Query         psy2440
Match_columns 60
No_of_seqs    118 out of 1025
Neff          8.1 
Searched_HMMs 46136
Date          Sat Aug 17 00:59:19 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2440.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2440hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4171|consensus               99.9 6.8E-22 1.5E-26  133.4   6.8   60    1-60    482-542 (671)
  2 KOG1023|consensus               99.6 3.9E-16 8.4E-21  103.4   4.9   59    2-60    337-398 (484)
  3 KOG3618|consensus               99.5 2.5E-15 5.5E-20  103.9   2.3   59    2-60    381-439 (1318)
  4 KOG3619|consensus               99.5   6E-14 1.3E-18   97.6   6.3   58    3-60    154-211 (867)
  5 PF00211 Guanylate_cyc:  Adenyl  99.4 4.9E-13 1.1E-17   77.7   5.3   59    2-60     49-107 (184)
  6 KOG3619|consensus               99.3 2.4E-12 5.3E-17   89.7   4.5   60    1-60    697-766 (867)
  7 cd07302 CHD cyclase homology d  99.2 1.2E-10 2.6E-15   66.2   8.0   59    2-60     42-102 (177)
  8 smart00044 CYCc Adenylyl- / gu  99.2 2.1E-10 4.6E-15   67.3   7.9   58    3-60     78-137 (194)
  9 COG2114 CyaA Adenylate cyclase  99.0 1.8E-09 3.9E-14   65.6   7.0   55    2-60     87-142 (227)
 10 KOG3618|consensus               99.0 1.4E-10   3E-15   81.0   0.8   60    1-60   1128-1195(1318)
 11 cd07556 Nucleotidyl_cyc_III Cl  92.1       1 2.2E-05   23.8   7.4   49    6-59     46-94  (133)
 12 PRK02240 GTP cyclohydrolase II  73.1      12 0.00026   23.8   4.5    8   11-18    186-193 (254)
 13 COG2429 Archaeal GTP cyclohydr  69.8      11 0.00025   23.8   3.9   11   11-21    182-192 (250)
 14 cd01906 proteasome_protease_Hs  53.8      35 0.00075   19.4   3.8   21    2-22     29-50  (182)
 15 PF05165 GGDN:  GGDN family;  I  50.7      18 0.00039   22.9   2.4    9   11-19    178-186 (246)
 16 COG1058 CinA Predicted nucleot  43.1      56  0.0012   20.8   3.7   23    3-25     36-76  (255)
 17 PF00990 GGDEF:  GGDEF domain;   40.9      58  0.0013   17.3   3.3   49    9-59     79-129 (161)
 18 cd03759 proteasome_beta_type_3  39.9      57  0.0012   19.2   3.3   19    3-21     33-52  (195)
 19 cd03756 proteasome_alpha_arche  39.2      74  0.0016   18.9   3.8   21    2-22     56-77  (211)
 20 PF10386 DUF2441:  Protein of u  37.5      54  0.0012   19.1   2.8   21    3-23    102-123 (141)
 21 cd00462 PTH Peptidyl-tRNA hydr  37.4      21 0.00046   21.2   1.2   10   51-60    123-132 (171)
 22 COG0375 HybF Zn finger protein  37.3      60  0.0013   18.3   2.9   26   33-58      5-34  (115)
 23 PF01195 Pept_tRNA_hydro:  Pept  37.1      21 0.00046   21.3   1.2   10   51-60    124-133 (184)
 24 cd03757 proteasome_beta_type_1  36.8      65  0.0014   19.3   3.3   20    2-21     37-57  (212)
 25 PRK05426 peptidyl-tRNA hydrola  34.9      24 0.00053   21.2   1.2   10   51-60    127-136 (189)
 26 TIGR03690 20S_bact_beta protea  34.3      87  0.0019   18.8   3.6   20    2-21     31-51  (219)
 27 cd03762 proteasome_beta_type_6  34.1      91   0.002   18.1   3.6   21    2-22     29-50  (188)
 28 cd01912 proteasome_beta protea  33.5      83  0.0018   18.1   3.3   20    2-21     29-49  (189)
 29 cd03758 proteasome_beta_type_2  32.9 1.1E+02  0.0023   18.0   4.5   21    2-22     30-51  (193)
 30 cd02406 CRS2 Chloroplast RNA s  32.4      70  0.0015   19.4   2.9   10   51-60    127-136 (191)
 31 PF01155 HypA:  Hydrogenase exp  31.3      95  0.0021   16.9   3.4   26   33-58      5-34  (113)
 32 COG0193 Pth Peptidyl-tRNA hydr  30.6      30 0.00066   21.1   1.1   10   51-60    127-136 (190)
 33 cd03755 proteasome_alpha_type_  30.3 1.1E+02  0.0023   18.2   3.5   21    3-23     56-77  (207)
 34 PF11590 DNAPolymera_Pol:  DNA   30.3      67  0.0014   14.8   2.0   21   19-39     20-40  (41)
 35 TIGR00447 pth peptidyl-tRNA hy  30.1      30 0.00066   20.8   1.1   10   51-60    126-135 (188)
 36 PF07530 PRE_C2HC:  Associated   27.4      39 0.00085   17.0   1.1   14    2-15     44-57  (68)
 37 KOG0443|consensus               27.1 2.2E+02  0.0048   21.4   5.0   42   10-57    424-481 (827)
 38 PF05770 Ins134_P3_kin:  Inosit  26.9      80  0.0017   20.6   2.6   19    4-22    185-205 (307)
 39 PF00885 DMRL_synthase:  6,7-di  26.0 1.3E+02  0.0029   17.2   3.2   20   26-45    125-144 (144)
 40 KOG0185|consensus               25.6   1E+02  0.0023   19.7   2.9   18    1-18     69-86  (256)
 41 cd03764 proteasome_beta_archea  24.5 1.2E+02  0.0026   17.6   2.9   20    2-21     29-49  (188)
 42 TIGR00676 fadh2 5,10-methylene  24.2      51  0.0011   20.6   1.4   35   12-46     88-123 (272)
 43 KOG1120|consensus               24.1      91   0.002   18.1   2.2   24   36-59     34-57  (134)
 44 TIGR00612 ispG_gcpE 1-hydroxy-  23.4   1E+02  0.0022   20.6   2.6   10   51-60    120-129 (346)
 45 PF10954 DUF2755:  Protein of u  23.3 1.4E+02  0.0031   16.3   2.8   29   32-60     44-72  (100)
 46 PF07865 DUF1652:  Protein of u  23.3 1.2E+02  0.0026   15.4   3.0   30   10-39     36-65  (69)
 47 PRK13302 putative L-aspartate   23.1 1.6E+02  0.0036   18.4   3.5   34   10-46    231-264 (271)
 48 PF09826 Beta_propel:  Beta pro  22.0   1E+02  0.0023   21.4   2.6   18    3-20    327-345 (521)
 49 cd03754 proteasome_alpha_type_  21.8 1.7E+02  0.0036   17.5   3.2   21    3-23     58-79  (215)
 50 PRK13303 L-aspartate dehydroge  21.8   2E+02  0.0043   17.9   3.6   43    3-47    216-261 (265)
 51 TIGR03855 NAD_NadX aspartate d  21.7 1.9E+02  0.0041   17.9   3.5   43    3-47    180-225 (229)
 52 TIGR00100 hypA hydrogenase nic  21.6 1.6E+02  0.0034   16.2   2.8   24   35-58      7-34  (115)
 53 PRK12380 hydrogenase nickel in  21.4 1.6E+02  0.0034   16.2   2.8   25   34-58      6-34  (113)
 54 cd03753 proteasome_alpha_type_  21.2   2E+02  0.0043   17.1   3.9   22    2-23     55-77  (213)
 55 cd01831 Endoglucanase_E_like E  21.1      45 0.00097   18.8   0.6   15    6-20      1-15  (169)
 56 PF04771 CAV_VP3:  Chicken anae  21.1      59  0.0013   18.2   1.0   10   51-60     29-38  (121)
 57 cd03751 proteasome_alpha_type_  20.9   2E+02  0.0044   17.2   3.6   21    2-22     58-79  (212)
 58 smart00596 PRE_C2HC PRE_C2HC d  20.9      41 0.00088   17.3   0.4   14    2-15     44-57  (69)
 59 PRK12419 riboflavin synthase s  20.7 1.6E+02  0.0035   17.4   2.9   20   27-46    136-155 (158)
 60 PF10379 nec1:  Virulence prote  20.2      69  0.0015   18.8   1.3   21    5-26      3-24  (184)
 61 PRK00366 ispG 4-hydroxy-3-meth  20.1 1.3E+02  0.0029   20.2   2.7   10   51-60    129-138 (360)

No 1  
>KOG4171|consensus
Probab=99.86  E-value=6.8e-22  Score=133.39  Aligned_cols=60  Identities=37%  Similarity=0.548  Sum_probs=57.6

