccccccChhh---HHhh---------------h----c------CC-CccCCCCcCcccChhHHHHHHH
Q psy2414          34 PGMYKCVICLKSVRSRWH---HLQT---------------H----F------SR-NHKCPYCESVYSRVDTLKLHAK   81 (114)
Q Consensus        34 ~~~~~C~~C~~~f~~~~~---h~~~---------------h----~------~~-~~~c~~C~~~f~~~~~l~~H~~   81 (114)
                      .+.+.|+.|+..++....   |++.               |    .      +. +|.|..|..++....+|.+|++
T Consensus       463 ~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  463 FKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             cccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            467899999988876643   6655               1    1      12 7899999999999999999975


No 81 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=68.77  E-value=3.4  Score=19.01  Aligned_cols=27  Identities=22%  Similarity=0.375  Sum_probs=18.0

Q ss_pred             CccccCCCCCCCCCCCCCCCceecccccc
Q psy2414          16 PFITRNNTDSIFYPDPASPGMYKCVICLK   44 (114)
Q Consensus        16 ~~~~c~~c~~~f~~~~~~~~~~~C~~C~~   44 (114)
                      +.+.|.+|+..+-.  ..+..+.|..|+-
T Consensus         7 ~~~~C~~C~~~~~~--~~dG~~yC~~cG~   33 (36)
T PF11781_consen    7 PNEPCPVCGSRWFY--SDDGFYYCDRCGH   33 (36)
T ss_pred             CCCcCCCCCCeEeE--ccCCEEEhhhCce
Confidence            44568888887444  4555677887763


No 82 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=68.67  E-value=4  Score=18.29  Aligned_cols=8  Identities=38%  Similarity=1.111  Sum_probs=3.6

Q ss_pred             CccCCCCc
Q psy2414          60 NHKCPYCE   67 (114)
Q Consensus        60 ~~~c~~C~   67 (114)
                      +..|+.||
T Consensus        17 ~irC~~CG   24 (32)
T PF03604_consen   17 PIRCPECG   24 (32)
T ss_dssp             TSSBSSSS
T ss_pred             cEECCcCC
Confidence            34444444


No 83 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=65.66  E-value=7.8  Score=22.78  Aligned_cols=18  Identities=6%  Similarity=-0.162  Sum_probs=9.4

Q ss_pred             cccCCCCCccCCCCCCCC
Q psy2414          92 IHGLIPQLLFPTPHAKTS  109 (114)
Q Consensus        92 ~~c~~c~~~f~~~~~L~~  109 (114)
                      |.|..|...|-..-++.-
T Consensus        82 y~C~~C~~~FC~dCD~fi   99 (112)
T TIGR00622        82 YVCAVCKNVFCVDCDVFV   99 (112)
T ss_pred             eeCCCCCCccccccchhh
Confidence            556666665554444333


No 84 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=64.99  E-value=18  Score=18.70  Aligned_cols=10  Identities=20%  Similarity=0.527  Sum_probs=5.2

Q ss_pred             ceeccccccc
Q psy2414          36 MYKCVICLKS   45 (114)
Q Consensus        36 ~~~C~~C~~~   45 (114)
                      .|.|+.||..
T Consensus        25 ~F~CPnCG~~   34 (59)
T PRK14890         25 KFLCPNCGEV   34 (59)
T ss_pred             EeeCCCCCCe
Confidence            3555555543


No 85 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=63.81  E-value=1.7  Score=26.57  Aligned_cols=39  Identities=21%  Similarity=0.364  Sum_probs=22.7

Q ss_pred             CCCceecccccccccChhh-HHhhhcCCCccCCCCcCcccC
Q psy2414          33 SPGMYKCVICLKSVRSRWH-HLQTHFSRNHKCPYCESVYSR   72 (114)
Q Consensus        33 ~~~~~~C~~C~~~f~~~~~-h~~~h~~~~~~c~~C~~~f~~   72 (114)
                      +..-|.|+.|+..|..... .....++ .|.|+.||.....
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~~d~~~-~f~Cp~Cg~~l~~  135 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQLLDMDG-TFTCPRCGEELEE  135 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHhcCCCC-cEECCCCCCEEEE
Confidence            3446788888877764432 1111111 4888888876543


No 86 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=63.41  E-value=3  Score=19.21  Aligned_cols=25  Identities=12%  Similarity=0.018  Sum_probs=10.5

Q ss_pred             cCCCCCCCCCCC-CCCCceecccccc
Q psy2414          20 RNNTDSIFYPDP-ASPGMYKCVICLK   44 (114)
Q Consensus        20 c~~c~~~f~~~~-~~~~~~~C~~C~~   44 (114)
                      |..||+.|.-.. .....-.|+.|+.
T Consensus         4 C~~Cg~~Yh~~~~pP~~~~~Cd~cg~   29 (36)
T PF05191_consen    4 CPKCGRIYHIEFNPPKVEGVCDNCGG   29 (36)
T ss_dssp             ETTTTEEEETTTB--SSTTBCTTTTE
T ss_pred             cCCCCCccccccCCCCCCCccCCCCC
Confidence            455555554433 2222334555543


No 87 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=63.34  E-value=5.6  Score=24.31  Aligned_cols=13  Identities=31%  Similarity=0.833  Sum_probs=7.0

Q ss_pred             ccCCCCcCcccCh
Q psy2414          61 HKCPYCESVYSRV   73 (114)
Q Consensus        61 ~~c~~C~~~f~~~   73 (114)
                      +.|+.||+.|..-
T Consensus       125 ~~C~~C~kiyW~G  137 (147)
T PF01927_consen  125 WRCPGCGKIYWEG  137 (147)
T ss_pred             EECCCCCCEeccc
Confidence            4555555555443


No 88 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=62.00  E-value=4.8  Score=22.68  Aligned_cols=29  Identities=17%  Similarity=0.209  Sum_probs=13.5

Q ss_pred             ccccCCCCCCCCCCCCCCCceecccccccc
Q psy2414          17 FITRNNTDSIFYPDPASPGMYKCVICLKSV   46 (114)
Q Consensus        17 ~~~c~~c~~~f~~~~~~~~~~~C~~C~~~f   46 (114)
                      .+.|+.|++.-.. ..+...|.|..|++.|
T Consensus        36 ~y~CpfCgk~~vk-R~a~GIW~C~~C~~~~   64 (90)
T PTZ00255         36 KYFCPFCGKHAVK-RQAVGIWRCKGCKKTV   64 (90)
T ss_pred             CccCCCCCCCcee-eeeeEEEEcCCCCCEE
Confidence            3456666542211 1233446666666554


No 89 
>PF11238 DUF3039:  Protein of unknown function (DUF3039);  InterPro: IPR021400  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=60.32  E-value=3.9  Score=21.01  Aligned_cols=27  Identities=11%  Similarity=0.201  Sum_probs=19.3

Q ss_pred             cCCCCCCCCCCCCCCCceecccccccc
Q psy2414          20 RNNTDSIFYPDPASPGMYKCVICLKSV   46 (114)
Q Consensus        20 c~~c~~~f~~~~~~~~~~~C~~C~~~f   46 (114)
                      -..||+.|.-....++.-.|+.|.+.+
T Consensus        28 vALCGk~wvp~rdp~~~PVCP~Ck~iy   54 (58)
T PF11238_consen   28 VALCGKVWVPTRDPKPFPVCPECKEIY   54 (58)
T ss_pred             EeeeCceeCCCCCCCCCCCCcCHHHHH
Confidence            357899998876555555788887654


No 90 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=59.78  E-value=11  Score=27.90  Aligned_cols=9  Identities=44%  Similarity=1.113  Sum_probs=5.7

Q ss_pred             CccCCCCcC
Q psy2414          60 NHKCPYCES   68 (114)
Q Consensus        60 ~~~c~~C~~   68 (114)
                      |..|+.|+.
T Consensus       253 ~~~Cp~C~s  261 (505)
T TIGR00595       253 PKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCC
Confidence            566666654


No 91 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=59.22  E-value=4.3  Score=17.93  Aligned_cols=24  Identities=13%  Similarity=0.101  Sum_probs=9.8

Q ss_pred             ccCCCCCCCCCCCCCCCceecccccc
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICLK   44 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~~   44 (114)
                      +|..|+..+.-  .....+.|++|+.
T Consensus         4 ~Cp~C~se~~y--~D~~~~vCp~C~~   27 (30)
T PF08274_consen    4 KCPLCGSEYTY--EDGELLVCPECGH   27 (30)
T ss_dssp             --TTT-----E--E-SSSEEETTTTE
T ss_pred             CCCCCCCccee--ccCCEEeCCcccc
Confidence            46666665544  3444567777764


No 92 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=58.86  E-value=6.3  Score=17.96  Aligned_cols=13  Identities=8%  Similarity=0.043  Sum_probs=5.4

Q ss_pred             ccCCCCCCCCCCC
Q psy2414          19 TRNNTDSIFYPDP   31 (114)
Q Consensus        19 ~c~~c~~~f~~~~   31 (114)
                      .|.+|++.|..+.
T Consensus         5 ~C~eC~~~f~dSy   17 (34)
T PF01286_consen    5 KCDECGKPFMDSY   17 (34)
T ss_dssp             E-TTT--EES-SS
T ss_pred             hHhHhCCHHHHHH
Confidence            4666666666654


No 93 
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=57.96  E-value=7  Score=20.35  Aligned_cols=29  Identities=17%  Similarity=0.021  Sum_probs=12.7

Q ss_pred             ccccCCCCCCCCCCCCCCCceecccccccccC
Q psy2414          17 FITRNNTDSIFYPDPASPGMYKCVICLKSVRS   48 (114)
Q Consensus        17 ~~~c~~c~~~f~~~~~~~~~~~C~~C~~~f~~   48 (114)
                      ...|..|++.|.   ...+.+.|..||..|-.
T Consensus         9 ~~~C~~C~~~F~---~~~rrhhCr~CG~~vC~   37 (69)
T PF01363_consen    9 ASNCMICGKKFS---LFRRRHHCRNCGRVVCS   37 (69)
T ss_dssp             -SB-TTT--B-B---SSS-EEE-TTT--EEEC
T ss_pred             CCcCcCcCCcCC---CceeeEccCCCCCEECC
Confidence            345788888883   23566778877776643


No 94 
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=57.74  E-value=4.9  Score=22.69  Aligned_cols=28  Identities=14%  Similarity=0.196  Sum_probs=12.8

Q ss_pred             cccCCCCCCCCCCCCCCCceecccccccc
Q psy2414          18 ITRNNTDSIFYPDPASPGMYKCVICLKSV   46 (114)
Q Consensus        18 ~~c~~c~~~f~~~~~~~~~~~C~~C~~~f   46 (114)
                      +.|+.|++.-.. ..+...|.|..|++.|
T Consensus        36 y~CpfCgk~~vk-R~a~GIW~C~~C~~~~   63 (91)
T TIGR00280        36 YVCPFCGKKTVK-RGSTGIWTCRKCGAKF   63 (91)
T ss_pred             ccCCCCCCCceE-EEeeEEEEcCCCCCEE
Confidence            455666542211 1233345566665554


No 95 
>KOG3214|consensus
Probab=57.59  E-value=1.9  Score=24.67  Aligned_cols=22  Identities=27%  Similarity=0.218  Sum_probs=13.1

Q ss_pred             cccCCCCCccCC-CCCCCCCCCC
Q psy2414          92 IHGLIPQLLFPT-PHAKTSPVDR  113 (114)
Q Consensus        92 ~~c~~c~~~f~~-~~~L~~h~~~  113 (114)
                      ..|.+|+.+|++ ...|..+|++
T Consensus        48 ~sC~iC~esFqt~it~LsepIDV   70 (109)
T KOG3214|consen   48 ASCRICEESFQTTITALSEPIDV   70 (109)
T ss_pred             eeeeehhhhhccchHhhccchHH
Confidence            456677777766 3455555543


No 96 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=57.25  E-value=4.2  Score=21.90  Aligned_cols=7  Identities=0%  Similarity=-0.292  Sum_probs=3.3

Q ss_pred             ccCCCCC
Q psy2414          19 TRNNTDS   25 (114)
Q Consensus        19 ~c~~c~~   25 (114)
                      .|..||.
T Consensus         3 ~CP~Cg~    9 (72)
T PRK09678          3 HCPLCQH    9 (72)
T ss_pred             cCCCCCC
Confidence            3455543


No 97 
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=56.53  E-value=9.8  Score=21.73  Aligned_cols=34  Identities=9%  Similarity=0.088  Sum_probs=15.0

Q ss_pred             CccccCCCCCCCCCCC---CCCCce-ecccccccccCh
Q psy2414          16 PFITRNNTDSIFYPDP---ASPGMY-KCVICLKSVRSR   49 (114)
Q Consensus        16 ~~~~c~~c~~~f~~~~---~~~~~~-~C~~C~~~f~~~   49 (114)
                      +-..|..||+++..-.   .|++.| -|+.|.+.|..-
T Consensus        13 ke~~CalCG~tWg~~y~Ev~G~rLfFCCd~ca~EF~nm   50 (105)
T PF11494_consen   13 KEMGCALCGATWGDYYEEVDGERLFFCCDDCAKEFKNM   50 (105)
T ss_dssp             GGGS-SS---S---SS-B-TT--BSSS--SSSS-TTS-
T ss_pred             ccccccccCCcHHHHHHhhcCCEEEEEcHHHHHHHHHH
Confidence            4567999999888665   677764 568898888665


No 98 
>KOG4173|consensus
Probab=56.33  E-value=1.9  Score=28.17  Aligned_cols=51  Identities=16%  Similarity=0.339  Sum_probs=31.8

