BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy2420
(174 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2P6R|A Chain A, Crystal Structure Of Superfamily 2 Helicase Hel308 In
Complex With Unwound Dna
pdb|2P6U|A Chain A, Apo Structure Of The Hel308 Superfamily 2 Helicase
Length = 702
Score = 28.1 bits (61), Expect = 3.0, Method: Composition-based stats.
Identities = 16/73 (21%), Positives = 33/73 (45%), Gaps = 4/73 (5%)
Query: 89 GTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQNGLLTPNFKMQR 148
G L ++C P ++++ + +W ++ F K++ +P FSV+ K
Sbjct: 509 GALHLICRTPDMERLTVRKTDSWVEEEA---FRLRKELSYYPSDFSVEYDWFLSEVKTAL 565
Query: 149 AQLKSYFKPQIED 161
LK + + + ED
Sbjct: 566 C-LKDWIEEKDED 577
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.134 0.388
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,940,104
Number of Sequences: 62578
Number of extensions: 177824
Number of successful extensions: 386
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 384
Number of HSP's gapped (non-prelim): 3
length of query: 174
length of database: 14,973,337
effective HSP length: 92
effective length of query: 82
effective length of database: 9,216,161
effective search space: 755725202
effective search space used: 755725202
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 48 (23.1 bits)