Q ss_pred             CCCceEEeeeCcEEEEEeCCCCCCchhHHHHHHHHHHHHHHHHHhhcCC-CCceEEEEecC
Q psy2440           1 MKIMRQVETVGQVYMAVSGAPEETPHHACNISDLSLSFIETVENMKEGS-DNNIQIRIDEG   60 (60)
Q Consensus         1 ~~~v~KvktiGD~ym~~~Glp~~~~~ha~~~~~~al~m~~~~~~~~~~~-~~~~~iRIGi~   60 (60)
                      +++|||||||||+||+++|+|.++++||+.++++||+|+...+++-.+. +.+++|||||+
T Consensus       482 ~~~VYKVETIGDaYm~vsG~P~~~~~HAe~i~~~AL~Mm~~ak~v~~p~~~~pi~iRiGIH  542 (671)
T KOG4171|consen  482 THDVYKVETIGDAYMVVSGLPDASDYHAEHIADLALGMMEEAKEVVSPVTGEPIQIRIGIH  542 (671)
T ss_pred             ccCeEEEeeccchheeecCCCCCChhHHHHHHHHHHHHHHHhhhhcCcCCCCceEEEEEec
Confidence            4799999999999999999999999999999999999999999999987 79999999996


No 2  
>KOG1023|consensus
Probab=99.63  E-value=3.9e-16  Score=103.43  Aligned_cols=59  Identities=29%  Similarity=0.455  Sum_probs=55.8

Q ss_pred             CCceEEeeeCcEEEEEeCCCCCCc-hhHHHHHHHHHHHHHHHHHhhcCCC--CceEEEEecC
Q psy2440           2 KIMRQVETVGQVYMAVSGAPEETP-HHACNISDLSLSFIETVENMKEGSD--NNIQIRIDEG   60 (60)
Q Consensus         2 ~~v~KvktiGD~ym~~~Glp~~~~-~ha~~~~~~al~m~~~~~~~~~~~~--~~~~iRIGi~   60 (60)
                      +|+|||+||||+||+++|+|..+. .|+..++.++++++..++.|..+|.  .++++|||++
T Consensus       337 ~d~yKVetiGDaYmvvSglp~~n~~~H~~eia~msl~~~~~~~~f~i~H~P~~~l~iRig~~  398 (484)
T KOG1023|consen  337 HDVYKVETIGDAYMVVSGLPIRNGYRHAREIASMALGLRSFLESFSLPHRPWEKLRLRIGFH  398 (484)
T ss_pred             cCCeeEeccCcceeecccCceecHhHHHHHHHHHHHHHHHHHhccCCCCCCchhhheeeccc
Confidence            689999999999999999999987 5999999999999999999999986  8999999985


No 3  
>KOG3618|consensus
Probab=99.54  E-value=2.5e-15  Score=103.92  Aligned_cols=59  Identities=20%  Similarity=0.461  Sum_probs=56.9

Q ss_pred             CCceEEeeeCcEEEEEeCCCCCCchhHHHHHHHHHHHHHHHHHhhcCCCCceEEEEecC
Q psy2440           2 KIMRQVETVGQVYMAVSGAPEETPHHACNISDLSLSFIETVENMKEGSDNNIQIRIDEG   60 (60)
Q Consensus         2 ~~v~KvktiGD~ym~~~Glp~~~~~ha~~~~~~al~m~~~~~~~~~~~~~~~~iRIGi~   60 (60)
                      .+.+||.|.||||.|++|.|+|+.|||-+++++.|+|+.++++|....++.++||+|++
T Consensus       381 ~gcEKISTLGDCYYCVaGCPEPraDHA~ccvEMGLgMI~AirqFd~~r~e~VnMRVGvH  439 (1318)
T KOG3618|consen  381 TGCEKISTLGDCYYCVAGCPEPRADHAYCCVEMGLGMIKAIRQFDQERKEMVNMRVGVH  439 (1318)
T ss_pred             cCcchhccccceeeeecCCCCCcccceeeehhhcchHHHHHHHHHHHhhcccceEEEEe
Confidence            47899999999999999999999999999999999999999999999999999999985


No 4  
>KOG3619|consensus
Probab=99.49  E-value=6e-14  Score=97.56  Aligned_cols=58  Identities=24%  Similarity=0.545  Sum_probs=55.7

Q ss_pred             CceEEeeeCcEEEEEeCCCCCCchhHHHHHHHHHHHHHHHHHhhcCCCCceEEEEecC
Q psy2440           3 IMRQVETVGQVYMAVSGAPEETPHHACNISDLSLSFIETVENMKEGSDNNIQIRIDEG   60 (60)
Q Consensus         3 ~v~KvktiGD~ym~~~Glp~~~~~ha~~~~~~al~m~~~~~~~~~~~~~~~~iRIGi~   60 (60)
                      ...+||..||||.|++|+|.+++|||..++++.++|++.++.++...+.+++|||||+
T Consensus       154 ~clRiKiLGdcyyCvsglp~~~~dHA~~~v~mgl~Mi~aI~~vr~at~~dvnmrvGih  211 (867)
T KOG3619|consen  154 HCLRIKILGDCYYCVSGLPEARPDHAVCCVEMGLDMIKAIKQVREATGVDVNMRVGIH  211 (867)
T ss_pred             ceEeeeeecceeEEecCCCCCChhHHHHHHHHHHHHHHHHHHHHHHhCCCCceEEEEe
Confidence            4678999999999999999999999999999999999999999999999999999985


No 5  
>PF00211 Guanylate_cyc:  Adenylate and Guanylate cyclase catalytic domain;  InterPro: IPR001054 Guanylate cyclases (4.6.1.2 from EC) catalyse the formation of cyclic GMP (cGMP) from GTP. cGMP acts as an intracellular messenger, activating cGMP-dependent kinases and regulating cGMP-sensitive ion channels. The role of cGMP as a second messenger in vascular smooth muscle relaxation and retinal photo-transduction is well established. Guanylate cyclase is found both in the soluble and particulate fractions of eukaryotic cells. The soluble and plasma membrane-bound forms differ in structure, regulation and other properties [, , , ]. Most currently known plasma membrane-bound forms are receptors for small polypeptides. The soluble forms of guanylate cyclase are cytoplasmic heterodimers having alpha and beta subunits.  In all characterised eukaryote guanylyl- and adenylyl cyclases, cyclic nucleotide synthesis is carried out by the conserved class III cyclase domain. ; GO: 0016849 phosphorus-oxygen lyase activity, 0009190 cyclic nucleotide biosynthetic process, 0035556 intracellular signal transduction; PDB: 3UVJ_A 1FX4_A 1WC4_B 2BW7_D 1WC1_A 1WC0_A 1WC3_A 1WC5_A 1WC6_A 3ET6_B ....
Probab=99.41  E-value=4.9e-13  Score=77.74  Aligned_cols=59  Identities=24%  Similarity=0.334  Sum_probs=53.2

Q ss_pred             CCceEEeeeCcEEEEEeCCCCCCchhHHHHHHHHHHHHHHHHHhhcCCCCceEEEEecC
Q psy2440           2 KIMRQVETVGQVYMAVSGAPEETPHHACNISDLSLSFIETVENMKEGSDNNIQIRIDEG   60 (60)
Q Consensus         2 ~~v~KvktiGD~ym~~~Glp~~~~~ha~~~~~~al~m~~~~~~~~~~~~~~~~iRIGi~   60 (60)
                      ++.++++++||+||++||.|.+..+|+..++++|+++++.+++++.....++++||||+
T Consensus        49 ~~g~~~~~~Gd~~~~~f~~~~~~~~~~~~a~~~al~~~~~~~~~~~~~~~~~~~rIGI~  107 (184)
T PF00211_consen   49 HGGEIIKFIGDGVMAVFGLPEPDEDAAERAVQFALALLEALERLNKESGPPLSVRIGIH  107 (184)
T ss_dssp             TTEEEEEEETTEEEEEESSSSCHCHHHHHHHHHHHHHHHHHHHHHHHHHSS-EEEEEEE
T ss_pred             ccccccccccceeEEEeccccccccccccccccccchhhcccccccccceeeeeecccc
Confidence            35789999999999999999888899999999999999999998887778999999985


No 6  
>KOG3619|consensus
Probab=99.31  E-value=2.4e-12  Score=89.72  Aligned_cols=60  Identities=23%  Similarity=0.439  Sum_probs=52.8

Q ss_pred             CCCceEEeeeCcEEEEEeCCC-CC----C-----chhHHHHHHHHHHHHHHHHHhhcCCCCceEEEEecC
Q psy2440           1 MKIMRQVETVGQVYMAVSGAP-EE----T-----PHHACNISDLSLSFIETVENMKEGSDNNIQIRIDEG   60 (60)
Q Consensus         1 ~~~v~KvktiGD~ym~~~Glp-~~----~-----~~ha~~~~~~al~m~~~~~~~~~~~~~~~~iRIGi~   60 (60)
                      |++|+||||||.+|||++|+- .+    +     ..|....++||++|...+...|...-+.+++||||+
T Consensus       697 F~~IEKIKTIGSTYMAAsGL~~~~~~~~~~~~~~~~h~~~l~eFAlal~~~L~~IN~~SfNnF~LrIGin  766 (867)
T KOG3619|consen  697 FSGVEKIKTIGSTYMAASGLNPTSAQENDQSLRQWSHLGALVEFALALMHKLDEINRHSFNNFELRIGIN  766 (867)
T ss_pred             cccceeEEEecchhhhhhCCChhhhhccCcchhHHhhHHHHHHHHHHHHHHHHhhhHHhhccceeeecee
Confidence            789999999999999999993 22    1     158899999999999999999977779999999985