Q ss_pred             ccCCCCcCcccChhHHHHHHHHHhC------CCC-CCccccCC--CCCccCCCCCCCCCC
Q psy2414          61 HKCPYCESVYSRVDTLKLHAKRVHG------LGI-SRYIHGLI--PQLLFPTPHAKTSPV  111 (114)
Q Consensus        61 ~~c~~C~~~f~~~~~l~~H~~~~~~------~~~-~~~~~c~~--c~~~f~~~~~L~~h~  111 (114)
                      -.|..|.+.|.+..-|..||...|.      .++ ..-|.|..  |+..|.+..+-.+|+
T Consensus       107 ~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~  166 (253)
T KOG4173|consen  107 NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHM  166 (253)
T ss_pred             chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHH
Confidence            4677888888887777777632221      011 23356643  888888877766665


No 99 
>KOG4167|consensus
Probab=55.87  E-value=2.6  Score=32.59  Aligned_cols=26  Identities=19%  Similarity=0.411  Sum_probs=22.6

Q ss_pred             CccCCCCcCcccChhHHHHHHHHHhC
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKRVHG   85 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~~~~   85 (114)
                      -|.|+.|++.|-..-+++.||++|-.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            48999999999999999999987543


No 100
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=55.85  E-value=4.3  Score=18.47  Aligned_cols=25  Identities=8%  Similarity=-0.020  Sum_probs=9.5

Q ss_pred             cCCCCCCCCCCC---CCCCceecccccc
Q psy2414          20 RNNTDSIFYPDP---ASPGMYKCVICLK   44 (114)
Q Consensus        20 c~~c~~~f~~~~---~~~~~~~C~~C~~   44 (114)
                      |..||......-   .+...+.|+.|+.
T Consensus         3 C~~CG~~l~~~ip~gd~r~R~vC~~Cg~   30 (34)
T PF14803_consen    3 CPQCGGPLERRIPEGDDRERLVCPACGF   30 (34)
T ss_dssp             -TTT--B-EEE--TT-SS-EEEETTTTE
T ss_pred             cccccChhhhhcCCCCCccceECCCCCC
Confidence            566665544432   2223456666664


No 101
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=55.45  E-value=2.4  Score=26.96  Aligned_cols=33  Identities=15%  Similarity=0.421  Sum_probs=20.1

Q ss_pred             CCceecccccccccChhhHHhhhcCC-CccCCCCcCcccC
Q psy2414          34 PGMYKCVICLKSVRSRWHHLQTHFSR-NHKCPYCESVYSR   72 (114)
Q Consensus        34 ~~~~~C~~C~~~f~~~~~h~~~h~~~-~~~c~~C~~~f~~   72 (114)
                      ..-|.|+.|+..|..... +     + .|.|+.||.....
T Consensus       115 ~~~Y~Cp~C~~rytf~eA-~-----~~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEA-M-----EYGFRCPQCGEMLEE  148 (178)
T ss_pred             CCEEECCCCCcEEeHHHH-h-----hcCCcCCCCCCCCee
Confidence            345778888766644321 1     2 4888888876543


No 102
>PRK14873 primosome assembly protein PriA; Provisional
Probab=55.05  E-value=12  Score=28.83  Aligned_cols=10  Identities=40%  Similarity=1.046  Sum_probs=5.8

Q ss_pred             CccCCCCcCc
Q psy2414          60 NHKCPYCESV   69 (114)
Q Consensus        60 ~~~c~~C~~~   69 (114)
                      |+.|+.||..
T Consensus       422 p~~Cp~Cgs~  431 (665)
T PRK14873        422 DWRCPRCGSD  431 (665)
T ss_pred             CccCCCCcCC
Confidence            5666666543


No 103
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=55.03  E-value=8.1  Score=22.65  Aligned_cols=28  Identities=18%  Similarity=0.052  Sum_probs=17.0

Q ss_pred             cCCCCCCCCCCCCCCCceecccccccccCh
Q psy2414          20 RNNTDSIFYPDPASPGMYKCVICLKSVRSR   49 (114)
Q Consensus        20 c~~c~~~f~~~~~~~~~~~C~~C~~~f~~~   49 (114)
                      |+.||+.|-.  .++.|-.|+.||+.|..+
T Consensus        12 dPetg~KFYD--LNrdPiVsPytG~s~P~s   39 (129)
T COG4530          12 DPETGKKFYD--LNRDPIVSPYTGKSYPRS   39 (129)
T ss_pred             Cccccchhhc--cCCCccccCcccccchHH
Confidence            5666666644  455666677777666433


No 104
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=54.45  E-value=17  Score=15.13  Aligned_cols=7  Identities=29%  Similarity=0.880  Sum_probs=2.9

Q ss_pred             eeccccc
Q psy2414          37 YKCVICL   43 (114)
Q Consensus        37 ~~C~~C~   43 (114)
                      |.|+.||
T Consensus        17 f~CPnCG   23 (24)
T PF07754_consen   17 FPCPNCG   23 (24)
T ss_pred             EeCCCCC
Confidence            4444443


No 105
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=53.58  E-value=11  Score=18.66  Aligned_cols=26  Identities=12%  Similarity=0.083  Sum_probs=14.1

Q ss_pred             ccCCCCCCCCCCCCCCCceeccccccccc
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICLKSVR   47 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~~~f~   47 (114)
                      .|..|++.|..   ..+.+.|..|++.|-
T Consensus         4 ~C~~C~~~F~~---~~rk~~Cr~Cg~~~C   29 (57)
T cd00065           4 SCMGCGKPFTL---TRRRHHCRNCGRIFC   29 (57)
T ss_pred             cCcccCccccC---CccccccCcCcCCcC
Confidence            35666666654   223455666665543


No 106
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=53.54  E-value=13  Score=18.40  Aligned_cols=25  Identities=16%  Similarity=0.206  Sum_probs=13.0

Q ss_pred             ccCCCCCCCCCCCCCCCceeccccccc
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICLKS   45 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~~~   45 (114)
                      .|+.||..|...  .+..+.|..|+..
T Consensus        22 fCP~Cg~~~m~~--~~~r~~C~~Cgyt   46 (50)
T PRK00432         22 FCPRCGSGFMAE--HLDRWHCGKCGYT   46 (50)
T ss_pred             cCcCCCcchhec--cCCcEECCCcCCE
Confidence            466666543332  2245666666643


No 107
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=53.39  E-value=9.9  Score=27.61  Aligned_cols=30  Identities=10%  Similarity=0.195  Sum_probs=22.7

Q ss_pred             ccCCCCCCCCCCCCCCCceecccccccccChh
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICLKSVRSRW   50 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~~~f~~~~   50 (114)
                      .|+.||.+-.+.  |..-|.|..|+..+....
T Consensus       352 ~Cp~Cg~~m~S~--G~~g~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCGGRMKSA--GRNGFRCKKCGTRARETL  381 (421)
T ss_pred             CCCccCCchhhc--CCCCcccccccccCCccc
Confidence            599999987764  555899999998775543


No 108
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=52.70  E-value=7.3  Score=23.53  Aligned_cols=26  Identities=12%  Similarity=0.148  Sum_probs=17.9

Q ss_pred             cccCCCCCCCCCCCCCCCceecccccc
Q psy2414          18 ITRNNTDSIFYPDPASPGMYKCVICLK   44 (114)
Q Consensus        18 ~~c~~c~~~f~~~~~~~~~~~C~~C~~   44 (114)
                      .+|-.||+.|...+ .+-.-.|+.||.
T Consensus         2 H~Ct~Cg~~f~dgs-~eil~GCP~CGg   27 (131)
T PF09845_consen    2 HQCTKCGRVFEDGS-KEILSGCPECGG   27 (131)
T ss_pred             cccCcCCCCcCCCc-HHHHccCcccCC
Confidence            46888999998653 234456888873


No 109
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=52.57  E-value=5.3  Score=18.92  Aligned_cols=27  Identities=19%  Similarity=0.031  Sum_probs=12.2

Q ss_pred             ccCCCCCCCCCCCCCCCceeccccccc
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICLKS   45 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~~~   45 (114)
                      .|+.|+....--.....-+.|..||..
T Consensus         2 ~Cp~Cg~~~~~~D~~~g~~vC~~CG~V   28 (43)
T PF08271_consen    2 KCPNCGSKEIVFDPERGELVCPNCGLV   28 (43)
T ss_dssp             SBTTTSSSEEEEETTTTEEEETTT-BB
T ss_pred             CCcCCcCCceEEcCCCCeEECCCCCCE
Confidence            466666543111123334566666644


No 110
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=52.39  E-value=11  Score=22.26  Aligned_cols=26  Identities=19%  Similarity=0.406  Sum_probs=15.0

Q ss_pred             CccccCCCCCCCCCCCCCCCce-ecccccc
Q psy2414          16 PFITRNNTDSIFYPDPASPGMY-KCVICLK   44 (114)
Q Consensus        16 ~~~~c~~c~~~f~~~~~~~~~~-~C~~C~~   44 (114)
                      ....|..||..|....   ..+ .|+.|+.
T Consensus        70 ~~~~C~~Cg~~~~~~~---~~~~~CP~Cgs   96 (117)
T PRK00564         70 VELECKDCSHVFKPNA---LDYGVCEKCHS   96 (117)
T ss_pred             CEEEhhhCCCccccCC---ccCCcCcCCCC
Confidence            3456888887664431   123 4777774


No 111
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=51.89  E-value=6.6  Score=22.15  Aligned_cols=28  Identities=11%  Similarity=0.160  Sum_probs=12.2

Q ss_pred             cccCCCCCCCCCCCCCCCceecccccccc
Q psy2414          18 ITRNNTDSIFYPDPASPGMYKCVICLKSV   46 (114)
Q Consensus        18 ~~c~~c~~~f~~~~~~~~~~~C~~C~~~f   46 (114)
                      +.|+.|++.-... .+...|.|..|++.|
T Consensus        37 y~CpfCgk~~vkR-~a~GIW~C~~C~~~~   64 (90)
T PRK03976         37 HVCPVCGRPKVKR-VGTGIWECRKCGAKF   64 (90)
T ss_pred             ccCCCCCCCceEE-EEEEEEEcCCCCCEE
Confidence            4455554321111 223345555555554


No 112
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=51.53  E-value=7.8  Score=30.04  Aligned_cols=14  Identities=36%  Similarity=0.508  Sum_probs=7.5

Q ss_pred             CccccCCCCCCCCC
Q psy2414          16 PFITRNNTDSIFYP   29 (114)
Q Consensus        16 ~~~~c~~c~~~f~~   29 (114)
                      |++-|..||-+|+-
T Consensus       122 PF~~CT~CGPRfTI  135 (750)
T COG0068         122 PFINCTNCGPRFTI  135 (750)
T ss_pred             cccccCCCCcceee
Confidence            44555555555544


No 113
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=50.79  E-value=3  Score=25.94  Aligned_cols=34  Identities=15%  Similarity=0.328  Sum_probs=20.4

Q ss_pred             CCCceecccccccccChhhHHhhhcCCCccCCCCcCccc
Q psy2414          33 SPGMYKCVICLKSVRSRWHHLQTHFSRNHKCPYCESVYS   71 (114)
Q Consensus        33 ~~~~~~C~~C~~~f~~~~~h~~~h~~~~~~c~~C~~~f~   71 (114)
                      +..-|.|+.|+..|..... +.    ..|.|+.||....
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA-~~----~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEA-ME----LNFTCPRCGAMLD  139 (158)
T ss_pred             CCCeEECCCCCcEeeHHHH-HH----cCCcCCCCCCEee
Confidence            3445788888866644321 11    1488888887654


No 114
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=50.48  E-value=10  Score=22.26  Aligned_cols=25  Identities=8%  Similarity=0.057  Sum_probs=13.7

Q ss_pred             cccCCCCCCCCCCCCCCCceecccccc
Q psy2414          18 ITRNNTDSIFYPDPASPGMYKCVICLK   44 (114)
Q Consensus        18 ~~c~~c~~~f~~~~~~~~~~~C~~C~~   44 (114)
                      ..|..|+..|....  ...+.|+.|+.
T Consensus        71 ~~C~~Cg~~~~~~~--~~~~~CP~Cgs   95 (114)
T PRK03681         71 CWCETCQQYVTLLT--QRVRRCPQCHG   95 (114)
T ss_pred             EEcccCCCeeecCC--ccCCcCcCcCC
Confidence            45777776664421  11245777763


No 115
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=49.59  E-value=13  Score=18.45  Aligned_cols=8  Identities=38%  Similarity=1.182  Sum_probs=4.8

Q ss_pred             CccCCCCc
Q psy2414          60 NHKCPYCE   67 (114)
Q Consensus        60 ~~~c~~C~   67 (114)
                      .|.|+.|+
T Consensus        34 ~w~CP~C~   41 (50)
T cd00730          34 DWVCPVCG   41 (50)
T ss_pred             CCCCCCCC
Confidence            35666665


No 116
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=49.19  E-value=12  Score=21.80  Aligned_cols=29  Identities=14%  Similarity=0.148  Sum_probs=18.7

Q ss_pred             ccCCCCCCCCCCCCCCCceecccccccccCh
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICLKSVRSR   49 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~~~f~~~   49 (114)
                      .|+.|+..|..  .....|.|++|+..+...
T Consensus         4 ~CP~C~seytY--~dg~~~iCpeC~~EW~~~   32 (109)
T TIGR00686         4 PCPKCNSEYTY--HDGTQLICPSCLYEWNEN   32 (109)
T ss_pred             cCCcCCCcceE--ecCCeeECcccccccccc
Confidence            47777766655  333468888888766433


No 117
>KOG2593|consensus
Probab=49.10  E-value=10  Score=27.50  Aligned_cols=14  Identities=36%  Similarity=0.510  Sum_probs=6.6

Q ss_pred             ceecccccccccCh
Q psy2414          36 MYKCVICLKSVRSR   49 (114)
Q Consensus        36 ~~~C~~C~~~f~~~   49 (114)
                      .|.|+.|.+.|...
T Consensus       128 ~Y~Cp~C~kkyt~L  141 (436)
T KOG2593|consen  128 GYVCPNCQKKYTSL  141 (436)
T ss_pred             cccCCccccchhhh
Confidence            34555555444333


No 118
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=48.70  E-value=5.9  Score=27.37  Aligned_cols=34  Identities=15%  Similarity=0.208  Sum_probs=23.0

Q ss_pred             ccccCCCCCCCCCCCCCCCceecccccccccChh
Q psy2414          17 FITRNNTDSIFYPDPASPGMYKCVICLKSVRSRW   50 (114)
Q Consensus        17 ~~~c~~c~~~f~~~~~~~~~~~C~~C~~~f~~~~   50 (114)
                      -.+|+.|+.....+...+..+.|+.|+.-|....
T Consensus        38 w~kc~~C~~~~~~~~l~~~~~vcp~c~~h~rltA   71 (296)
T CHL00174         38 WVQCENCYGLNYKKFLKSKMNICEQCGYHLKMSS   71 (296)
T ss_pred             eeECCCccchhhHHHHHHcCCCCCCCCCCcCCCH
Confidence            3568888877766655555677888887665443


No 119
>KOG2231|consensus
Probab=48.45  E-value=7.9  Score=29.77  Aligned_cols=12  Identities=17%  Similarity=0.074  Sum_probs=8.9

Q ss_pred             cccCCCCCCCCC
Q psy2414          18 ITRNNTDSIFYP   29 (114)
Q Consensus        18 ~~c~~c~~~f~~   29 (114)
                      ..|.+|+..|.-
T Consensus       100 ~~C~~C~~~~~~  111 (669)
T KOG2231|consen  100 HSCHICDRRFRA  111 (669)
T ss_pred             hhcCccccchhh
Confidence            468888888844


No 120
>KOG2041|consensus
Probab=48.17  E-value=11  Score=29.61  Aligned_cols=80  Identities=20%  Similarity=0.299  Sum_probs=45.7

Q ss_pred             CCcCCCCCCCCCCCCccccCCCCCCCCCCCCCCCceecccccccccChhhHHhhhcCC-CccCCCCcCcccChhHHHHHH
Q psy2414           2 FGFKSRYPPTSPIQPFITRNNTDSIFYPDPASPGMYKCVICLKSVRSRWHHLQTHFSR-NHKCPYCESVYSRVDTLKLHA   80 (114)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~c~~c~~~f~~~~~~~~~~~C~~C~~~f~~~~~h~~~h~~~-~~~c~~C~~~f~~~~~l~~H~   80 (114)
                      ++.++.++...+..+-.-|..||..-...     ...|++|.-.|..=-..-+.-+.. -|-|+.|.           | 
T Consensus      1102 ~~iFsk~~p~d~~~~~vdc~~cg~~i~~~-----~~~c~ec~~kfP~CiasG~pIt~~~fWlC~~Ck-----------H- 1164 (1189)
T KOG2041|consen 1102 FRIFSKNPPVDPNSAKVDCSVCGAKIDPY-----DLQCSECQTKFPVCIASGRPITDNIFWLCPRCK-----------H- 1164 (1189)
T ss_pred             HHHhccCCCCCCCccceeeeecCCcCCcc-----CCCChhhcCcCceeeccCCccccceEEEccccc-----------c-
Confidence            34566777777777777888888644333     246888876663321111111122 36666662           2 


Q ss_pred             HHHhCCCCCCccccCCCCC
Q psy2414          81 KRVHGLGISRYIHGLIPQL   99 (114)
Q Consensus        81 ~~~~~~~~~~~~~c~~c~~   99 (114)
                      + .+..+.+.|.+|+.|-.
T Consensus      1165 ~-a~~~EIs~y~~CPLCHs 1182 (1189)
T KOG2041|consen 1165 R-AHQHEISKYNCCPLCHS 1182 (1189)
T ss_pred             c-cccccccccccCccccC
Confidence            2 24446677888888865


No 121
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=48.16  E-value=12  Score=22.62  Aligned_cols=24  Identities=29%  Similarity=0.523  Sum_probs=15.0

Q ss_pred             CceecccccccccChhhHHhhhcC
Q psy2414          35 GMYKCVICLKSVRSRWHHLQTHFS   58 (114)
Q Consensus        35 ~~~~C~~C~~~f~~~~~h~~~h~~   58 (114)
                      ..-.|-+||+.|.....|++.|.|
T Consensus        71 d~i~clecGk~~k~LkrHL~~~~g   94 (132)
T PF05443_consen   71 DYIICLECGKKFKTLKRHLRTHHG   94 (132)
T ss_dssp             S-EE-TBT--EESBHHHHHHHTT-
T ss_pred             CeeEEccCCcccchHHHHHHHccC
Confidence            346799999999888668888854


No 122
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=48.03  E-value=17  Score=18.84  Aligned_cols=25  Identities=12%  Similarity=0.058  Sum_probs=9.9

Q ss_pred             cCCCCCCCCCCCCCCCceeccccccc
Q psy2414          20 RNNTDSIFYPDPASPGMYKCVICLKS   45 (114)
Q Consensus        20 c~~c~~~f~~~~~~~~~~~C~~C~~~   45 (114)
                      |..||..-.. ....+.+.|+.|+..
T Consensus        31 C~~CG~~~~~-~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   31 CPRCGHRNKK-RRSGRVFTCPNCGFE   55 (69)
T ss_pred             ccCccccccc-ccccceEEcCCCCCE
Confidence            4444443333 122334444444433


No 123
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=47.59  E-value=19  Score=26.61  Aligned_cols=30  Identities=23%  Similarity=0.510  Sum_probs=23.7

Q ss_pred             CccCCCCcCcccChhHHHHHHHHHhCCCCC
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKRVHGLGIS   89 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~   89 (114)
                      =+.|+.|.+.|.....+..|+...|.+.-.
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~~l~   86 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPAGLK   86 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhhhcC
Confidence            368888999999999999998766765543


No 124
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=47.43  E-value=19  Score=25.13  Aligned_cols=42  Identities=17%  Similarity=0.213  Sum_probs=27.7

Q ss_pred             ccccCCCCCCCCCCC------CCCCceecccccccccChhhHHhhhcCCCccCCCCcC
Q psy2414          17 FITRNNTDSIFYPDP------ASPGMYKCVICLKSVRSRWHHLQTHFSRNHKCPYCES   68 (114)
Q Consensus        17 ~~~c~~c~~~f~~~~------~~~~~~~C~~C~~~f~~~~~h~~~h~~~~~~c~~C~~   68 (114)
                      ...|++||....-..      .|.+...|..|+-.+...          ..+|..||.
T Consensus       187 ~~~CPvCGs~P~~s~v~~~~~~G~RyL~CslC~teW~~~----------R~~C~~Cg~  234 (309)
T PRK03564        187 RQFCPVCGSMPVSSVVQIGTTQGLRYLHCNLCESEWHVV----------RVKCSNCEQ  234 (309)
T ss_pred             CCCCCCCCCcchhheeeccCCCCceEEEcCCCCCccccc----------CccCCCCCC
Confidence            457999998764331      456677899998443111          377888885


No 125
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=47.06  E-value=18  Score=18.33  Aligned_cols=27  Identities=11%  Similarity=0.033  Sum_probs=18.7

Q ss_pred             ccccCCCCCCCCCCCCCCCceecccccccc
Q psy2414          17 FITRNNTDSIFYPDPASPGMYKCVICLKSV   46 (114)
Q Consensus        17 ~~~c~~c~~~f~~~~~~~~~~~C~~C~~~f   46 (114)
                      .-+|..||+.|...   +--..|++|+..+
T Consensus         5 ~~~C~~Cg~~~~~~---dDiVvCp~Cgapy   31 (54)
T PF14446_consen    5 GCKCPVCGKKFKDG---DDIVVCPECGAPY   31 (54)
T ss_pred             CccChhhCCcccCC---CCEEECCCCCCcc
Confidence            45688999888543   3346788888665


No 126
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=46.79  E-value=19  Score=25.04  Aligned_cols=43  Identities=16%  Similarity=0.198  Sum_probs=27.9

Q ss_pred             ccccCCCCCCCCCCC-------CCCCceecccccccccChhhHHhhhcCCCccCCCCcCc
Q psy2414          17 FITRNNTDSIFYPDP-------ASPGMYKCVICLKSVRSRWHHLQTHFSRNHKCPYCESV   69 (114)
Q Consensus        17 ~~~c~~c~~~f~~~~-------~~~~~~~C~~C~~~f~~~~~h~~~h~~~~~~c~~C~~~   69 (114)
                      ...|.+||....-..       .|.+...|..|+-.+...          ..+|..||..
T Consensus       184 ~~~CPvCGs~P~~s~~~~~~~~~G~RyL~CslC~teW~~~----------R~~C~~Cg~~  233 (305)
T TIGR01562       184 RTLCPACGSPPVASMVRQGGKETGLRYLSCSLCATEWHYV----------RVKCSHCEES  233 (305)
T ss_pred             CCcCCCCCChhhhhhhcccCCCCCceEEEcCCCCCccccc----------CccCCCCCCC
Confidence            347999998764321       455677899998443111          3778888863


No 127
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=46.59  E-value=19  Score=24.37  Aligned_cols=32  Identities=16%  Similarity=0.310  Sum_probs=15.8

Q ss_pred             CccccCCCCCCCCCCC----CCCCceeccccccccc
Q psy2414          16 PFITRNNTDSIFYPDP----ASPGMYKCVICLKSVR   47 (114)
Q Consensus        16 ~~~~c~~c~~~f~~~~----~~~~~~~C~~C~~~f~   47 (114)
                      +..+|..|.+.|....    .|..-|.|+.|+..|.
T Consensus       131 eVSRCr~C~~rYDPVP~dkmwG~aef~C~~C~h~F~  166 (278)
T PF15135_consen  131 EVSRCRKCRKRYDPVPCDKMWGIAEFHCPKCRHNFR  166 (278)
T ss_pred             ccccccccccccCCCccccccceeeeecccccccch
Confidence            3444555555443332    2333466666666554


No 128
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=46.54  E-value=11  Score=22.81  Aligned_cols=9  Identities=56%  Similarity=1.040  Sum_probs=5.0

Q ss_pred             CccCCCCcC
Q psy2414          60 NHKCPYCES   68 (114)
Q Consensus        60 ~~~c~~C~~   68 (114)
                      .+.|+.||.
T Consensus       107 ~~~CP~Cgs  115 (135)
T PRK03824        107 FLKCPKCGS  115 (135)
T ss_pred             CcCCcCCCC
Confidence            355666663


No 129
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=46.52  E-value=5.1  Score=22.59  Aligned_cols=28  Identities=21%  Similarity=0.309  Sum_probs=12.3

Q ss_pred             cccCCCCCCCCCCCCCCCceecccccccc
Q psy2414          18 ITRNNTDSIFYPDPASPGMYKCVICLKSV   46 (114)
Q Consensus        18 ~~c~~c~~~f~~~~~~~~~~~C~~C~~~f   46 (114)
                      +.|+.||+.-... ....-|.|..|++.|
T Consensus        36 y~Cp~Cgk~~vkR-~a~GIW~C~~C~~~~   63 (90)
T PF01780_consen   36 YTCPFCGKTSVKR-VATGIWKCKKCGKKF   63 (90)
T ss_dssp             BEESSSSSSEEEE-EETTEEEETTTTEEE
T ss_pred             CcCCCCCCceeEE-eeeEEeecCCCCCEE
Confidence            4455555432111 222235555555554


No 130
>PRK10220 hypothetical protein; Provisional
Probab=46.49  E-value=19  Score=21.10  Aligned_cols=29  Identities=21%  Similarity=0.353  Sum_probs=19.1

Q ss_pred             ccCCCCCCCCCCCCCCCceecccccccccCh
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICLKSVRSR   49 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~~~f~~~   49 (114)
                      .|+.|+..|..  .....|.|++|+-.|...
T Consensus         5 ~CP~C~seytY--~d~~~~vCpeC~hEW~~~   33 (111)
T PRK10220          5 HCPKCNSEYTY--EDNGMYICPECAHEWNDA   33 (111)
T ss_pred             cCCCCCCcceE--cCCCeEECCcccCcCCcc
Confidence            47788776655  334468888888666443


No 131
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=46.43  E-value=16  Score=23.05  Aligned_cols=18  Identities=22%  Similarity=0.654  Sum_probs=10.9

Q ss_pred             ccCCCCcCcccChhHHHH
Q psy2414          61 HKCPYCESVYSRVDTLKL   78 (114)
Q Consensus        61 ~~c~~C~~~f~~~~~l~~   78 (114)
                      +.|+.||+.|..-+.+..
T Consensus       131 ~~C~~CgkiYW~GsHw~~  148 (165)
T COG1656         131 YRCPKCGKIYWKGSHWRR  148 (165)
T ss_pred             eECCCCcccccCchHHHH
Confidence            457777776666555543


No 132
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=45.69  E-value=9.6  Score=18.68  Aligned_cols=13  Identities=23%  Similarity=0.654  Sum_probs=7.7