No 7  
>cd07302 CHD cyclase homology domain. Catalytic domains of the mononucleotidyl cyclases (MNC's), also called cyclase homology domains (CHDs), are part of the class III nucleotidyl cyclases. This class includes eukaryotic and prokaryotic adenylate cyclases (AC's) and guanylate cyclases (GC's). They seem to share a common catalytic mechanism in their requirement for two magnesium ions to bind the polyphosphate moiety of the nucleotide.
Probab=99.23  E-value=1.2e-10  Score=66.22  Aligned_cols=59  Identities=22%  Similarity=0.273  Sum_probs=53.7

Q ss_pred             CCceEEeeeCcEEEEEeCCCCCCchhHHHHHHHHHHHHHHHHHhhcC--CCCceEEEEecC
Q psy2440           2 KIMRQVETVGQVYMAVSGAPEETPHHACNISDLSLSFIETVENMKEG--SDNNIQIRIDEG   60 (60)
Q Consensus         2 ~~v~KvktiGD~ym~~~Glp~~~~~ha~~~~~~al~m~~~~~~~~~~--~~~~~~iRIGi~   60 (60)
                      .+.+++++.||++|++|+.|....+++.+++++|+++++.+.+++.+  ....+++||||+
T Consensus        42 ~~g~~~~~~gd~~~~~f~~~~~~~~~~~~A~~~a~~i~~~~~~~~~~~~~~~~~~~riGi~  102 (177)
T cd07302          42 HGGTVDKTIGDAVMAVFGLPGAHEDHAERAVRAALEMQEALAELNAEREGGPPLRLRIGIH  102 (177)
T ss_pred             cCCEEEEEeCceEEEEeCCCCCchhHHHHHHHHHHHHHHHHHHHhhcccCCCCeEEEEEEe
Confidence            36789999999999999999999999999999999999999998876  458999999985


No 8  
>smart00044 CYCc Adenylyl- / guanylyl cyclase, catalytic domain. Present in two copies in mammalian adenylyl cyclases. Eubacterial homologues are known. Two residues (Asn, Arg) are thought to be involved in catalysis. These cyclases have important roles in a diverse range of cellular processes.
Probab=99.18  E-value=2.1e-10  Score=67.35  Aligned_cols=58  Identities=31%  Similarity=0.469  Sum_probs=52.1

Q ss_pred             CceEEeeeCcEEEEEeCCCCCC-chhHHHHHHHHHHHHHHHHHhhcCC-CCceEEEEecC
Q psy2440           3 IMRQVETVGQVYMAVSGAPEET-PHHACNISDLSLSFIETVENMKEGS-DNNIQIRIDEG   60 (60)
Q Consensus         3 ~v~KvktiGD~ym~~~Glp~~~-~~ha~~~~~~al~m~~~~~~~~~~~-~~~~~iRIGi~   60 (60)
                      +.+.++++||++|++||.|... .+|+.+++.+|+++++.+.+++.+. ..++++||||+
T Consensus        78 gg~v~~~~Gd~~l~~F~~~~~~~~~~a~~a~~~al~l~~~~~~~~~~~~~~~l~~riGih  137 (194)
T smart00044       78 GGYKVKTIGDAYMVVSGLPTEALVDHAELAADEALDMVESLKTVLSQHRGNGLRVRIGIH  137 (194)
T ss_pred             CeEEEEEeCCEEEEEECCCCCcchHHHHHHHHHHHHHHHHHHHHHhhccCCCeeEEEEEe
Confidence            5688999999999999999887 4999999999999999999988765 48899999985


No 9  
>COG2114 CyaA Adenylate cyclase, family 3 (some proteins contain HAMP domain) [Signal transduction mechanisms]
Probab=99.02  E-value=1.8e-09  Score=65.61  Aligned_cols=55  Identities=24%  Similarity=0.352  Sum_probs=43.0

Q ss_pred             CCceEEeeeCcEEEEEeCCCCCCchhHHHHHH-HHHHHHHHHHHhhcCCCCceEEEEecC
Q psy2440           2 KIMRQVETVGQVYMAVSGAPEETPHHACNISD-LSLSFIETVENMKEGSDNNIQIRIDEG   60 (60)
Q Consensus         2 ~~v~KvktiGD~ym~~~Glp~~~~~ha~~~~~-~al~m~~~~~~~~~~~~~~~~iRIGi~   60 (60)
                      ++...+|+|||++|++||.|.+.+ ++.+++. ..++|.+...+++.+.   +++||||+
T Consensus        87 ~gG~v~k~iGD~~la~F~~p~~~~-~A~~~a~~~~~~~~~~~~~~~~~~---l~~riGi~  142 (227)
T COG2114          87 HGGRVVKFIGDGFLAVFGRPSPLE-DAVACALDLQLALRNPLARLRRES---LRVRIGIH  142 (227)
T ss_pred             cCCEEEEEecceEEEEeCCCCCcH-HHHHHHHHHHHHHHHHHhhccCcC---eeEEEEEE
Confidence            456788999999999999998877 5544444 6777877777766554   99999986


No 10 
>KOG3618|consensus
Probab=98.97  E-value=1.4e-10  Score=81.00  Aligned_cols=60  Identities=18%  Similarity=0.350  Sum_probs=51.6

Q ss_pred             CCCceEEeeeCcEEEEEeCCCCC-C------chhHHHHHHHHHHHHHHHHHhhcCCC-CceEEEEecC
Q psy2440           1 MKIMRQVETVGQVYMAVSGAPEE-T------PHHACNISDLSLSFIETVENMKEGSD-NNIQIRIDEG   60 (60)
Q Consensus         1 ~~~v~KvktiGD~ym~~~Glp~~-~------~~ha~~~~~~al~m~~~~~~~~~~~~-~~~~iRIGi~   60 (60)
                      |..++||||||-+|||++||-.. .      .+|-....+||++|++.+..||.... -++.+|||++
T Consensus      1128 f~~iEKIKTIG~tyMAASGLnp~~~~~~~hp~EHl~~l~eFa~amq~Vvd~FN~dlL~Fnf~lrvG~N 1195 (1318)
T KOG3618|consen 1128 FSSIEKIKTIGATYMAASGLNPAQAQDGSHPQEHLQILFEFAKAMQRVVDDFNNDLLWFNFKLRVGFN 1195 (1318)
T ss_pred             chhhHHHhhhhHHHHHhcCCChHHccCCCChHHHHHHHHHHHHHHHHHHHHhhhhhhheeeeEEeecc
Confidence            67899999999999999999322 1      26889999999999999999998765 6899999975


No 11 
>cd07556 Nucleotidyl_cyc_III Class III nucleotidyl cyclases. Class III nucleotidyl cyclases are the largest, most diverse group of nucleotidyl cyclases (NC's) containing prokaryotic and eukaryotic proteins. They can be divided into two major groups; the mononucleotidyl cyclases (MNC's) and the diguanylate cyclases (DGC's).  The MNC's, which include the adenylate cyclases (AC's) and the guanylate cyclases (GC's), have a conserved cyclase homology domain (CHD), while the DGC's have a conserved GGDEF domain, named after a conserved motif within this subgroup. Their products, cyclic guanylyl and adenylyl nucleotides, are second messengers that play important roles in eukaryotic signal transduction and prokaryotic sensory pathways.
Probab=92.06  E-value=1  Score=23.82  Aligned_cols=49  Identities=24%  Similarity=0.494  Sum_probs=33.8

Q ss_pred             EEeeeCcEEEEEeCCCCCCchhHHHHHHHHHHHHHHHHHhhcCCCCceEEEEec
Q psy2440           6 QVETVGQVYMAVSGAPEETPHHACNISDLSLSFIETVENMKEGSDNNIQIRIDE   59 (60)
Q Consensus         6 KvktiGD~ym~~~Glp~~~~~ha~~~~~~al~m~~~~~~~~~~~~~~~~iRIGi   59 (60)
                      -.++-||.+++++..     +....+..++..+.+.+.+........+.++||+
T Consensus        46 ~~r~~~d~f~~l~~~-----~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~ig~   94 (133)
T cd07556          46 KIKTIGDEFMVVSGL-----DHPAAAVAFAEDMREAVSALNQSEGNPVRVRIGI   94 (133)
T ss_pred             EEEeecceEEEEECc-----hHHHHHHHHHHHHHHHHHHHHhccCCceEEEEEE
Confidence            445789999999743     2346677788888888776554344567777775


No 12 
>PRK02240 GTP cyclohydrolase III; Provisional
Probab=73.12  E-value=12  Score=23.83  Aligned_cols=8  Identities=38%  Similarity=0.642  Sum_probs=7.0

Q ss_pred             CcEEEEEe
Q psy2440          11 GQVYMAVS   18 (60)
Q Consensus        11 GD~ym~~~   18 (60)
                      ||-+|++|
T Consensus       186 GDN~~~~~  193 (254)
T PRK02240        186 GDNFMAPC  193 (254)
T ss_pred             CceEEEEC
Confidence            59999998


No 13 
>COG2429 Archaeal GTP cyclohydrolase III [Nucleotide transport and    metabolism]
Probab=69.83  E-value=11  Score=23.81  Aligned_cols=11  Identities=36%  Similarity=0.347  Sum_probs=8.6

Q ss_pred             CcEEEEEeCCC
Q psy2440          11 GQVYMAVSGAP   21 (60)
Q Consensus        11 GD~ym~~~Glp   21 (60)
                      ||-||+++..-
T Consensus       182 GDN~ma~~p~~  192 (250)
T COG2429         182 GDNIMAVCPGL  192 (250)
T ss_pred             CcceEEECCCC
Confidence            59999998554