Q ss_pred             eecccccccccCh
Q psy2414          37 YKCVICLKSVRSR   49 (114)
Q Consensus        37 ~~C~~C~~~f~~~   49 (114)
                      |.|..|+..+-..
T Consensus         2 y~C~~CgyvYd~~   14 (47)
T PF00301_consen    2 YQCPVCGYVYDPE   14 (47)
T ss_dssp             EEETTTSBEEETT
T ss_pred             cCCCCCCEEEcCC
Confidence            5666777665443


No 133
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=45.33  E-value=12  Score=21.83  Aligned_cols=24  Identities=8%  Similarity=-0.000  Sum_probs=13.8

Q ss_pred             ccccCCCCCCCCCCCCCCCceeccccc
Q psy2414          17 FITRNNTDSIFYPDPASPGMYKCVICL   43 (114)
Q Consensus        17 ~~~c~~c~~~f~~~~~~~~~~~C~~C~   43 (114)
                      ...|..||..|...   +..+.|+.|+
T Consensus        70 ~~~C~~Cg~~~~~~---~~~~~CP~Cg   93 (113)
T PRK12380         70 QAWCWDCSQVVEIH---QHDAQCPHCH   93 (113)
T ss_pred             EEEcccCCCEEecC---CcCccCcCCC
Confidence            34677777666442   1234577776


No 134
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=45.12  E-value=17  Score=25.93  Aligned_cols=34  Identities=21%  Similarity=0.402  Sum_probs=24.6

Q ss_pred             CccCCCCcCcccChhHHHHHHHHHhCCCCCCccccCCCCCc
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLL  100 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~c~~c~~~  100 (114)
                      .-.|..|...|-+...|..|++..|       ..|.+|++.
T Consensus       220 HP~C~FC~~~FYdDDEL~~HcR~~H-------E~ChICD~v  253 (493)
T COG5236         220 HPLCIFCKIYFYDDDELRRHCRLRH-------EACHICDMV  253 (493)
T ss_pred             CchhhhccceecChHHHHHHHHhhh-------hhhhhhhcc
Confidence            3467778888888888888888644       346677664


No 135
>KOG2893|consensus
Probab=44.91  E-value=6.1  Score=26.50  Aligned_cols=42  Identities=17%  Similarity=0.179  Sum_probs=26.1

Q ss_pred             CCCCcCcccChhHHHHHHHHHhCCCCCCccccCCCCCccCCCCCCCCCC
Q psy2414          63 CPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFPTPHAKTSPV  111 (114)
Q Consensus        63 c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~c~~c~~~f~~~~~L~~h~  111 (114)
                      |=+|++.|.+..-|.+|++..       +|+|.+|-|.+-+--.|..|-
T Consensus        13 cwycnrefddekiliqhqkak-------hfkchichkkl~sgpglsihc   54 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKAK-------HFKCHICHKKLFSGPGLSIHC   54 (341)
T ss_pred             eeecccccchhhhhhhhhhhc-------cceeeeehhhhccCCCceeeh
Confidence            555777777777777766532       277777766554444555554


No 136
>PRK05580 primosome assembly protein PriA; Validated
Probab=44.49  E-value=28  Score=26.91  Aligned_cols=10  Identities=40%  Similarity=0.953  Sum_probs=5.7

Q ss_pred             CccCCCCcCc
Q psy2414          60 NHKCPYCESV   69 (114)
Q Consensus        60 ~~~c~~C~~~   69 (114)
                      |..|+.||..
T Consensus       421 ~~~Cp~Cg~~  430 (679)
T PRK05580        421 PKACPECGST  430 (679)
T ss_pred             CCCCCCCcCC
Confidence            5566666543


No 137
>COG1773 Rubredoxin [Energy production and conversion]
Probab=44.41  E-value=17  Score=18.50  Aligned_cols=8  Identities=38%  Similarity=1.115  Sum_probs=4.9

Q ss_pred             CccCCCCc
Q psy2414          60 NHKCPYCE   67 (114)
Q Consensus        60 ~~~c~~C~   67 (114)
                      .+.|+.||
T Consensus        36 ~w~CP~Cg   43 (55)
T COG1773          36 DWVCPECG   43 (55)
T ss_pred             ccCCCCCC
Confidence            36666665


No 138
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=44.38  E-value=25  Score=17.13  Aligned_cols=23  Identities=26%  Similarity=0.287  Sum_probs=16.9

Q ss_pred             CccCCCCcCcccChhHHHHHHHH
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKR   82 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~   82 (114)
                      .|+|-+|.-.....+.|-.||+.
T Consensus        20 ~ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   20 KYKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             cceeecCCcccchHHHHHHHHHH
Confidence            46777787777777788777763


No 139
>PRK01343 zinc-binding protein; Provisional
Probab=43.97  E-value=28  Score=17.85  Aligned_cols=17  Identities=12%  Similarity=0.087  Sum_probs=12.0

Q ss_pred             CCCCccccCCCCCCCCC
Q psy2414          13 PIQPFITRNNTDSIFYP   29 (114)
Q Consensus        13 ~~~~~~~c~~c~~~f~~   29 (114)
                      +..+...|.+|++.+..
T Consensus         5 ~~~p~~~CP~C~k~~~~   21 (57)
T PRK01343          5 PLRPTRPCPECGKPSTR   21 (57)
T ss_pred             cCCCCCcCCCCCCcCcC
Confidence            44567788888887753


No 140
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=43.85  E-value=23  Score=17.93  Aligned_cols=27  Identities=7%  Similarity=0.036  Sum_probs=13.2

Q ss_pred             ccCCCCCCCCCCC-CCCCceeccccccc
Q psy2414          19 TRNNTDSIFYPDP-ASPGMYKCVICLKS   45 (114)
Q Consensus        19 ~c~~c~~~f~~~~-~~~~~~~C~~C~~~   45 (114)
                      +|..||..+.-.. .......|+.|+..
T Consensus         4 ~CP~CG~~iev~~~~~GeiV~Cp~CGae   31 (54)
T TIGR01206         4 ECPDCGAEIELENPELGELVICDECGAE   31 (54)
T ss_pred             CCCCCCCEEecCCCccCCEEeCCCCCCE
Confidence            5666666554332 11223456666644


No 141
>PRK12496 hypothetical protein; Provisional
Probab=43.74  E-value=22  Score=22.33  Aligned_cols=24  Identities=17%  Similarity=0.246  Sum_probs=12.4

Q ss_pred             ccCCCCCCCCCCCCCCCceeccccccc
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICLKS   45 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~~~   45 (114)
                      .|..|++.|.....+   -.|+.||..
T Consensus       129 ~C~gC~~~~~~~~~~---~~C~~CG~~  152 (164)
T PRK12496        129 VCKGCKKKYPEDYPD---DVCEICGSP  152 (164)
T ss_pred             ECCCCCccccCCCCC---CcCCCCCCh
Confidence            466676666432211   246666643


No 142
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=42.33  E-value=15  Score=21.58  Aligned_cols=24  Identities=17%  Similarity=0.454  Sum_probs=14.2

Q ss_pred             cccCCCCCCCCCCCCCCCceecccccc
Q psy2414          18 ITRNNTDSIFYPDPASPGMYKCVICLK   44 (114)
Q Consensus        18 ~~c~~c~~~f~~~~~~~~~~~C~~C~~   44 (114)
                      ..|..|+..|....   ..+.|+.|+.
T Consensus        71 ~~C~~Cg~~~~~~~---~~~~CP~Cgs   94 (115)
T TIGR00100        71 CECEDCSEEVSPEI---DLYRCPKCHG   94 (115)
T ss_pred             EEcccCCCEEecCC---cCccCcCCcC
Confidence            46777776664432   2356777763


No 143
>KOG2482|consensus
Probab=41.43  E-value=17  Score=25.82  Aligned_cols=23  Identities=35%  Similarity=0.856  Sum_probs=21.2

Q ss_pred             CccCCCCcCcccChhHHHHHHHH
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKR   82 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~   82 (114)
                      .+.|-.|.+.|.....|..||+.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            57899999999999999999984


No 144
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=41.11  E-value=18  Score=17.04  Aligned_cols=12  Identities=17%  Similarity=0.304  Sum_probs=6.9

Q ss_pred             ecccccccccCh
Q psy2414          38 KCVICLKSVRSR   49 (114)
Q Consensus        38 ~C~~C~~~f~~~   49 (114)
                      .|+.|+-.+...
T Consensus        15 ~C~~CgM~Y~~~   26 (41)
T PF13878_consen   15 TCPTCGMLYSPG   26 (41)
T ss_pred             CCCCCCCEECCC
Confidence            566666655433


No 145
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=40.15  E-value=5.6  Score=27.29  Aligned_cols=34  Identities=12%  Similarity=0.266  Sum_probs=23.9

Q ss_pred             ccccCCCCCCCCCCCCCCCceecccccccccChh
Q psy2414          17 FITRNNTDSIFYPDPASPGMYKCVICLKSVRSRW   50 (114)
Q Consensus        17 ~~~c~~c~~~f~~~~~~~~~~~C~~C~~~f~~~~   50 (114)
                      -.+|+.|+.....+...+..+.|+.|+.-|....
T Consensus        26 ~~~c~~c~~~~~~~~l~~~~~vc~~c~~h~rl~a   59 (285)
T TIGR00515        26 WTKCPKCGQVLYTKELERNLEVCPKCDHHMRMDA   59 (285)
T ss_pred             eeECCCCcchhhHHHHHhhCCCCCCCCCcCcCCH
Confidence            3578888887776655555678888887765443


No 146
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=40.13  E-value=15  Score=17.09  Aligned_cols=14  Identities=21%  Similarity=0.657  Sum_probs=10.0

Q ss_pred             CccCCCCcCcccCh
Q psy2414          60 NHKCPYCESVYSRV   73 (114)
Q Consensus        60 ~~~c~~C~~~f~~~   73 (114)
                      |++|..|+..|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            67788887777653


No 147
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=39.80  E-value=9.1  Score=17.79  Aligned_cols=10  Identities=0%  Similarity=-0.217  Sum_probs=5.3

Q ss_pred             cCCCCCCCCC
Q psy2414          20 RNNTDSIFYP   29 (114)
Q Consensus        20 c~~c~~~f~~   29 (114)
                      |+.||+.-..
T Consensus         1 Cd~CG~~I~~   10 (37)
T PF08394_consen    1 CDYCGGEITG   10 (37)
T ss_pred             CCccCCcccC
Confidence            5556655443


No 148
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=39.05  E-value=6.4  Score=26.90  Aligned_cols=42  Identities=21%  Similarity=0.287  Sum_probs=18.2

Q ss_pred             cccCCCCCCCCCCC----C--CCCceecccccccccChhhHHhhhcCCCccCCCCcCc
Q psy2414          18 ITRNNTDSIFYPDP----A--SPGMYKCVICLKSVRSRWHHLQTHFSRNHKCPYCESV   69 (114)
Q Consensus        18 ~~c~~c~~~f~~~~----~--~~~~~~C~~C~~~f~~~~~h~~~h~~~~~~c~~C~~~   69 (114)
                      -.|++||....-..    .  |.+...|..|+-.+...          ...|+.||..
T Consensus       173 g~CPvCGs~P~~s~l~~~~~~G~R~L~Cs~C~t~W~~~----------R~~Cp~Cg~~  220 (290)
T PF04216_consen  173 GYCPVCGSPPVLSVLRGGEREGKRYLHCSLCGTEWRFV----------RIKCPYCGNT  220 (290)
T ss_dssp             SS-TTT---EEEEEEE------EEEEEETTT--EEE------------TTS-TTT---
T ss_pred             CcCCCCCCcCceEEEecCCCCccEEEEcCCCCCeeeec----------CCCCcCCCCC
Confidence            47999987554332    2  55677899998554221          2667777654


No 149
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=38.64  E-value=15  Score=26.02  Aligned_cols=28  Identities=11%  Similarity=0.227  Sum_probs=14.3

Q ss_pred             ccCCCCCCCCCCCCCCCceecccccccc
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICLKSV   46 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~~~f   46 (114)
                      .|..|...|.-.....-.|.|+.||..+
T Consensus       248 AC~rC~t~y~le~A~~~~wrCpkCGg~i  275 (403)
T COG1379         248 ACSRCYTRYSLEEAKSLRWRCPKCGGKI  275 (403)
T ss_pred             HHHHhhhccCcchhhhhcccCcccccch
Confidence            3666665554432223346666666543


No 150
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF12907 zf-met2:  Zinc-binding
Probab=37.83  E-value=21  Score=16.89  Aligned_cols=26  Identities=27%  Similarity=0.478  Sum_probs=18.1

Q ss_pred             ccCCCCcCcc---cChhHHHHHHHHHhCC
Q psy2414          61 HKCPYCESVY---SRVDTLKLHAKRVHGL   86 (114)
Q Consensus        61 ~~c~~C~~~f---~~~~~l~~H~~~~~~~   86 (114)
                      +.|..|...|   .....|..|....|..
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK   30 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPK   30 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCC
Confidence            5688888544   4557788888766654


No 152
>KOG1842|consensus
Probab=37.80  E-value=21  Score=26.20  Aligned_cols=14  Identities=29%  Similarity=0.636  Sum_probs=7.0

Q ss_pred             ceecccccccccCh
Q psy2414          36 MYKCVICLKSVRSR   49 (114)
Q Consensus        36 ~~~C~~C~~~f~~~   49 (114)
                      -+.|+.|..-|.+-
T Consensus        15 gflCPiC~~dl~~~   28 (505)
T KOG1842|consen   15 GFLCPICLLDLPNL   28 (505)
T ss_pred             cccCchHhhhhhhH
Confidence            34555555554443


No 153
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=37.73  E-value=24  Score=15.13  Aligned_cols=23  Identities=13%  Similarity=0.208  Sum_probs=6.6