No 14 
>cd01906 proteasome_protease_HslV proteasome_protease_HslV. This group contains the eukaryotic proteosome alpha and beta subunits and the prokaryotic protease hslV subunit. Proteasomes are large multimeric self-compartmentalizing proteases, involved in the clearance of misfolded proteins, the breakdown of regulatory proteins, and the processing of proteins such as the preparation of peptides for immune presentation. Two main proteasomal types are distinguished by their different tertiary structures: the eukaryotic/archeal 20S proteasome and the prokaryotic proteasome-like heat shock protein encoded by heat shock locus V, hslV.  The proteasome core particle is a highly conserved cylindrical structure made up of non-identical subunits that have their active sites on the inner walls of a large central cavity. The proteasome subunits of bacteria, archaea, and eukaryotes all share a conserved Ntn (N terminal nucleophile) hydrolase fold and a catalytic mechanism involving an N-terminal nucleo
Probab=53.81  E-value=35  Score=19.43  Aligned_cols=21  Identities=10%  Similarity=0.222  Sum_probs=16.9

Q ss_pred             CCceEEeeeCc-EEEEEeCCCC
Q psy2440           2 KIMRQVETVGQ-VYMAVSGAPE   22 (60)
Q Consensus         2 ~~v~KvktiGD-~ym~~~Glp~   22 (60)
                      .++.||-.|+| .+++.+|.+.
T Consensus        29 ~~~~Ki~~i~~~i~~~~sG~~~   50 (182)
T cd01906          29 STVEKIFKIDDHIGCAFAGLAA   50 (182)
T ss_pred             CCcceEEEECCCEEEEEeeCHH
Confidence            45778999998 6888999974


No 15 
>PF05165 GGDN:  GGDN family;  InterPro: IPR007839 GTP cyclohydrolase III catalyses the formation of 2-amino-5-formylamino-6- ribofuranosylamino-4(3H)-pyrimidinone ribonucleotide monophosphate and inorganic phosphate from GTP. The enzyme also has an independent pyrophosphate phosphohydrolase activity. The proteins are 200-270 amino acids in length.; GO: 0003933 GTP cyclohydrolase activity, 0009058 biosynthetic process; PDB: 2QV6_B.
Probab=50.73  E-value=18  Score=22.92  Aligned_cols=9  Identities=44%  Similarity=0.490  Sum_probs=6.7

Q ss_pred             CcEEEEEeC
Q psy2440          11 GQVYMAVSG   19 (60)
Q Consensus        11 GD~ym~~~G   19 (60)
                      ||-+|+++.
T Consensus       178 GDNi~~v~p  186 (246)
T PF05165_consen  178 GDNIMAVCP  186 (246)
T ss_dssp             TTEEEEE-T
T ss_pred             CceEEEECC
Confidence            699999883


No 16 
>COG1058 CinA Predicted nucleotide-utilizing enzyme related to molybdopterin-biosynthesis enzyme MoeA [General function prediction only]
Probab=43.08  E-value=56  Score=20.80  Aligned_cols=23  Identities=26%  Similarity=0.504  Sum_probs=15.2

Q ss_pred             CceEEeeeCc-----------------EEEEEeCC-CCCCc
Q psy2440           3 IMRQVETVGQ-----------------VYMAVSGA-PEETP   25 (60)
Q Consensus         3 ~v~KvktiGD-----------------~ym~~~Gl-p~~~~   25 (60)
                      +|+++.++||                 -.+..+|| |.+++
T Consensus        36 ~v~~~~~VgD~~~~I~~~l~~a~~r~D~vI~tGGLGPT~DD   76 (255)
T COG1058          36 DLARITTVGDNPDRIVEALREASERADVVITTGGLGPTHDD   76 (255)
T ss_pred             eEEEEEecCCCHHHHHHHHHHHHhCCCEEEECCCcCCCccH
Confidence            4677777775                 45777788 66543


No 17 
>PF00990 GGDEF:  GGDEF domain;  InterPro: IPR000160 This domain appears to be ubiquitous in bacteria and is often linked to a regulatory domain, such as a phosphorylation receiver or oxygen sensing domain. Its function is to synthesize cyclic di-GMP, which is used as an intracellular signalling molecule in a wide variety of bacteria [,]. Enzymatic activity can be strongly influenced by the adjacent domains. Processes regulated by this domain include exopolysaccharide synthesis, biofilm formation, motility and cell differentiation. Structural studies of PleD from Caulobacter crescentus show that this domain forms a five-stranded beta sheet surrounded by helices, similar to the catalytic core of adenylate cyclase [].; PDB: 3IGN_A 3BRE_B 3EZU_A 3ICL_B 3PJX_A 3PJW_A 3HVW_A 3HVA_B 3I5C_B 3I5B_B ....
Probab=40.86  E-value=58  Score=17.28  Aligned_cols=49  Identities=8%  Similarity=0.152  Sum_probs=25.5

Q ss_pred             eeCcEEEEEeCCCCCCchhHHHHHHHHHHHHHHHHHhhcCCC--CceEEEEec
Q psy2440           9 TVGQVYMAVSGAPEETPHHACNISDLSLSFIETVENMKEGSD--NNIQIRIDE   59 (60)
Q Consensus         9 tiGD~ym~~~Glp~~~~~ha~~~~~~al~m~~~~~~~~~~~~--~~~~iRIGi   59 (60)
                      +=+|.|+++  +|..+.+.+..+.+...++++.+.......+  ..+.+.+|+
T Consensus        79 ~~~~~f~il--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~  129 (161)
T PF00990_consen   79 LGDDEFAIL--LPDTDSEEAEELAERLERLIDELNEPIDIDGIEVHLTLSIGI  129 (161)
T ss_dssp             EETTEEEEE--EETCTHHHHHHHHHHHHHHHHHHCCEEESTTEEEECEEEEEE
T ss_pred             ccchheeec--ccccccccchhhhhhhhhhhhhcccccccccccccccccceE
Confidence            445666665  3444444455555555555554443322223  347777775


No 18 
>cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=39.86  E-value=57  Score=19.17  Aligned_cols=19  Identities=21%  Similarity=0.560  Sum_probs=15.4

Q ss_pred             CceEEeeeCc-EEEEEeCCC
Q psy2440           3 IMRQVETVGQ-VYMAVSGAP   21 (60)
Q Consensus         3 ~v~KvktiGD-~ym~~~Glp   21 (60)
                      ++.||-.|+| .+|+.+|++
T Consensus        33 ~~~KI~~I~~~i~~~~sG~~   52 (195)
T cd03759          33 DFQKVFRIGDRLYIGLAGLA   52 (195)
T ss_pred             CCCeEEEeCCCEEEEccchH
Confidence            5789999997 678888986


No 19 
>cd03756 proteasome_alpha_archeal proteasome_alpha_archeal. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=39.18  E-value=74  Score=18.91  Aligned_cols=21  Identities=19%  Similarity=0.245  Sum_probs=16.0

Q ss_pred             CCceEEeeeCc-EEEEEeCCCC
Q psy2440           2 KIMRQVETVGQ-VYMAVSGAPE   22 (60)
Q Consensus         2 ~~v~KvktiGD-~ym~~~Glp~   22 (60)
                      +++.||-.|.| .+|+.+|++.
T Consensus        56 ~~~~KI~~I~~~i~~~~sG~~~   77 (211)
T cd03756          56 ESIEKIYKIDDHVGAATSGLVA   77 (211)
T ss_pred             CccceEEEEcCCEEEEEecCHH
Confidence            35678888886 7788899963


No 20 
>PF10386 DUF2441:  Protein of unknown function (DUF2441);  InterPro: IPR018840  This is a family of highly conserved predicted proteins primarily found in Bacillus species. Structurally they form homo-dimers, but their function is unknown. ; PDB: 2AUA_A.
Probab=37.55  E-value=54  Score=19.15  Aligned_cols=21  Identities=19%  Similarity=0.417  Sum_probs=14.7

Q ss_pred             CceEEeeeCcEEEEEeCC-CCC
Q psy2440           3 IMRQVETVGQVYMAVSGA-PEE   23 (60)
Q Consensus         3 ~v~KvktiGD~ym~~~Gl-p~~   23 (60)
                      ++.|++++|+.+-.-+.+ |..
T Consensus       102 qIvKl~v~gn~fegD~n~lp~~  123 (141)
T PF10386_consen  102 QIVKLRVIGNSFEGDSNLLPKE  123 (141)
T ss_dssp             EEEEEEEEEEEEEE-GGGS--S
T ss_pred             eEEEEEecCCccccccccccCC
Confidence            578999999998777765 543


No 21 
>cd00462 PTH Peptidyl-tRNA hydrolase (PTH) is a monomeric protein that cleaves the ester bond linking the nascent peptide and tRNA when peptidyl-tRNA is released prematurely from the ribosome. This ensures the recycling of peptidyl-tRNAs into tRNAs produced through abortion of translation and is essential for cell viability.This group also contains chloroplast RNA splicing 2 (CRS2), which is closely related nuclear-encoded protein required for the splicing of nine group II introns in chloroplasts.
Probab=37.39  E-value=21  Score=21.18  Aligned_cols=10  Identities=30%  Similarity=0.451  Sum_probs=7.1

Q ss_pred             CceEEEEecC
Q psy2440          51 NNIQIRIDEG   60 (60)
Q Consensus        51 ~~~~iRIGi~   60 (60)
                      .-.++|||||
T Consensus       123 ~f~RlriGIG  132 (171)
T cd00462         123 DFPRLRIGIG  132 (171)
T ss_pred             CeeEEEEEeC
Confidence            4567788875


No 22 
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only]
Probab=37.32  E-value=60  Score=18.26  Aligned_cols=26  Identities=23%  Similarity=0.372  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHhhcCCC----CceEEEEe
Q psy2440          33 DLSLSFIETVENMKEGSD----NNIQIRID   58 (60)
Q Consensus        33 ~~al~m~~~~~~~~~~~~----~~~~iRIG   58 (60)
                      .+|..+++.+.+....++    ..+.+|||
T Consensus         5 Sla~aii~~i~~~A~~~~a~~V~~V~l~IG   34 (115)
T COG0375           5 SLAQAIIELIEEQAEKHGAKRVTAVWLEIG   34 (115)
T ss_pred             HHHHHHHHHHHHHHHHcCCceEEEEEEEEc
Confidence            456666666666665554    57777777


No 23 
>PF01195 Pept_tRNA_hydro:  Peptidyl-tRNA hydrolase;  InterPro: IPR001328 Peptidyl-tRNA hydrolase (3.1.1.29 from EC) (PTH) is a bacterial enzyme that cleaves peptidyl-tRNA or N-acyl-aminoacyl-tRNA to yield free peptides or N-acyl-amino acids and tRNA. The natural substrate for this enzyme may be peptidyl-tRNA which drop off the ribosome during protein synthesis [, ]. Bacterial PTH has been found to be evolutionary related to a yeast protein [].; GO: 0004045 aminoacyl-tRNA hydrolase activity; PDB: 3KJZ_A 3KK0_A 3P2J_A 3V2I_A 3TCN_A 3TD6_A 2Z2K_A 3TD2_A 2Z2J_B 2JRC_A ....
Probab=37.07  E-value=21  Score=21.27  Aligned_cols=10  Identities=30%  Similarity=0.451  Sum_probs=6.6

Q ss_pred             CceEEEEecC
Q psy2440          51 NNIQIRIDEG   60 (60)
Q Consensus        51 ~~~~iRIGi~   60 (60)
                      .-.++|||||
T Consensus       124 ~f~RlrIGIG  133 (184)
T PF01195_consen  124 DFPRLRIGIG  133 (184)
T ss_dssp             GSEEEEEEE-
T ss_pred             cceeEEEecC
Confidence            5677788875


No 24 
>cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=36.77  E-value=65  Score=19.27  Aligned_cols=20  Identities=10%  Similarity=0.111  Sum_probs=15.8

Q ss_pred             CCceEEeeeCc-EEEEEeCCC
Q psy2440           2 KIMRQVETVGQ-VYMAVSGAP   21 (60)
Q Consensus         2 ~~v~KvktiGD-~ym~~~Glp   21 (60)
                      +++.||.-|+| .+++.+|+.
T Consensus        37 ~~~~KI~~I~~~i~~~~sG~~   57 (212)
T cd03757          37 RDSPKIFKLTDKCVLGSSGFQ   57 (212)
T ss_pred             CCCCeEEEcCCCEEEEccchH
Confidence            46789999997 668888985


No 25 
>PRK05426 peptidyl-tRNA hydrolase; Provisional
Probab=34.92  E-value=24  Score=21.24  Aligned_cols=10  Identities=30%  Similarity=0.478  Sum_probs=6.9

Q ss_pred             CceEEEEecC
Q psy2440          51 NNIQIRIDEG   60 (60)
Q Consensus        51 ~~~~iRIGi~   60 (60)
                      .-.++|||||
T Consensus       127 ~f~RlriGIG  136 (189)
T PRK05426        127 DFWRLRIGIG  136 (189)
T ss_pred             CeeEEEEEeC
Confidence            4567777775


No 26 
>TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type. Members of this family are the beta subunit of the 20S proteasome as found in Actinobacteria such as Mycobacterium, Rhodococcus, and Streptomyces. In Streptomyces, maturation during proteasome assembly was shown to remove a 53-amino acid propeptide. Most of the length of the propeptide is not included in this model.
Probab=34.34  E-value=87  Score=18.84  Aligned_cols=20  Identities=10%  Similarity=0.262  Sum_probs=15.4

Q ss_pred             CCceEEeeeCc-EEEEEeCCC
Q psy2440           2 KIMRQVETVGQ-VYMAVSGAP   21 (60)
Q Consensus         2 ~~v~KvktiGD-~ym~~~Glp   21 (60)
                      +++.||-.|.| .+|+.+|+.
T Consensus        31 ~~~~KI~~i~~~i~~~~sG~~   51 (219)
T TIGR03690        31 RDVEKVYPTDEYSAVGIAGTA   51 (219)
T ss_pred             CCcceEEEcCCcEEEEecccH
Confidence            46789999997 567778985


No 27 
>cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=34.12  E-value=91  Score=18.05  Aligned_cols=21  Identities=14%  Similarity=0.447  Sum_probs=14.6

Q ss_pred             CCceEEeeeCc-EEEEEeCCCC
Q psy2440           2 KIMRQVETVGQ-VYMAVSGAPE   22 (60)
Q Consensus         2 ~~v~KvktiGD-~ym~~~Glp~   22 (60)
                      +++.||..|.| .+|+.+|++-
T Consensus        29 ~~~~Ki~~i~~~i~~~~sG~~~   50 (188)
T cd03762          29 RVTDKLTQLHDRIYCCRSGSAA   50 (188)
T ss_pred             CCcccEEEccCCEEEEecccHH
Confidence            35677777775 4777889863


No 28 
>cd01912 proteasome_beta proteasome beta subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=33.50  E-value=83  Score=18.09  Aligned_cols=20  Identities=5%  Similarity=0.366  Sum_probs=15.6

Q ss_pred             CCceEEeeeCc-EEEEEeCCC
Q psy2440           2 KIMRQVETVGQ-VYMAVSGAP   21 (60)
Q Consensus         2 ~~v~KvktiGD-~ym~~~Glp   21 (60)
                      +.+.||-.|+| .+++.+|+.
T Consensus        29 ~~~~Ki~~i~~~i~~~~sG~~   49 (189)
T cd01912          29 RNFDKIFKISDNILLGTAGSA   49 (189)
T ss_pred             CCcCcEEEccCCEEEEccccH
Confidence            35678888885 788888985


No 29 
>cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis.Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=32.94  E-value=1.1e+02  Score=18.01  Aligned_cols=21  Identities=19%  Similarity=0.205  Sum_probs=16.4

Q ss_pred             CCceEEeeeCc-EEEEEeCCCC
Q psy2440           2 KIMRQVETVGQ-VYMAVSGAPE   22 (60)
Q Consensus         2 ~~v~KvktiGD-~ym~~~Glp~   22 (60)
                      +.+.||-.|.| .+++.+|+.-
T Consensus        30 ~~~~KI~~I~~~i~~~~sG~~a   51 (193)
T cd03758          30 DDEDKIYKLSDHKLMACSGEAG   51 (193)
T ss_pred             cCcccEEEeCCCeEEEEccchH
Confidence            45778888997 5789999963


No 30 
>cd02406 CRS2 Chloroplast RNA splicing 2 (CRS2) is a nuclear-encoded protein required for the splicing of group II introns in the chloroplast. CRS2 forms stable complexes with two CRS2-associated factors, CAF1 and CAF2, which are required for the splicing of distinct subsets of CRS2-dependent introns. CRS2 is closely related to bacterial peptidyl-tRNA hydrolases (PTH).
Probab=32.40  E-value=70  Score=19.42  Aligned_cols=10  Identities=20%  Similarity=0.245  Sum_probs=7.3

Q ss_pred             CceEEEEecC
Q psy2440          51 NNIQIRIDEG   60 (60)
Q Consensus        51 ~~~~iRIGi~   60 (60)
                      .-.++|||||
T Consensus       127 ~f~RlrIGIG  136 (191)
T cd02406         127 EFPRLSIGIG  136 (191)
T ss_pred             CeEEEEEEeC
Confidence            4567888886


No 31 
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=31.26  E-value=95  Score=16.94  Aligned_cols=26  Identities=23%  Similarity=0.445  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHhhcCCC----CceEEEEe
Q psy2440          33 DLSLSFIETVENMKEGSD----NNIQIRID   58 (60)
Q Consensus        33 ~~al~m~~~~~~~~~~~~----~~~~iRIG   58 (60)
                      ..+..+++.+.+....++    ..+.++||
T Consensus         5 si~~~iv~~v~~~a~~~~~~kV~~V~l~iG   34 (113)
T PF01155_consen    5 SIAQSIVEIVEEEAEENGAKKVTKVRLEIG   34 (113)
T ss_dssp             HHHHHHHHHHHHHHHCTT-SEEEEEEEEEE
T ss_pred             HHHHHHHHHHHHHHHHcCCCEEEEEEEEEC
Confidence            445666677766665443    57777777