Q ss_pred             ccCCCCCCCCCCCCCCCceeccccccc
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICLKS   45 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~~~   45 (114)
                      .|+.|++...    +...|.|..|+-.
T Consensus         2 ~C~~C~~~~~----~~~~Y~C~~Cdf~   24 (30)
T PF07649_consen    2 RCDACGKPID----GGWFYRCSECDFD   24 (30)
T ss_dssp             --TTTS--------S--EEE-TTT---
T ss_pred             cCCcCCCcCC----CCceEECccCCCc
Confidence            3555655331    2245677776543


No 154
>PF14369 zf-RING_3:  zinc-finger
Probab=37.62  E-value=28  Score=15.80  Aligned_cols=8  Identities=25%  Similarity=0.679  Sum_probs=3.4

Q ss_pred             cccccccc
Q psy2414          39 CVICLKSV   46 (114)
Q Consensus        39 C~~C~~~f   46 (114)
                      |+.|+..|
T Consensus        24 CP~C~~gF   31 (35)
T PF14369_consen   24 CPRCHGGF   31 (35)
T ss_pred             CcCCCCcE
Confidence            44444333


No 155
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=37.47  E-value=6.3  Score=27.16  Aligned_cols=32  Identities=13%  Similarity=0.292  Sum_probs=22.1

Q ss_pred             cccCCCCCCCCCCCCCCCceecccccccccCh
Q psy2414          18 ITRNNTDSIFYPDPASPGMYKCVICLKSVRSR   49 (114)
Q Consensus        18 ~~c~~c~~~f~~~~~~~~~~~C~~C~~~f~~~   49 (114)
                      .+|+.|+.....+...+..+.|+.|+.-|...
T Consensus        28 ~~c~~c~~~~~~~~l~~~~~vc~~c~~h~rl~   59 (292)
T PRK05654         28 TKCPSCGQVLYRKELEANLNVCPKCGHHMRIS   59 (292)
T ss_pred             eECCCccchhhHHHHHhcCCCCCCCCCCeeCC
Confidence            56888887776665545567888888776544


No 156
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=37.28  E-value=13  Score=18.55  Aligned_cols=14  Identities=21%  Similarity=0.546  Sum_probs=5.8

Q ss_pred             CceecccccccccC
Q psy2414          35 GMYKCVICLKSVRS   48 (114)
Q Consensus        35 ~~~~C~~C~~~f~~   48 (114)
                      ..|.|+.|.+.|-.
T Consensus        20 ~~y~C~~C~~~FC~   33 (51)
T PF07975_consen   20 SRYRCPKCKNHFCI   33 (51)
T ss_dssp             EEE--TTTT--B-H
T ss_pred             CeEECCCCCCcccc
Confidence            45777777766643


No 157
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=36.99  E-value=5.9  Score=23.15  Aligned_cols=24  Identities=21%  Similarity=0.329  Sum_probs=10.2

Q ss_pred             cccCCCCCCCCCCCCCCCceecccccc
Q psy2414          18 ITRNNTDSIFYPDPASPGMYKCVICLK   44 (114)
Q Consensus        18 ~~c~~c~~~f~~~~~~~~~~~C~~C~~   44 (114)
                      ..|..||..|.-..   ..+.|+.|+.
T Consensus        71 ~~C~~Cg~~~~~~~---~~~~CP~Cgs   94 (113)
T PF01155_consen   71 ARCRDCGHEFEPDE---FDFSCPRCGS   94 (113)
T ss_dssp             EEETTTS-EEECHH---CCHH-SSSSS
T ss_pred             EECCCCCCEEecCC---CCCCCcCCcC
Confidence            34666666554321   1144555553


No 158
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=36.54  E-value=19  Score=22.46  Aligned_cols=33  Identities=18%  Similarity=0.201  Sum_probs=18.4

Q ss_pred             CccCCCCcCcccChhHHHHHHHHHhCCCCCCccccCCCCCc
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLL  100 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~c~~c~~~  100 (114)
                      +|.|. |+..+...   ++|-. .-.|+ .  |.|..|+-.
T Consensus       117 ~Y~C~-C~q~~l~~---RRhn~-~~~g~-~--YrC~~C~gk  149 (156)
T COG3091         117 PYRCQ-CQQHYLRI---RRHNT-VRRGE-V--YRCGKCGGK  149 (156)
T ss_pred             eEEee-cCCccchh---hhccc-ccccc-e--EEeccCCce
Confidence            78888 88776553   22222 23333 2  666666643


No 159
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=36.14  E-value=24  Score=24.54  Aligned_cols=52  Identities=29%  Similarity=0.577  Sum_probs=36.1

Q ss_pred             CCceecccccccccChhh---HHhhhcCC-CccCCC--CcCcccChhHHHHHHHHHhC
Q psy2414          34 PGMYKCVICLKSVRSRWH---HLQTHFSR-NHKCPY--CESVYSRVDTLKLHAKRVHG   85 (114)
Q Consensus        34 ~~~~~C~~C~~~f~~~~~---h~~~h~~~-~~~c~~--C~~~f~~~~~l~~H~~~~~~   85 (114)
                      ..++.|+.|...|....+   |.+.+.++ +..|..  |...+.....+..|...++.
T Consensus        31 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (467)
T COG5048          31 PRPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSYSGCDKSFSRPLELSRHLRTHHN   88 (467)
T ss_pred             CchhhcccccccccccchhhhhcccccccCCccccccccccccCCcchhhhhcccccc
Confidence            446778888777766654   77778877 777766  66677777777777665444


No 160
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=35.82  E-value=24  Score=21.22  Aligned_cols=32  Identities=16%  Similarity=0.170  Sum_probs=18.8

Q ss_pred             cccCCCCCCCCCCC----CCCCceecccccccccCh
Q psy2414          18 ITRNNTDSIFYPDP----ASPGMYKCVICLKSVRSR   49 (114)
Q Consensus        18 ~~c~~c~~~f~~~~----~~~~~~~C~~C~~~f~~~   49 (114)
                      ..|+.|+..-..+.    .+...|.|..|++.|...
T Consensus        31 ~~cP~C~s~~~~k~g~~~~~~qRyrC~~C~~tf~~~   66 (129)
T COG3677          31 VNCPRCKSSNVVKIGGIRRGHQRYKCKSCGSTFTVE   66 (129)
T ss_pred             CcCCCCCccceeeECCccccccccccCCcCcceeee
Confidence            45777765441111    345667888888777554


No 161
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=35.68  E-value=31  Score=16.48  Aligned_cols=10  Identities=40%  Similarity=1.092  Sum_probs=4.9

Q ss_pred             CCceeccccc
Q psy2414          34 PGMYKCVICL   43 (114)
Q Consensus        34 ~~~~~C~~C~   43 (114)
                      ...|.|..|.
T Consensus        35 ~~~~~C~~C~   44 (46)
T PF12760_consen   35 RGRYRCKACR   44 (46)
T ss_pred             CCeEECCCCC
Confidence            3445555554


No 162
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=35.67  E-value=44  Score=16.13  Aligned_cols=29  Identities=10%  Similarity=0.145  Sum_probs=17.6

Q ss_pred             CccccCCCCCCCCCCCCCCCceecccccccc
Q psy2414          16 PFITRNNTDSIFYPDPASPGMYKCVICLKSV   46 (114)
Q Consensus        16 ~~~~c~~c~~~f~~~~~~~~~~~C~~C~~~f   46 (114)
                      ....|+.|++....  .+..-+.|..|+...
T Consensus        10 ~~~~C~~C~~~i~g--~~~~g~~C~~C~~~~   38 (53)
T PF00130_consen   10 KPTYCDVCGKFIWG--LGKQGYRCSWCGLVC   38 (53)
T ss_dssp             STEB-TTSSSBECS--SSSCEEEETTTT-EE
T ss_pred             CCCCCcccCcccCC--CCCCeEEECCCCChH
Confidence            34568888877622  445568888887554


No 163
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=35.57  E-value=39  Score=15.47  Aligned_cols=9  Identities=11%  Similarity=0.076  Sum_probs=4.6

Q ss_pred             cccCCCCCC
Q psy2414          18 ITRNNTDSI   26 (114)
Q Consensus        18 ~~c~~c~~~   26 (114)
                      +.|+.|+.+
T Consensus         6 v~CP~C~s~   14 (36)
T PF03811_consen    6 VHCPRCQST   14 (36)
T ss_pred             eeCCCCCCC
Confidence            445555543


No 164
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=34.77  E-value=39  Score=14.51  Aligned_cols=21  Identities=14%  Similarity=0.115  Sum_probs=12.6

Q ss_pred             ccCCCCCCCCCCCCCCCceeccccc
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICL   43 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~   43 (114)
                      .|+.|++.....    .-|.|..|.
T Consensus         2 ~C~~C~~~~~~~----~~Y~C~~c~   22 (30)
T PF03107_consen    2 WCDVCRRKIDGF----YFYHCSECC   22 (30)
T ss_pred             CCCCCCCCcCCC----EeEEeCCCC
Confidence            477777655332    157777776


No 165
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=34.32  E-value=29  Score=21.18  Aligned_cols=54  Identities=15%  Similarity=0.318  Sum_probs=29.2

Q ss_pred             CccccCCCCCCCCCCCCCCCceecc---cccccccChhhHHhhhcCCCccCCCCcCcccChh
Q psy2414          16 PFITRNNTDSIFYPDPASPGMYKCV---ICLKSVRSRWHHLQTHFSRNHKCPYCESVYSRVD   74 (114)
Q Consensus        16 ~~~~c~~c~~~f~~~~~~~~~~~C~---~C~~~f~~~~~h~~~h~~~~~~c~~C~~~f~~~~   74 (114)
                      +.++|+.|..+..... --+|-+|-   .|+-.+...|.|-..    --.|+.|.-+|..++
T Consensus        79 ~lYeCnIC~etS~ee~-FLKPneCCgY~iCn~Cya~LWK~~~~----ypvCPvCkTSFKss~  135 (140)
T PF05290_consen   79 KLYECNICKETSAEER-FLKPNECCGYSICNACYANLWKFCNL----YPVCPVCKTSFKSSS  135 (140)
T ss_pred             CceeccCcccccchhh-cCCcccccchHHHHHHHHHHHHHccc----CCCCCcccccccccc
Confidence            6789999987765443 22343331   233333333322222    246888888887654


No 166
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=34.01  E-value=13  Score=17.45  Aligned_cols=25  Identities=20%  Similarity=0.286  Sum_probs=12.4

Q ss_pred             ccCCCCCCCCCCC---CCC-Cceeccccc
Q psy2414          19 TRNNTDSIFYPDP---ASP-GMYKCVICL   43 (114)
Q Consensus        19 ~c~~c~~~f~~~~---~~~-~~~~C~~C~   43 (114)
                      .|+.||+.-....   .|. ..+.|+.|-
T Consensus         3 ~CSFCgr~~~~v~~li~g~~~~~IC~~Cv   31 (41)
T PF06689_consen    3 RCSFCGRPESEVGRLISGPNGAYICDECV   31 (41)
T ss_dssp             B-TTT--BTTTSSSEEEES-SEEEEHHHH
T ss_pred             CccCCCCCHHHHhceecCCCCcEECHHHH
Confidence            4777777665544   222 456676654


No 167
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger present in plant ubiquitin-associated (UBA) proteins. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=33.90  E-value=42  Score=16.14  Aligned_cols=20  Identities=10%  Similarity=0.039  Sum_probs=9.8

Q ss_pred             ccCCCCCCCCCCCCCCCceecccc
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVIC   42 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C   42 (114)
                      .|+.||.....    ...|+|..|
T Consensus         2 ~CDgCg~~PI~----G~RykC~~C   21 (43)
T cd02342           2 QCDGCGVLPIT----GPRYKSKVK   21 (43)
T ss_pred             CCCCCCCCccc----ccceEeCCC
Confidence            46666654322    234555554


No 168
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=33.77  E-value=48  Score=16.09  Aligned_cols=21  Identities=14%  Similarity=0.178  Sum_probs=11.9

Q ss_pred             ccCCCCCCCCCCCCCCCceeccccc
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICL   43 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~   43 (114)
                      .|+.|++..    .+...+.|..|.
T Consensus         2 ~Cd~C~~~~----~~g~r~~C~~C~   22 (49)
T cd02335           2 HCDYCSKDI----TGTIRIKCAECP   22 (49)
T ss_pred             CCCCcCCCC----CCCcEEECCCCC
Confidence            477776644    233456666654


No 169
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=33.30  E-value=58  Score=15.50  Aligned_cols=24  Identities=13%  Similarity=0.173  Sum_probs=13.8

Q ss_pred             cCCCCCCCCCCCCCCCceeccccccccc
Q psy2414          20 RNNTDSIFYPDPASPGMYKCVICLKSVR   47 (114)
Q Consensus        20 c~~c~~~f~~~~~~~~~~~C~~C~~~f~   47 (114)
                      |.+|+.    ...++....|+.|+..|.
T Consensus         2 C~vC~~----~~~~~~~i~C~~C~~~~H   25 (51)
T PF00628_consen    2 CPVCGQ----SDDDGDMIQCDSCNRWYH   25 (51)
T ss_dssp             BTTTTS----SCTTSSEEEBSTTSCEEE
T ss_pred             CcCCCC----cCCCCCeEEcCCCChhhC
Confidence            455665    123445667777776653


No 170
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=32.97  E-value=28  Score=20.75  Aligned_cols=11  Identities=9%  Similarity=-0.315  Sum_probs=6.8

Q ss_pred             cccCCCCCCCCC
Q psy2414          18 ITRNNTDSIFYP   29 (114)
Q Consensus        18 ~~c~~c~~~f~~   29 (114)
                      ..| .||..|..
T Consensus        71 ~~C-~Cg~~~~~   81 (124)
T PRK00762         71 IEC-ECGYEGVV   81 (124)
T ss_pred             EEe-eCcCcccc
Confidence            457 77766654