No 32 
>COG0193 Pth Peptidyl-tRNA hydrolase [Translation, ribosomal structure and biogenesis]
Probab=30.63  E-value=30  Score=21.12  Aligned_cols=10  Identities=40%  Similarity=0.567  Sum_probs=5.9

Q ss_pred             CceEEEEecC
Q psy2440          51 NNIQIRIDEG   60 (60)
Q Consensus        51 ~~~~iRIGi~   60 (60)
                      .-.++|||||
T Consensus       127 ~f~RlRiGIG  136 (190)
T COG0193         127 NFYRLRIGIG  136 (190)
T ss_pred             ccceEEEEcC
Confidence            4456666664


No 33 
>cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=30.27  E-value=1.1e+02  Score=18.20  Aligned_cols=21  Identities=19%  Similarity=0.430  Sum_probs=16.1

Q ss_pred             CceEEeeeCc-EEEEEeCCCCC
Q psy2440           3 IMRQVETVGQ-VYMAVSGAPEE   23 (60)
Q Consensus         3 ~v~KvktiGD-~ym~~~Glp~~   23 (60)
                      ...||-.|+| .+|+.+|+.-.
T Consensus        56 ~~~KI~~I~~~i~~~~sG~~~D   77 (207)
T cd03755          56 TVRKICMLDDHVCLAFAGLTAD   77 (207)
T ss_pred             ccCcEEEECCCEEEEEecchhh
Confidence            3678889997 67888899643


No 34 
>PF11590 DNAPolymera_Pol:  DNA polymerase catalytic subunit Pol;  InterPro: IPR021639  This family of proteins represents the catalytic subunit, Pol, of the Herpes simplex virus DNA polymerase. Pol binds UL42, making up the DNA polymerase. UL42 is a processivity subunit which binds to the C-terminal of Pol in a similar way that the cell cycle regulator p21 binds to PCNA []. ; GO: 0003887 DNA-directed DNA polymerase activity, 0004523 ribonuclease H activity; PDB: 1DML_H.
Probab=30.26  E-value=67  Score=14.84  Aligned_cols=21  Identities=10%  Similarity=0.214  Sum_probs=11.3

Q ss_pred             CCCCCCchhHHHHHHHHHHHH
Q psy2440          19 GAPEETPHHACNISDLSLSFI   39 (60)
Q Consensus        19 Glp~~~~~ha~~~~~~al~m~   39 (60)
                      |+|...++...+-++-|++++
T Consensus        20 g~~~~~eeEt~qkL~~AF~iL   40 (41)
T PF11590_consen   20 GLPSSEEEETRQKLRRAFDIL   40 (41)
T ss_dssp             ------HHHHHHHHHHHHHHH
T ss_pred             cccchhhHHHHHHHHHHHHhh
Confidence            557666677777788888775


No 35 
>TIGR00447 pth peptidyl-tRNA hydrolase. The natural substrate for this enzyme may be peptidyl-tRNAs that drop off the ribosome during protein synthesis. Peptidyl-tRNA hydrolase is a bacterial protein; YHR189W from Saccharomyces cerevisiae appears to be orthologous and likely has the same function.
Probab=30.07  E-value=30  Score=20.84  Aligned_cols=10  Identities=40%  Similarity=0.498  Sum_probs=6.6

Q ss_pred             CceEEEEecC
Q psy2440          51 NNIQIRIDEG   60 (60)
Q Consensus        51 ~~~~iRIGi~   60 (60)
                      .-.++|||||
T Consensus       126 ~f~RlrIGIG  135 (188)
T TIGR00447       126 NFNRLRIGIG  135 (188)
T ss_pred             CcceEEEEeC
Confidence            4557777775


No 36 
>PF07530 PRE_C2HC:  Associated with zinc fingers;  InterPro: IPR006579 This domain is present in proteins found exclusively in the arthropods, including a number of Drosophila species, the silk moth and the gypsy moth. These proteins are possibly involved in RNA binding or single strand DNA binding.
Probab=27.42  E-value=39  Score=16.99  Aligned_cols=14  Identities=14%  Similarity=0.159  Sum_probs=11.0

Q ss_pred             CCceEEeeeCcEEE
Q psy2440           2 KIMRQVETVGQVYM   15 (60)
Q Consensus         2 ~~v~KvktiGD~ym   15 (60)
                      +++|+|+++|-.-+
T Consensus        44 k~i~~Ik~l~~~~V   57 (68)
T PF07530_consen   44 KEIYKIKTLCGQRV   57 (68)
T ss_pred             cceeehHhhCCeEE
Confidence            57899999987653


No 37 
>KOG0443|consensus
Probab=27.13  E-value=2.2e+02  Score=21.38  Aligned_cols=42  Identities=19%  Similarity=0.400  Sum_probs=25.6

Q ss_pred             eCcEEEEEeCCCCC----------------CchhHHHHHHHHHHHHHHHHHhhcCCCCceEEEE
Q psy2440          10 VGQVYMAVSGAPEE----------------TPHHACNISDLSLSFIETVENMKEGSDNNIQIRI   57 (60)
Q Consensus        10 iGD~ym~~~Glp~~----------------~~~ha~~~~~~al~m~~~~~~~~~~~~~~~~iRI   57 (60)
                      -||||++.-.-|..                ..+...+++.+|-.|...++      +.+++.||
T Consensus       424 ~GdcYlvlYtY~~~~~~~~~iiY~W~G~qAs~ee~~~a~~~A~~l~~s~k------g~~vq~rv  481 (827)
T KOG0443|consen  424 GGDCYLVLYTYPRGEERTEHIIYVWQGKQASQEERAAAISLAKALVESLK------GVPVQVRI  481 (827)
T ss_pred             CCCeEEEEEeeccCCcccceEEEEEecccCCHHHHHHHHHHHHHHhhhcC------CceeEEEe
Confidence            38999998877722                12344566677766666553      34555554


No 38 
>PF05770 Ins134_P3_kin:  Inositol 1, 3, 4-trisphosphate 5/6-kinase;  InterPro: IPR008656 This entry represents inositol-tetrakisphosphate 1-kinase which is also called inositol 1,3,4-trisphosphate 5/6-kinase. Inositol-tetrakisphosphate 1-kinase can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. This enzyme phosphorylates Ins(3,4,5,6)P4 at position 1 to form Ins(1,3,4,5,6)P5. This reaction is thought to have regulatory importance, since Ins(3,4,5,6)P4 is an inhibitor of plasma membrane Ca(2+)-activated Cl(-) channels, while Ins(1,3,4,5,6)P5 is not. It also phosphorylates Ins(1,3,4)P3 on O-5 and O-6 to form Ins(1,3,4,6)P4, an essential molecule in the hexakisphosphate (InsP6) pathway [, , , , ].; GO: 0000287 magnesium ion binding, 0005524 ATP binding, 0047325 inositol tetrakisphosphate 1-kinase activity, 0052725 inositol-1,3,4-trisphosphate 6-kinase activity, 0052726 inositol-1,3,4-trisphosphate 5-kinase activity, 0032957 inositol trisphosphate metabolic process, 0005622 intracellular; PDB: 1Z2P_X 1Z2O_X 1Z2N_X 2Q7D_A 2QB5_B 2ODT_X.
Probab=26.93  E-value=80  Score=20.58  Aligned_cols=19  Identities=26%  Similarity=0.401  Sum_probs=13.5

Q ss_pred             ceEEeeeCcEEEEEe--CCCC
Q psy2440           4 MRQVETVGQVYMAVS--GAPE   22 (60)
Q Consensus         4 v~KvktiGD~ym~~~--Glp~   22 (60)
                      +|||-.+||.+.++-  .+|+
T Consensus       185 LfKVyVvGd~v~~v~R~SLpn  205 (307)
T PF05770_consen  185 LFKVYVVGDKVFVVKRPSLPN  205 (307)
T ss_dssp             EEEEEEETTEEEEEEEE----
T ss_pred             EEEEEEecCEEEEEECCCCCC
Confidence            799999999998875  5543


No 39 
>PF00885 DMRL_synthase:  6,7-dimethyl-8-ribityllumazine synthase;  InterPro: IPR002180 6,7-dimethyl-8-ribityllumazine synthase (riboflavin synthase) catalyses the biosynthesis of riboflavin according to the reaction: 2 6,7-dimethyl-8-(1-D-ribityl)lumazine = riboflavin + 4-(1-D-ribitylamino)-5-amino-2,6-dihydroxypyrimidine.  The biosynthesis of one riboflavin molecule requires one molecule of GTP and two molecules of ribulose 5-phosphate as substrates. The final step in the biosynthesis of the vitamin involves the dismutation of 6,7-dimethyl-8-ribityllumazine catalyzed by riboflavin synthase. The second product, 5-amino-6-ribitylamino-2,4(1H,3H)-pyrimidinedione, is recycled in the biosynthetic pathway by 6,7-dimethyl-8-ribityllumazine synthase []. N-[2,4-dioxo-6-d-ribitylamino-1,2,3,4-tetrahydropyrimidin-5-yl]oxalamic acid derivatives inhibit riboflavin synthase []. This family includes the beta chain of 6,7-dimethyl-8-ribityllumazine synthase 2.5.1.9 from EC. The family also includes a subfamily of distant archaebacterial proteins that may also have the same function for example O28856 from SWISSPROT.; GO: 0009231 riboflavin biosynthetic process, 0009349 riboflavin synthase complex; PDB: 2O6H_D 1C41_C 2OBX_H 1VSX_H 1VSW_3 3JV8_C 3MK3_r 3NQ4_G 2A58_A 2A57_D ....
Probab=26.03  E-value=1.3e+02  Score=17.22  Aligned_cols=20  Identities=5%  Similarity=0.243  Sum_probs=16.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHh
Q psy2440          26 HHACNISDLSLSFIETVENM   45 (60)
Q Consensus        26 ~ha~~~~~~al~m~~~~~~~   45 (60)
                      ++...+++.|++|++..+++
T Consensus       125 nkG~eaA~aal~m~~l~~~l  144 (144)
T PF00885_consen  125 NKGREAAEAALEMAKLLRQL  144 (144)
T ss_dssp             EHHHHHHHHHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHHHHHhcC
Confidence            57788899999999887653


No 40 
>KOG0185|consensus
Probab=25.58  E-value=1e+02  Score=19.67  Aligned_cols=18  Identities=17%  Similarity=0.172  Sum_probs=14.6

Q ss_pred             CCCceEEeeeCcEEEEEe
Q psy2440           1 MKIMRQVETVGQVYMAVS   18 (60)
Q Consensus         1 ~~~v~KvktiGD~ym~~~   18 (60)
                      |++|++|.-+||--+.-.
T Consensus        69 ~~nVeRi~kVgdntllG~   86 (256)
T KOG0185|consen   69 YKNVERIFKVGDNTLLGA   86 (256)
T ss_pred             hcCceeeEEecCceEEec
Confidence            689999999998765544


No 41 
>cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme for non-lysosomal protein degradation in both the cytosol and the nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are both members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=24.54  E-value=1.2e+02  Score=17.55  Aligned_cols=20  Identities=15%  Similarity=0.424  Sum_probs=15.1

Q ss_pred             CCceEEeeeCc-EEEEEeCCC
Q psy2440           2 KIMRQVETVGQ-VYMAVSGAP   21 (60)
Q Consensus         2 ~~v~KvktiGD-~ym~~~Glp   21 (60)
                      +++.||..|+| .+++++|++
T Consensus        29 ~~~~KI~~i~~~i~~~~sG~~   49 (188)
T cd03764          29 KNVKKIFQIDDKIAMTIAGSV   49 (188)
T ss_pred             CCcccEEEccCCEEEEcCccH
Confidence            35778888884 577788986


No 42 
>TIGR00676 fadh2 5,10-methylenetetrahydrofolate reductase, prokaryotic form. This protein is an FAD-containing flavoprotein.
Probab=24.15  E-value=51  Score=20.64  Aligned_cols=35  Identities=14%  Similarity=0.160  Sum_probs=19.7

Q ss_pred             cEEEEEeCCCCCCch-hHHHHHHHHHHHHHHHHHhh
Q psy2440          12 QVYMAVSGAPEETPH-HACNISDLSLSFIETVENMK   46 (60)
Q Consensus        12 D~ym~~~Glp~~~~~-ha~~~~~~al~m~~~~~~~~   46 (60)
                      +.++++.|.|....+ .+....+.|.++++.+++.+
T Consensus        88 ~nvL~l~GD~~~~~~~~~~~~f~~a~~Li~~i~~~~  123 (272)
T TIGR00676        88 RHILALRGDPPKGEGTPTPGGFNYASELVEFIRNEF  123 (272)
T ss_pred             CEEEEeCCCCCCCCCCCCCCCCCCHHHHHHHHHHhc
Confidence            457888888764332 22122334677777776543


No 43 
>KOG1120|consensus
Probab=24.12  E-value=91  Score=18.06  Aligned_cols=24  Identities=13%  Similarity=0.282  Sum_probs=16.5

Q ss_pred             HHHHHHHHHhhcCCCCceEEEEec
Q psy2440          36 LSFIETVENMKEGSDNNIQIRIDE   59 (60)
Q Consensus        36 l~m~~~~~~~~~~~~~~~~iRIGi   59 (60)
                      -.-++.++++.....+++-+|||+
T Consensus        34 p~Av~~ik~ll~~~~e~~~lrigV   57 (134)
T KOG1120|consen   34 PSAVNHIKQLLSDKPEDVCLRIGV   57 (134)
T ss_pred             HHHHHHHHHHHHhCCcCceeEEEE
Confidence            344455666666667888899986


No 44 
>TIGR00612 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase. Chlamydial members of the family have a long insert. The family is largely restricted to Bacteria, where it is widely but not universally distributed. No homology can be detected between the GcpE family and other proteins.
Probab=23.43  E-value=1e+02  Score=20.65  Aligned_cols=10  Identities=20%  Similarity=0.305  Sum_probs=8.0

Q ss_pred             CceEEEEecC
Q psy2440          51 NNIQIRIDEG   60 (60)
Q Consensus        51 ~~~~iRIGi~   60 (60)
                      ..+.||||+|
T Consensus       120 ~~ipIRIGVN  129 (346)
T TIGR00612       120 HGKAMRIGVN  129 (346)
T ss_pred             CCCCEEEecC
Confidence            5678899986


No 45 
>PF10954 DUF2755:  Protein of unknown function (DUF2755);  InterPro: IPR020513 This entry contains membrane proteins with no known function.; GO: 0016021 integral to membrane
Probab=23.34  E-value=1.4e+02  Score=16.27  Aligned_cols=29  Identities=10%  Similarity=0.193  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHhhcCCCCceEEEEecC
Q psy2440          32 SDLSLSFIETVENMKEGSDNNIQIRIDEG   60 (60)
Q Consensus        32 ~~~al~m~~~~~~~~~~~~~~~~iRIGi~   60 (60)
                      .-.|..+.+.+-+......+.++|-.|+|
T Consensus        44 LvHAPGV~EhLmQ~Qds~RPrveigl~Vg   72 (100)
T PF10954_consen   44 LVHAPGVYEHLMQVQDSGRPRVEIGLGVG   72 (100)
T ss_pred             HHhCcHHHHHHHHHHhcCCCceEEeehhH
Confidence            34455667777777666667777666553


No 46 
>PF07865 DUF1652:  Protein of unknown function (DUF1652);  InterPro: IPR012448  The proteins in this entry have not been characterised.
Probab=23.28  E-value=1.2e+02  Score=15.43  Aligned_cols=30  Identities=20%  Similarity=0.294  Sum_probs=20.2

Q ss_pred             eCcEEEEEeCCCCCCchhHHHHHHHHHHHH
Q psy2440          10 VGQVYMAVSGAPEETPHHACNISDLSLSFI   39 (60)
Q Consensus        10 iGD~ym~~~Glp~~~~~ha~~~~~~al~m~   39 (60)
                      -|+..+.+.|+|...-...+.++.+..++.
T Consensus        36 sg~~~l~vtGI~~~~l~s~rdI~~LI~eLr   65 (69)
T PF07865_consen   36 SGRVELTVTGISTSALNSSRDIVRLIAELR   65 (69)
T ss_pred             CCcEEEEEcCcCHHHcCCHHHHHHHHHHHH
Confidence            366778899998766666666666555543


No 47 
>PRK13302 putative L-aspartate dehydrogenase; Provisional
Probab=23.15  E-value=1.6e+02  Score=18.40  Aligned_cols=34  Identities=15%  Similarity=0.143  Sum_probs=23.8

Q ss_pred             eCcEEEEEeCCCCCCchhHHHHHHHHHHHHHHHHHhh
Q psy2440          10 VGQVYMAVSGAPEETPHHACNISDLSLSFIETVENMK   46 (60)
Q Consensus        10 iGD~ym~~~Glp~~~~~ha~~~~~~al~m~~~~~~~~   46 (60)
                      .|+.++.+.|.|..   +.+-..-.|+..++.+++..
T Consensus       231 ~g~~~~~~~~~p~~---npkts~laa~s~~~~l~~~~  264 (271)
T PRK13302        231 SARFSMTIENIPSE---NPKTGRITAQSVIALLRKQS  264 (271)
T ss_pred             eEEEEEEEEcCcCC---CCchHHHHHHHHHHHHHhhc
Confidence            56788999999984   33444566777777777665


No 48 
>PF09826 Beta_propel:  Beta propeller domain;  InterPro: IPR019198 This entry consists of predicted secreted proteins containing a C-terminal beta-propeller domain distantly related to WD-40 repeats. 
Probab=21.99  E-value=1e+02  Score=21.41  Aligned_cols=18  Identities=17%  Similarity=0.298  Sum_probs=14.1

Q ss_pred             CceEEeeeCc-EEEEEeCC
Q psy2440           3 IMRQVETVGQ-VYMAVSGA   20 (60)
Q Consensus         3 ~v~KvktiGD-~ym~~~Gl   20 (60)
                      .+|-++++|| +||+.+--
T Consensus       327 ~IysvRF~Gd~~Y~VTFrq  345 (521)
T PF09826_consen  327 RIYSVRFMGDRAYLVTFRQ  345 (521)
T ss_pred             eEEEEEEeCCeEEEEEEee
Confidence            5789999997 67777754


No 49 
>cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=21.84  E-value=1.7e+02  Score=17.55  Aligned_cols=21  Identities=5%  Similarity=0.161  Sum_probs=15.2