No 171
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=32.88  E-value=63  Score=16.46  Aligned_cols=17  Identities=12%  Similarity=0.249  Sum_probs=10.2

Q ss_pred             CCCceecccccccccCh
Q psy2414          33 SPGMYKCVICLKSVRSR   49 (114)
Q Consensus        33 ~~~~~~C~~C~~~f~~~   49 (114)
                      +...|.|+.||-..--+
T Consensus        11 ~~v~~~Cp~cGipthcS   27 (55)
T PF13824_consen   11 AHVNFECPDCGIPTHCS   27 (55)
T ss_pred             cccCCcCCCCCCcCccC
Confidence            34467788777654433


No 172
>PLN02294 cytochrome c oxidase subunit Vb
Probab=32.34  E-value=15  Score=23.26  Aligned_cols=21  Identities=14%  Similarity=0.493  Sum_probs=15.8

Q ss_pred             HHhhhcCCCccCCCCcCcccC
Q psy2414          52 HLQTHFSRNHKCPYCESVYSR   72 (114)
Q Consensus        52 h~~~h~~~~~~c~~C~~~f~~   72 (114)
                      ++..+.|+|..|..||..|..
T Consensus       133 Wf~L~kGkp~RCpeCG~~fkL  153 (174)
T PLN02294        133 WFWLEKGKSFECPVCTQYFEL  153 (174)
T ss_pred             EEEecCCCceeCCCCCCEEEE
Confidence            455666668889999988765


No 173
>COG4647 AcxC Acetone carboxylase, gamma subunit [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=31.95  E-value=13  Score=22.46  Aligned_cols=16  Identities=13%  Similarity=-0.010  Sum_probs=10.8

Q ss_pred             CCccccCCCCCCCCCCC
Q psy2414          15 QPFITRNNTDSIFYPDP   31 (114)
Q Consensus        15 ~~~~~c~~c~~~f~~~~   31 (114)
                      ++.++| +||.+|....
T Consensus        68 ~rv~rc-ecghsf~d~r   83 (165)
T COG4647          68 KRVIRC-ECGHSFGDYR   83 (165)
T ss_pred             ccEEEE-eccccccChh
Confidence            345566 7888887765


No 174
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=31.81  E-value=26  Score=21.26  Aligned_cols=11  Identities=27%  Similarity=0.875  Sum_probs=6.3

Q ss_pred             ceecccccccc
Q psy2414          36 MYKCVICLKSV   46 (114)
Q Consensus        36 ~~~C~~C~~~f   46 (114)
                      .|.|..|+..+
T Consensus       123 ~~~C~~C~~~~  133 (157)
T PF10263_consen  123 VYRCPSCGREY  133 (157)
T ss_pred             EEEcCCCCCEe
Confidence            45666666544


No 175
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=30.89  E-value=43  Score=24.61  Aligned_cols=25  Identities=12%  Similarity=0.029  Sum_probs=16.6

Q ss_pred             CCccccCCCCCCCCCCCCCCCceecccccc
Q psy2414          15 QPFITRNNTDSIFYPDPASPGMYKCVICLK   44 (114)
Q Consensus        15 ~~~~~c~~c~~~f~~~~~~~~~~~C~~C~~   44 (114)
                      +..+.|..||..+..     ..+.|+.|+.
T Consensus         5 ~~~y~C~~Cg~~~~~-----~~g~Cp~C~~   29 (454)
T TIGR00416         5 KSKFVCQHCGADSPK-----WQGKCPACHA   29 (454)
T ss_pred             CCeEECCcCCCCCcc-----ccEECcCCCC
Confidence            356788888876543     3467887763


No 176
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=30.87  E-value=58  Score=14.35  Aligned_cols=24  Identities=8%  Similarity=0.350  Sum_probs=13.4

Q ss_pred             ccCCCCCCCCCCCCCCCceeccccc
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICL   43 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~   43 (114)
                      .|..|+..+.-. .|...+.|..|.
T Consensus         3 ~C~~C~t~L~yP-~gA~~vrCs~C~   26 (31)
T TIGR01053         3 VCGGCRTLLMYP-RGASSVRCALCQ   26 (31)
T ss_pred             CcCCCCcEeecC-CCCCeEECCCCC
Confidence            455555554443 455566666664


No 177
>KOG2907|consensus
Probab=30.73  E-value=42  Score=19.80  Aligned_cols=42  Identities=21%  Similarity=0.322  Sum_probs=25.2

Q ss_pred             CccCCCCcCcccChhHHHHHHHHHhCCCCCCccccCCCCCccCCC
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFPTP  104 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~c~~c~~~f~~~  104 (114)
                      ..+|+.||-.=..-..|  .+|. -.++..-||.|..|+..|+..
T Consensus        74 ~~kCpkCghe~m~Y~T~--QlRS-ADEGQTVFYTC~kC~~k~~e~  115 (116)
T KOG2907|consen   74 KHKCPKCGHEEMSYHTL--QLRS-ADEGQTVFYTCPKCKYKFTEN  115 (116)
T ss_pred             hccCcccCCchhhhhhh--hccc-ccCCceEEEEcCccceeeecc
Confidence            46888887532221222  1232 334557788999999988754


No 178
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=30.65  E-value=29  Score=21.59  Aligned_cols=11  Identities=18%  Similarity=0.546  Sum_probs=5.2

Q ss_pred             eeccccccccc
Q psy2414          37 YKCVICLKSVR   47 (114)
Q Consensus        37 ~~C~~C~~~f~   47 (114)
                      -.|..|+..|.
T Consensus        29 ReC~~C~~RFT   39 (156)
T COG1327          29 RECLECGERFT   39 (156)
T ss_pred             hcccccccccc
Confidence            34555554443


No 179
>PRK12722 transcriptional activator FlhC; Provisional
Probab=29.99  E-value=44  Score=21.56  Aligned_cols=8  Identities=25%  Similarity=0.924  Sum_probs=4.1

Q ss_pred             CccCCCCc
Q psy2414          60 NHKCPYCE   67 (114)
Q Consensus        60 ~~~c~~C~   67 (114)
                      .|.|+.|.
T Consensus       154 ~f~CplC~  161 (187)
T PRK12722        154 SFVCGLCQ  161 (187)
T ss_pred             CCcCCCCC
Confidence            45555553


No 180
>PRK11823 DNA repair protein RadA; Provisional
Probab=29.84  E-value=47  Score=24.34  Aligned_cols=25  Identities=8%  Similarity=0.012  Sum_probs=17.0

Q ss_pred             CCccccCCCCCCCCCCCCCCCceecccccc
Q psy2414          15 QPFITRNNTDSIFYPDPASPGMYKCVICLK   44 (114)
Q Consensus        15 ~~~~~c~~c~~~f~~~~~~~~~~~C~~C~~   44 (114)
                      +..+.|..||..+..     ..+.|+.|+.
T Consensus         5 ~~~y~C~~Cg~~~~~-----~~g~Cp~C~~   29 (446)
T PRK11823          5 KTAYVCQECGAESPK-----WLGRCPECGA   29 (446)
T ss_pred             CCeEECCcCCCCCcc-----cCeeCcCCCC
Confidence            456789898876544     3467877763


No 181
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=29.79  E-value=50  Score=18.38  Aligned_cols=23  Identities=9%  Similarity=-0.048  Sum_probs=14.8

Q ss_pred             CCCccccCCCCCCCCCCCCCCCc
Q psy2414          14 IQPFITRNNTDSIFYPDPASPGM   36 (114)
Q Consensus        14 ~~~~~~c~~c~~~f~~~~~~~~~   36 (114)
                      ++..-+|+.||..|.....++.|
T Consensus         5 Lk~~~~C~~CG~d~~~~~adDgP   27 (86)
T PF06170_consen    5 LKVAPRCPHCGLDYSHARADDGP   27 (86)
T ss_pred             ccCCCcccccCCccccCCcCccc
Confidence            34455688888888776644433


No 182
>COG4640 Predicted membrane protein [Function unknown]
Probab=29.73  E-value=41  Score=24.46  Aligned_cols=13  Identities=15%  Similarity=0.580  Sum_probs=6.5

Q ss_pred             ccCCCCcCcccCh
Q psy2414          61 HKCPYCESVYSRV   73 (114)
Q Consensus        61 ~~c~~C~~~f~~~   73 (114)
                      ++|.+||..|...
T Consensus        16 ~qC~qCG~~~t~~   28 (465)
T COG4640          16 VQCTQCGHKFTSR   28 (465)
T ss_pred             ccccccCCcCCch
Confidence            4455555555443


No 183
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=29.38  E-value=30  Score=21.39  Aligned_cols=12  Identities=17%  Similarity=0.611  Sum_probs=6.4

Q ss_pred             eecccccccccC
Q psy2414          37 YKCVICLKSVRS   48 (114)
Q Consensus        37 ~~C~~C~~~f~~   48 (114)
                      -+|..|++.|.+
T Consensus        29 ReC~~C~~RFTT   40 (147)
T TIGR00244        29 RECLECHERFTT   40 (147)
T ss_pred             ccCCccCCccce
Confidence            445555555543


No 184
>PRK00420 hypothetical protein; Validated
Probab=29.28  E-value=55  Score=19.28  Aligned_cols=28  Identities=11%  Similarity=-0.035  Sum_probs=18.0

Q ss_pred             cccCCCCCCCCCCCCCCCceeccccccccc
Q psy2414          18 ITRNNTDSIFYPDPASPGMYKCVICLKSVR   47 (114)
Q Consensus        18 ~~c~~c~~~f~~~~~~~~~~~C~~C~~~f~   47 (114)
                      -.|+.||..+-.-  ......|+.|+....
T Consensus        24 ~~CP~Cg~pLf~l--k~g~~~Cp~Cg~~~~   51 (112)
T PRK00420         24 KHCPVCGLPLFEL--KDGEVVCPVHGKVYI   51 (112)
T ss_pred             CCCCCCCCcceec--CCCceECCCCCCeee
Confidence            3588888665442  234577888887554


No 185
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=29.25  E-value=13  Score=17.98  Aligned_cols=6  Identities=17%  Similarity=-0.114  Sum_probs=2.7

Q ss_pred             CCCccC
Q psy2414          97 PQLLFP  102 (114)
Q Consensus        97 c~~~f~  102 (114)
                      ||..|.
T Consensus        33 Cg~tfv   38 (47)
T PF04606_consen   33 CGHTFV   38 (47)
T ss_pred             CCCEEE
Confidence            444443


No 186
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=29.00  E-value=17  Score=20.77  Aligned_cols=21  Identities=19%  Similarity=0.539  Sum_probs=14.8

Q ss_pred             HHhhhcCCCccCCCCcCcccC
Q psy2414          52 HLQTHFSRNHKCPYCESVYSR   72 (114)
Q Consensus        52 h~~~h~~~~~~c~~C~~~f~~   72 (114)
                      ++..+.++|..|..||..|..
T Consensus        71 W~~l~~g~~~rC~eCG~~fkL   91 (97)
T cd00924          71 WMWLEKGKPKRCPECGHVFKL   91 (97)
T ss_pred             EEEEeCCCceeCCCCCcEEEE
Confidence            455565568889889887753


No 187
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=28.90  E-value=17  Score=23.65  Aligned_cols=30  Identities=10%  Similarity=-0.044  Sum_probs=16.5

Q ss_pred             ccccCCCCCCCCCCC-------CCC---Cceecccccccc
Q psy2414          17 FITRNNTDSIFYPDP-------ASP---GMYKCVICLKSV   46 (114)
Q Consensus        17 ~~~c~~c~~~f~~~~-------~~~---~~~~C~~C~~~f   46 (114)
                      .+.|+.||.++....       .|+   ..+.|..||..+
T Consensus        14 ~~~CPvCg~~l~~~~~~~~IPyFG~V~i~t~~C~~CgYR~   53 (201)
T COG1779          14 RIDCPVCGGTLKAHMYLYDIPYFGEVLISTGVCERCGYRS   53 (201)
T ss_pred             eecCCcccceeeEEEeeecCCccceEEEEEEEccccCCcc
Confidence            456777777555443       222   235566666543


No 188
>KOG2071|consensus
Probab=28.76  E-value=42  Score=25.58  Aligned_cols=23  Identities=13%  Similarity=0.342  Sum_probs=19.4

Q ss_pred             CccCCCCcCcccChhHHHHHHHH
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAKR   82 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~~   82 (114)
                      |-+|..||.+|........|+..
T Consensus       418 pnqC~~CG~R~~~~ee~sk~md~  440 (579)
T KOG2071|consen  418 PNQCKSCGLRFDDSEERSKHMDI  440 (579)
T ss_pred             cchhcccccccccchhhhhHhhh
Confidence            78999999999988777777654


No 189
>KOG2785|consensus
Probab=28.45  E-value=20  Score=25.66  Aligned_cols=21  Identities=14%  Similarity=0.061  Sum_probs=16.2

Q ss_pred             cccCCCC---CccCCCCCCCCCCC
Q psy2414          92 IHGLIPQ---LLFPTPHAKTSPVD  112 (114)
Q Consensus        92 ~~c~~c~---~~f~~~~~L~~h~~  112 (114)
                      +.|..|.   +.|.+-.+++.|++
T Consensus       218 ~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  218 FICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             ceEEEeccccCcccccHHHHHHHh
Confidence            6788888   77888777777764


No 190
>PRK12860 transcriptional activator FlhC; Provisional
Probab=28.17  E-value=50  Score=21.38  Aligned_cols=10  Identities=10%  Similarity=-0.001  Sum_probs=4.9

Q ss_pred             ccCCCCCCCC
Q psy2414          19 TRNNTDSIFY   28 (114)
Q Consensus        19 ~c~~c~~~f~   28 (114)
                      .|..||..|.
T Consensus       136 ~C~~Cgg~fv  145 (189)
T PRK12860        136 RCCRCGGKFV  145 (189)
T ss_pred             cCCCCCCCee
Confidence            4555554444


No 191
>cd02339 ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger present in Drosophila Mind bomb (D-mib) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Mind bomb is an E3 ubiqitin ligase that has been shown to regulate signaling by the Notch ligand Delta in Drosophila melanogaster.
Probab=27.29  E-value=74  Score=15.29  Aligned_cols=21  Identities=14%  Similarity=0.115  Sum_probs=10.9

Q ss_pred             ccCCCCCCCCCCCCCCCceeccccc
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICL   43 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~   43 (114)
                      .|+.|++..    .....|+|..|.
T Consensus         2 ~Cd~C~~~~----i~G~RykC~~C~   22 (45)
T cd02339           2 ICDTCRKQG----IIGIRWKCAECP   22 (45)
T ss_pred             CCCCCCCCC----cccCeEECCCCC
Confidence            466776532    222346666654


No 192
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=27.12  E-value=74  Score=15.09  Aligned_cols=13  Identities=15%  Similarity=0.514  Sum_probs=8.3

Q ss_pred             ceecccccccccC
Q psy2414          36 MYKCVICLKSVRS   48 (114)
Q Consensus        36 ~~~C~~C~~~f~~   48 (114)
                      .|.|..|+..+..
T Consensus        11 l~~CL~C~~~~c~   23 (50)
T smart00290       11 LWLCLTCGQVGCG   23 (50)
T ss_pred             eEEecCCCCcccC
Confidence            6777777765543


No 193
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=27.12  E-value=49  Score=15.80  Aligned_cols=24  Identities=17%  Similarity=0.200  Sum_probs=12.2

Q ss_pred             CccccCCCCCCCCCCCCCCCceeccccc
Q psy2414          16 PFITRNNTDSIFYPDPASPGMYKCVICL   43 (114)
Q Consensus        16 ~~~~c~~c~~~f~~~~~~~~~~~C~~C~   43 (114)
                      ..+.|+.|+....    ....|.|..|.
T Consensus         3 ~~~~C~~C~~~~i----~g~Ry~C~~C~   26 (46)
T PF00569_consen    3 HGYTCDGCGTDPI----IGVRYHCLVCP   26 (46)
T ss_dssp             SSCE-SSS-SSSE----ESSEEEESSSS
T ss_pred             CCeECcCCCCCcC----cCCeEECCCCC
Confidence            4567888876321    12357777664


No 194
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.99  E-value=46  Score=20.09  Aligned_cols=11  Identities=27%  Similarity=-0.031  Sum_probs=6.4

Q ss_pred             ccCCCCCCCCC
Q psy2414          19 TRNNTDSIFYP   29 (114)
Q Consensus        19 ~c~~c~~~f~~   29 (114)
                      -|..||+.|+.
T Consensus        70 fchncgs~fpw   80 (160)
T COG4306          70 FCHNCGSRFPW   80 (160)
T ss_pred             hhhcCCCCCCc
Confidence            46666666654


No 195
>PRK04351 hypothetical protein; Provisional
Probab=26.94  E-value=47  Score=20.52  Aligned_cols=32  Identities=16%  Similarity=0.496  Sum_probs=17.2

Q ss_pred             ceecccccccccChhhHHhhhcCCCccCCCCcCccc
Q psy2414          36 MYKCVICLKSVRSRWHHLQTHFSRNHKCPYCESVYS   71 (114)
Q Consensus        36 ~~~C~~C~~~f~~~~~h~~~h~~~~~~c~~C~~~f~   71 (114)
                      .|.|..|+..+...    +.+....|.|..|+-.+.
T Consensus       112 ~Y~C~~Cg~~~~r~----Rr~n~~~yrCg~C~g~L~  143 (149)
T PRK04351        112 LYECQSCGQQYLRK----RRINTKRYRCGKCRGKLK  143 (149)
T ss_pred             EEECCCCCCEeeee----eecCCCcEEeCCCCcEee
Confidence            47787777554332    112112577777765543


No 196
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=26.63  E-value=16  Score=16.55  Aligned_cols=6  Identities=33%  Similarity=0.866  Sum_probs=2.5

Q ss_pred             eccccc
Q psy2414          38 KCVICL   43 (114)
Q Consensus        38 ~C~~C~   43 (114)
                      .|..|+
T Consensus        22 ~C~~C~   27 (35)
T PF02150_consen   22 ACRTCG   27 (35)
T ss_dssp             EESSSS
T ss_pred             CCCCCC
Confidence            344444


No 197
>TIGR00270 conserved hypothetical protein TIGR00270.
Probab=26.54  E-value=33  Score=21.33  Aligned_cols=25  Identities=12%  Similarity=0.074  Sum_probs=17.7

Q ss_pred             ccCCCCCCCCCCC-----CCCCceeccccc
Q psy2414          19 TRNNTDSIFYPDP-----ASPGMYKCVICL   43 (114)
Q Consensus        19 ~c~~c~~~f~~~~-----~~~~~~~C~~C~   43 (114)
                      .|..||+......     .|.....|..|.
T Consensus         2 ~CEiCG~~i~~~~~~v~iega~l~vC~~C~   31 (154)
T TIGR00270         2 NCEICGRKIKGKGFKIVIEGSEMTVCGECR   31 (154)
T ss_pred             ccccCCCccCCCCeEEEEcCeEEehhhhHH
Confidence            4888888776653     556667788776


No 198
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=26.41  E-value=35  Score=16.91  Aligned_cols=18  Identities=11%  Similarity=0.015  Sum_probs=12.0

Q ss_pred             CCceecccccccccChhh
Q psy2414          34 PGMYKCVICLKSVRSRWH   51 (114)
Q Consensus        34 ~~~~~C~~C~~~f~~~~~   51 (114)
                      ++.+.|..||..|.....
T Consensus         2 Dk~l~C~dCg~~FvfTa~   19 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAG   19 (49)
T ss_pred             CeeEEcccCCCeEEEehh
Confidence            356778888887755443


No 199
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=26.20  E-value=30  Score=16.27  Aligned_cols=14  Identities=36%  Similarity=0.415  Sum_probs=8.5

Q ss_pred             CceecccccccccC
Q psy2414          35 GMYKCVICLKSVRS   48 (114)
Q Consensus        35 ~~~~C~~C~~~f~~   48 (114)
                      -|+.|..|+..|-.
T Consensus        12 ~~~~C~~C~~~FC~   25 (43)
T PF01428_consen   12 LPFKCKHCGKSFCL   25 (43)
T ss_dssp             SHEE-TTTS-EE-T
T ss_pred             CCeECCCCCcccCc
Confidence            47888888888754


No 200
>KOG3408|consensus
Probab=25.88  E-value=39  Score=20.25  Aligned_cols=22  Identities=27%  Similarity=0.484  Sum_probs=16.2

Q ss_pred             CccCCCCcCcccChhHHHHHHH
Q psy2414          60 NHKCPYCESVYSRVDTLKLHAK   81 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~~l~~H~~   81 (114)
                      .|.|-.|.+-|.+...|..|.+
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHh
Confidence            4777777777777777777764


No 201
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=25.07  E-value=18  Score=15.47  Aligned_cols=24  Identities=13%  Similarity=0.106  Sum_probs=8.9

Q ss_pred             ccCCCCCCCCCCC-CCCCceecccc
Q psy2414          19 TRNNTDSIFYPDP-ASPGMYKCVIC   42 (114)
Q Consensus        19 ~c~~c~~~f~~~~-~~~~~~~C~~C   42 (114)
                      +|..|+....... .++.++-|+.|
T Consensus         3 ~C~rC~~~~~~~~~~~r~~~~C~rC   27 (30)
T PF06827_consen    3 KCPRCWNYIEDIGINGRSTYLCPRC   27 (30)
T ss_dssp             B-TTT--BBEEEEETTEEEEE-TTT
T ss_pred             cCccCCCcceEeEecCCCCeECcCC
Confidence            3555555443332 23334555555


No 202
>cd02344 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present in HERC2 and related proteins. HERC2 is a potential E3 ubiquitin protein ligase and/or guanine nucleotide exchange factor. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=25.04  E-value=87  Score=15.13  Aligned_cols=21  Identities=19%  Similarity=0.270  Sum_probs=10.6

Q ss_pred             ccCCCCCCCCCCCCCCCceeccccc
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICL   43 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~   43 (114)
                      .|+.|+....    ....|+|..|.
T Consensus         2 ~Cd~C~~~pI----~G~RykC~~C~   22 (45)
T cd02344           2 TCDGCQMFPI----NGPRFKCRNCD   22 (45)
T ss_pred             CCCCCCCCCC----ccCeEECCCCC
Confidence            4666654321    12356666654


No 203
>cd02337 ZZ_CBP Zinc finger, ZZ type. Zinc finger present in CBP/p300 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. CREB-binding protein (CBP) is a large multidomain protein that provides binding sites for transcriptional coactivators, the role of the ZZ domain in CBP/p300 is unclear.
Probab=25.00  E-value=80  Score=14.80  Aligned_cols=19  Identities=21%  Similarity=0.462  Sum_probs=10.6

Q ss_pred             ccCCCCCCCCCCCCCCCceeccccc
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICL   43 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~   43 (114)
                      .|+.|+..      .+..|.|..|.
T Consensus         2 ~C~~C~~~------~~~r~~C~~C~   20 (41)
T cd02337           2 TCNECKHH------VETRWHCTVCE   20 (41)
T ss_pred             cCCCCCCc------CCCceECCCCc
Confidence            46667551      12556777664


No 204
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=24.95  E-value=36  Score=15.70  Aligned_cols=12  Identities=42%  Similarity=0.797  Sum_probs=5.6

Q ss_pred             Cceecccccccc
Q psy2414          35 GMYKCVICLKSV   46 (114)
Q Consensus        35 ~~~~C~~C~~~f   46 (114)
                      +-|+|..|++..
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            347777777653


No 205
>KOG0717|consensus
Probab=24.94  E-value=44  Score=24.84  Aligned_cols=22  Identities=23%  Similarity=0.463  Sum_probs=18.5

Q ss_pred             ccCCCCcCcccChhHHHHHHHH
Q psy2414          61 HKCPYCESVYSRVDTLKLHAKR   82 (114)
Q Consensus        61 ~~c~~C~~~f~~~~~l~~H~~~   82 (114)
                      +.|..|.+.|....+|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7888999999998888888753


No 206
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.81  E-value=63  Score=17.00  Aligned_cols=27  Identities=4%  Similarity=-0.113  Sum_probs=14.7

Q ss_pred             CccccCCCCCCCCCCC-CCCCceecccc
Q psy2414          16 PFITRNNTDSIFYPDP-ASPGMYKCVIC   42 (114)
Q Consensus        16 ~~~~c~~c~~~f~~~~-~~~~~~~C~~C   42 (114)
                      ...+|.+||+.-.... +.-+||-+.-|
T Consensus         6 ~~v~CP~Cgkpv~w~~~s~frPFCSkRC   33 (65)
T COG3024           6 ITVPCPTCGKPVVWGEESPFRPFCSKRC   33 (65)
T ss_pred             ccccCCCCCCcccccccCCcCcchhHhh
Confidence            4567888888665533 22334433334


No 207
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=24.66  E-value=67  Score=19.48  Aligned_cols=32  Identities=16%  Similarity=0.338  Sum_probs=15.0

Q ss_pred             ceecccccccccChhhHHhhhcCCCccCCCCcCcc
Q psy2414          36 MYKCVICLKSVRSRWHHLQTHFSRNHKCPYCESVY   70 (114)
Q Consensus        36 ~~~C~~C~~~f~~~~~h~~~h~~~~~~c~~C~~~f   70 (114)
                      .|.|..|+..+.....+...   ..+.|..|+-.+
T Consensus       112 ~y~C~~C~~~~~~~rr~~~~---~~y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYLRVRRSNNV---SRYRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCceEccccCc---ceEEcCCCCCEE
Confidence            56676676554321111111   136666666543


No 208
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=24.55  E-value=50  Score=14.31  Aligned_cols=9  Identities=33%  Similarity=0.892  Sum_probs=4.5

Q ss_pred             ecccccccc
Q psy2414          38 KCVICLKSV   46 (114)
Q Consensus        38 ~C~~C~~~f   46 (114)
                      .|..|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            344555555


No 209
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=24.49  E-value=26  Score=17.32  Aligned_cols=10  Identities=0%  Similarity=-0.333  Sum_probs=4.7

Q ss_pred             ccCCCCCccC
Q psy2414          93 HGLIPQLLFP  102 (114)
Q Consensus        93 ~c~~c~~~f~  102 (114)
                      +|+.|+..|.
T Consensus        22 ~CPlC~r~l~   31 (54)
T PF04423_consen   22 CCPLCGRPLD   31 (54)
T ss_dssp             E-TTT--EE-
T ss_pred             cCCCCCCCCC
Confidence            7888887765


No 210
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=24.30  E-value=61  Score=13.37  Aligned_cols=7  Identities=14%  Similarity=-0.035  Sum_probs=4.1

Q ss_pred             ccCCCCC
Q psy2414          19 TRNNTDS   25 (114)
Q Consensus        19 ~c~~c~~   25 (114)
                      .|..||+
T Consensus         4 ~Cp~Cg~   10 (26)
T PF13248_consen    4 FCPNCGA   10 (26)
T ss_pred             CCcccCC
Confidence            4566665


No 211
>COG4332 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.10  E-value=59  Score=20.99  Aligned_cols=33  Identities=24%  Similarity=0.319  Sum_probs=20.4

Q ss_pred             CCccccCCCC--CCCCCCC------CCCC-----ceeccccccccc
Q psy2414          15 QPFITRNNTD--SIFYPDP------ASPG-----MYKCVICLKSVR   47 (114)
Q Consensus        15 ~~~~~c~~c~--~~f~~~~------~~~~-----~~~C~~C~~~f~   47 (114)
                      ++...|+.||  +.|..+.      .++.     -|+|..|++++.
T Consensus        15 q~~k~C~~Cg~kr~f~cSg~fRvNAq~K~LDvWlIYkC~~Cd~tWN   60 (203)
T COG4332          15 QPAKRCNSCGVKRAFTCSGKFRVNAQGKVLDVWLIYKCTHCDYTWN   60 (203)
T ss_pred             hhhhhCcccCCcceeeecCcEEEcCCCcEEEEEEEEEeeccCCccc
Confidence            3556799998  4555544      1221     288999987753


No 212
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=23.76  E-value=36  Score=15.75  Aligned_cols=13  Identities=8%  Similarity=0.204  Sum_probs=8.9

Q ss_pred             CccccCCCCCCCC
Q psy2414          16 PFITRNNTDSIFY   28 (114)
Q Consensus        16 ~~~~c~~c~~~f~   28 (114)
                      |.+.|+.||..+-
T Consensus        31 p~~~C~~CGE~~~   43 (46)
T TIGR03831        31 PALVCPQCGEEYL   43 (46)
T ss_pred             CccccccCCCEee
Confidence            5566888886653


No 213
>PRK06424 transcription factor; Provisional
Probab=23.24  E-value=30  Score=21.28  Aligned_cols=25  Identities=8%  Similarity=0.024  Sum_probs=17.5

Q ss_pred             ccCCCCCCCCCCC----CCCCceeccccc
Q psy2414          19 TRNNTDSIFYPDP----ASPGMYKCVICL   43 (114)
Q Consensus        19 ~c~~c~~~f~~~~----~~~~~~~C~~C~   43 (114)
                      .|+.||+.-....    .|.....|+.|.
T Consensus         2 ~CE~CG~~~~~~~~v~ieg~~l~vC~~Ca   30 (144)
T PRK06424          2 ECEMCGKKVPQTTKVMIDGAILNVCDDCA   30 (144)
T ss_pred             cccccCcccCCceEEEEcCeeeehhHHHH
Confidence            4888988776554    566667777775


No 214
>KOG0782|consensus
Probab=23.19  E-value=20  Score=27.42  Aligned_cols=32  Identities=13%  Similarity=0.130  Sum_probs=22.9

Q ss_pred             ccCCCCCCCCCCC---CCCC-ceecccccccccChh
Q psy2414          19 TRNNTDSIFYPDP---ASPG-MYKCVICLKSVRSRW   50 (114)
Q Consensus        19 ~c~~c~~~f~~~~---~~~~-~~~C~~C~~~f~~~~   50 (114)
                      +|+.|||.|.++.   ..+. .-.|..|..+|..+-
T Consensus       255 kC~~CgKgFQQKf~FhsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  255 KCNTCGKGFQQKFFFHSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             ccchhhhhhhhheeeccccEEEEEehHHHHHhhcch
Confidence            6999999998886   2221 346888888876664


No 215
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=22.39  E-value=48  Score=15.87  Aligned_cols=12  Identities=8%  Similarity=-0.305  Sum_probs=8.1

Q ss_pred             cccCCCCCCCCC
Q psy2414          18 ITRNNTDSIFYP   29 (114)
Q Consensus        18 ~~c~~c~~~f~~   29 (114)
                      =.|..|++.|.-
T Consensus         9 K~C~~C~rpf~W   20 (42)
T PF10013_consen    9 KICPVCGRPFTW   20 (42)
T ss_pred             CcCcccCCcchH
Confidence            347778777754


No 216
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=22.24  E-value=1.2e+02  Score=20.81  Aligned_cols=81  Identities=12%  Similarity=0.115  Sum_probs=43.0

Q ss_pred             CCCCceecccccccccChhh--HHhhh-c-C-CCccCCCCcCcccC------hhHHHHHHHHHhC-CCCCCccccCCCCC
Q psy2414          32 ASPGMYKCVICLKSVRSRWH--HLQTH-F-S-RNHKCPYCESVYSR------VDTLKLHAKRVHG-LGISRYIHGLIPQL   99 (114)
Q Consensus        32 ~~~~~~~C~~C~~~f~~~~~--h~~~h-~-~-~~~~c~~C~~~f~~------~~~l~~H~~~~~~-~~~~~~~~c~~c~~   99 (114)
                      .|.+.|.|..|....-....  ||..- . + +.|+|..|++.=..      ......|++.... .++...+-|+.|+.
T Consensus       138 hGGrif~CsfC~~flCEDDQFEHQAsCQvLe~E~~KC~SCNrlGq~sCLRCK~cfCddHvrrKg~ky~k~k~~PCPKCg~  217 (314)
T PF06524_consen  138 HGGRIFKCSFCDNFLCEDDQFEHQASCQVLESETFKCQSCNRLGQYSCLRCKICFCDDHVRRKGFKYEKGKPIPCPKCGY  217 (314)
T ss_pred             CCCeEEEeecCCCeeeccchhhhhhhhhhhhcccccccccccccchhhhheeeeehhhhhhhcccccccCCCCCCCCCCC
Confidence            35667888888754433322  66532 2 2 27888887653221      1223356653211 12222256888887


Q ss_pred             ccCCCCCCCCCCC
Q psy2414         100 LFPTPHAKTSPVD  112 (114)
Q Consensus       100 ~f~~~~~L~~h~~  112 (114)
                      -.+....|...++
T Consensus       218 et~eTkdLSmStR  230 (314)
T PF06524_consen  218 ETQETKDLSMSTR  230 (314)
T ss_pred             cccccccceeeee
Confidence            7776666655443


No 217
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=21.97  E-value=50  Score=16.33  Aligned_cols=13  Identities=23%  Similarity=0.590  Sum_probs=7.6

Q ss_pred             ceecccccccccC
Q psy2414          36 MYKCVICLKSVRS   48 (114)
Q Consensus        36 ~~~C~~C~~~f~~   48 (114)
                      -|.|..|+-.+..
T Consensus        28 ~W~C~~Cgh~w~~   40 (55)
T PF14311_consen   28 WWKCPKCGHEWKA   40 (55)
T ss_pred             EEECCCCCCeeEc
Confidence            3677777655533


No 218
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=21.89  E-value=74  Score=14.83  Aligned_cols=26  Identities=8%  Similarity=0.045  Sum_probs=14.8

Q ss_pred             cccCCCCCCCCCCCCCCCceeccccccc
Q psy2414          18 ITRNNTDSIFYPDPASPGMYKCVICLKS   45 (114)
Q Consensus        18 ~~c~~c~~~f~~~~~~~~~~~C~~C~~~   45 (114)
                      ..|+.|++.+...  ...-+.|..|+..
T Consensus        12 ~~C~~C~~~i~~~--~~~~~~C~~C~~~   37 (50)
T cd00029          12 TFCDVCRKSIWGL--FKQGLRCSWCKVK   37 (50)
T ss_pred             CChhhcchhhhcc--ccceeEcCCCCCc
Confidence            3477777665431  2345667777544


No 219
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=21.49  E-value=18  Score=19.14  Aligned_cols=33  Identities=18%  Similarity=0.415  Sum_probs=15.2

Q ss_pred             eecccccccccChhhHHhhhcCC-CccCCCCcCc
Q psy2414          37 YKCVICLKSVRSRWHHLQTHFSR-NHKCPYCESV   69 (114)
Q Consensus        37 ~~C~~C~~~f~~~~~h~~~h~~~-~~~c~~C~~~   69 (114)
                      |.|..|+..-...-..+..+.|- -.+|+-|...
T Consensus         5 FTC~~C~~Rs~~~~sk~aY~~GvViv~C~gC~~~   38 (66)
T PF05180_consen    5 FTCNKCGTRSAKMFSKQAYHKGVVIVQCPGCKNR   38 (66)
T ss_dssp             EEETTTTEEEEEEEEHHHHHTSEEEEE-TTS--E
T ss_pred             EEcCCCCCccceeeCHHHHhCCeEEEECCCCcce
Confidence            66777763321111134455555 6777777543


No 221
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=21.42  E-value=80  Score=14.51  Aligned_cols=26  Identities=8%  Similarity=0.027  Sum_probs=15.2

Q ss_pred             ccccCCCCCCCCCCCCCCCceeccccccc
Q psy2414          17 FITRNNTDSIFYPDPASPGMYKCVICLKS   45 (114)
Q Consensus        17 ~~~c~~c~~~f~~~~~~~~~~~C~~C~~~   45 (114)
                      ...|+.|++.+....   ..+.|..|+..
T Consensus        11 ~~~C~~C~~~i~~~~---~~~~C~~C~~~   36 (49)
T smart00109       11 PTKCCVCRKSIWGSF---QGLRCSWCKVK   36 (49)
T ss_pred             CCCccccccccCcCC---CCcCCCCCCch
Confidence            345777777664421   35667777543


No 222
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=21.22  E-value=72  Score=18.45  Aligned_cols=13  Identities=8%  Similarity=-0.225  Sum_probs=6.3

Q ss_pred             CCccccCCCCCCC
Q psy2414          15 QPFITRNNTDSIF   27 (114)
Q Consensus        15 ~~~~~c~~c~~~f   27 (114)
                      .....|..|+..-
T Consensus        20 ~k~FtCp~Cghe~   32 (104)
T COG4888          20 PKTFTCPRCGHEK   32 (104)
T ss_pred             CceEecCccCCee
Confidence            3344555555443


No 223
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=21.08  E-value=1.1e+02  Score=14.50  Aligned_cols=20  Identities=15%  Similarity=0.416  Sum_probs=11.4

Q ss_pred             ccCCCCCCCCCCCCCCCceeccccc
Q psy2414          19 TRNNTDSIFYPDPASPGMYKCVICL   43 (114)
Q Consensus        19 ~c~~c~~~f~~~~~~~~~~~C~~C~   43 (114)
                      .|+.|++..    .| ..|.|..|.
T Consensus         2 ~C~~C~~~i----~g-~r~~C~~C~   21 (46)
T cd02249           2 SCDGCLKPI----VG-VRYHCLVCE   21 (46)
T ss_pred             CCcCCCCCC----cC-CEEECCCCC
Confidence            477777622    22 456676664


No 224
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=21.01  E-value=1e+02  Score=15.03  Aligned_cols=7  Identities=0%  Similarity=-0.054  Sum_probs=3.8

Q ss_pred             ccCCCCC
Q psy2414          19 TRNNTDS   25 (114)
Q Consensus        19 ~c~~c~~   25 (114)
                      .|+.|+.
T Consensus         2 ~Cd~C~~    8 (48)
T cd02341           2 KCDSCGI    8 (48)
T ss_pred             CCCCCCC
Confidence            4555554


No 225
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=20.96  E-value=51  Score=15.31  Aligned_cols=15  Identities=13%  Similarity=0.319  Sum_probs=7.3

Q ss_pred             CCCCccccCCCCCCC
Q psy2414          13 PIQPFITRNNTDSIF   27 (114)
Q Consensus        13 ~~~~~~~c~~c~~~f   27 (114)
                      ++...+.|..|+..|
T Consensus        24 ~mT~fy~C~~C~~~w   38 (40)
T smart00440       24 PMTVFYVCTKCGHRW   38 (40)
T ss_pred             CCeEEEEeCCCCCEe
Confidence            333445555555443


No 226
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=20.36  E-value=72  Score=14.32  Aligned_cols=11  Identities=27%  Similarity=0.606  Sum_probs=4.9

Q ss_pred             eeccccccccc
Q psy2414          37 YKCVICLKSVR   47 (114)
Q Consensus        37 ~~C~~C~~~f~   47 (114)
                      +.|+.|++.+.
T Consensus         5 ~~C~nC~R~v~   15 (33)
T PF08209_consen    5 VECPNCGRPVA   15 (33)
T ss_dssp             EE-TTTSSEEE
T ss_pred             EECCCCcCCcc
Confidence            44555555443


No 227
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=20.10  E-value=49  Score=20.26  Aligned_cols=22  Identities=32%  Similarity=0.416  Sum_probs=18.1

Q ss_pred             eecccccccccChhhHHhhhcC
Q psy2414          37 YKCVICLKSVRSRWHHLQTHFS   58 (114)
Q Consensus        37 ~~C~~C~~~f~~~~~h~~~h~~   58 (114)
                      -.|.++|+.|++...|+..|-+
T Consensus        77 IicLEDGkkfKSLKRHL~t~~g   98 (148)
T COG4957          77 IICLEDGKKFKSLKRHLTTHYG   98 (148)
T ss_pred             EEEeccCcchHHHHHHHhcccC
Confidence            5799999999888778888755


No 228
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=20.01  E-value=52  Score=19.09  Aligned_cols=15  Identities=27%  Similarity=0.738  Sum_probs=12.2

Q ss_pred             CccCCCCcCcccChh
Q psy2414          60 NHKCPYCESVYSRVD   74 (114)
Q Consensus        60 ~~~c~~C~~~f~~~~   74 (114)
                      |++|.-||..|.+-+
T Consensus         2 pH~CtrCG~vf~~g~   16 (112)
T COG3364           2 PHQCTRCGEVFDDGS   16 (112)
T ss_pred             Cceeccccccccccc
Confidence            578999999998853


Done!