Q ss_pred             CceEEeeeCc-EEEEEeCCCCC
Q psy2440           3 IMRQVETVGQ-VYMAVSGAPEE   23 (60)
Q Consensus         3 ~v~KvktiGD-~ym~~~Glp~~   23 (60)
                      ...||-.|.| .+|+.+|+...
T Consensus        58 ~~~Ki~~I~~~i~~~~sG~~~D   79 (215)
T cd03754          58 TVTHLFRITDEIGCVMTGMIAD   79 (215)
T ss_pred             ccCceEEEcCCEEEEEEechhh
Confidence            3567888886 67888899643


No 50 
>PRK13303 L-aspartate dehydrogenase; Provisional
Probab=21.81  E-value=2e+02  Score=17.92  Aligned_cols=43  Identities=21%  Similarity=0.274  Sum_probs=26.1

Q ss_pred             CceEEee---eCcEEEEEeCCCCCCchhHHHHHHHHHHHHHHHHHhhc
Q psy2440           3 IMRQVET---VGQVYMAVSGAPEETPHHACNISDLSLSFIETVENMKE   47 (60)
Q Consensus         3 ~v~Kvkt---iGD~ym~~~Glp~~~~~ha~~~~~~al~m~~~~~~~~~   47 (60)
                      ++.+|+-   .|+.++-+.|.|.+..  .+-..-.|+..++.+++...
T Consensus       216 n~h~i~~~g~~g~~~~~~~~~p~~~n--pkts~laa~S~~~~l~~~~~  261 (265)
T PRK13303        216 NVHEIEARGAFGEFEFEMSGKPLPDN--PKTSALTALSAIRALRNRAA  261 (265)
T ss_pred             ceEEEEEEeccEEEEEEEeCCcCCCC--CchHHHHHHHHHHHHHhhcC
Confidence            3444544   4567888889886532  23444556777777776543


No 51 
>TIGR03855 NAD_NadX aspartate dehydrogenase. Members of this protein family are L-aspartate dehydrogenase, as shown for the NADP-dependent enzyme TM_1643 of Thermotoga maritima. Members lack homology to NadB, the aspartate oxidase (EC 1.4.3.16) of most mesophilic bacteria (described by TIGR00551), which this enzyme replaces in the generation of oxaloacetate from aspartate for the NAD biosynthetic pathway. All members of the seed alignment are found adjacent to other genes of NAD biosynthesis, although other uses of L-aspartate dehydrogenase may occur.
Probab=21.71  E-value=1.9e+02  Score=17.87  Aligned_cols=43  Identities=14%  Similarity=0.203  Sum_probs=26.3

Q ss_pred             CceEEee---eCcEEEEEeCCCCCCchhHHHHHHHHHHHHHHHHHhhc
Q psy2440           3 IMRQVET---VGQVYMAVSGAPEETPHHACNISDLSLSFIETVENMKE   47 (60)
Q Consensus         3 ~v~Kvkt---iGD~ym~~~Glp~~~~~ha~~~~~~al~m~~~~~~~~~   47 (60)
                      ++.+|+-   .|+.++-+.|.|.+..  .+-..-.|+.+++.++++..
T Consensus       180 n~h~i~~~g~~g~~~~~~~~~p~~~n--pkts~laa~S~~~~l~~~~~  225 (229)
T TIGR03855       180 NIHEIFVESDFGEMEIRVENVPSPEN--PRTSYLAALSALRLLRNLAS  225 (229)
T ss_pred             cEEEEEEEeccEEEEEEEeCCcCCCC--CcHHHHHHHHHHHHHHhhcC
Confidence            3445544   4567888889886533  23344556777777776653


No 52 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=21.58  E-value=1.6e+02  Score=16.19  Aligned_cols=24  Identities=21%  Similarity=0.386  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHhhcCCC----CceEEEEe
Q psy2440          35 SLSFIETVENMKEGSD----NNIQIRID   58 (60)
Q Consensus        35 al~m~~~~~~~~~~~~----~~~~iRIG   58 (60)
                      +..+++.+.+....++    ..+.++||
T Consensus         7 a~~iv~~v~~~a~~~~~~~V~~V~l~iG   34 (115)
T TIGR00100         7 AEAMLEIVEEQAEKHQAKKVTRVTLEIG   34 (115)
T ss_pred             HHHHHHHHHHHHHHhCCCeEEEEEEEEc
Confidence            4444444444332222    56777777


No 53 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=21.39  E-value=1.6e+02  Score=16.16  Aligned_cols=25  Identities=24%  Similarity=0.364  Sum_probs=13.3

Q ss_pred             HHHHHHHHHHHhhcCCC----CceEEEEe
Q psy2440          34 LSLSFIETVENMKEGSD----NNIQIRID   58 (60)
Q Consensus        34 ~al~m~~~~~~~~~~~~----~~~~iRIG   58 (60)
                      .+..+++.+.+....++    ..+.++||
T Consensus         6 i~~~iv~~v~~~a~~~~~~rV~~V~l~iG   34 (113)
T PRK12380          6 LCQSAVEIIQRQAEQHDVKRVTAVWLEIG   34 (113)
T ss_pred             HHHHHHHHHHHHHHHhCCCeEEEEEEEEc
Confidence            34455555544332222    57778877


No 54 
>cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=21.18  E-value=2e+02  Score=17.11  Aligned_cols=22  Identities=14%  Similarity=0.261  Sum_probs=15.3

Q ss_pred             CCceEEeeeC-cEEEEEeCCCCC
Q psy2440           2 KIMRQVETVG-QVYMAVSGAPEE   23 (60)
Q Consensus         2 ~~v~KvktiG-D~ym~~~Glp~~   23 (60)
                      +++.||..|. ..+|+.+|+...
T Consensus        55 ~~~~KI~~I~~~i~~~~sG~~~D   77 (213)
T cd03753          55 SSVEKIMEIDDHIGCAMSGLIAD   77 (213)
T ss_pred             CccceEEEEcCCEEEEEecCHHH
Confidence            3567887777 567888898633


No 55 
>cd01831 Endoglucanase_E_like Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
Probab=21.06  E-value=45  Score=18.75  Aligned_cols=15  Identities=20%  Similarity=0.363  Sum_probs=11.9

Q ss_pred             EEeeeCcEEEEEeCC
Q psy2440           6 QVETVGQVYMAVSGA   20 (60)
Q Consensus         6 KvktiGD~ym~~~Gl   20 (60)
                      ||..|||.+.+=.|.
T Consensus         1 ~i~~iGDSit~G~~~   15 (169)
T cd01831           1 KIEFIGDSITCGYGV   15 (169)
T ss_pred             CEEEEeccccccCcc
Confidence            688999999775555


No 56 
>PF04771 CAV_VP3:  Chicken anaemia virus VP-3 protein;  InterPro: IPR006858 Chicken anaemia virus (CAV) is a circovirus which can cause severe depletion of some cell types, such as lymphocytes, by the induction of apoptosis []. Studies indicate that expression of the viral VP3 protein, also known as apoptin, is sufficient to induce apoptosis in susceptible cells and to produce the doughnut-shaped apoptosis body formations observed in cells during CAV infections. This protein induces apoptosis in tumor cells and transformed cells, but is incapable of inducing apoptosis in normal cells unless tranforming signals are supplied which induce its phosphorylation. Cell death occurs in a p53- and Bcl-2-independent manner []. Apoptin contains putative nuclear localisation and nuclear export domains, and has a positively charged C terminus which is thought to allow direct interaction with nucleic acids. Localisation to the nucleus appears to be necessary for apoptosis, but is not sufficient on its own. The biologically active form of the protein appears to be large complexes of 30-40 molecules which form distinct superstructures upon DNA binding. A number of cellular factors including Nmi, and several death domain superfamily proteins, have been shown to interact apoptin. It has been suggested that in the nucleus, it this binding of phosphorylated apoptin to DNA and other factors which starts the apoptotic machinery, triggering cell death.; GO: 0019051 induction by virus of host apoptosis, 0042025 host cell nucleus
Probab=21.06  E-value=59  Score=18.21  Aligned_cols=10  Identities=30%  Similarity=0.498  Sum_probs=7.5

Q ss_pred             CceEEEEecC
Q psy2440          51 NNIQIRIDEG   60 (60)
Q Consensus        51 ~~~~iRIGi~   60 (60)
                      .-.+|+||||
T Consensus        29 ~~~EIqIGig   38 (121)
T PF04771_consen   29 HSREIQIGIG   38 (121)
T ss_pred             ceeEEEEeee
Confidence            4568899886


No 57 
>cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=20.94  E-value=2e+02  Score=17.21  Aligned_cols=21  Identities=19%  Similarity=0.246  Sum_probs=15.9

Q ss_pred             CCceEEeeeCc-EEEEEeCCCC
Q psy2440           2 KIMRQVETVGQ-VYMAVSGAPE   22 (60)
Q Consensus         2 ~~v~KvktiGD-~ym~~~Glp~   22 (60)
                      +.+.||..|+| .+++.+|+..
T Consensus        58 ~~~~KI~~I~~~i~~~~sG~~~   79 (212)
T cd03751          58 GSNKRIFNVDRHIGIAVAGLLA   79 (212)
T ss_pred             chhcceeEecCcEEEEEEEChH
Confidence            35678888886 6788889863


No 58 
>smart00596 PRE_C2HC PRE_C2HC domain.
Probab=20.87  E-value=41  Score=17.31  Aligned_cols=14  Identities=21%  Similarity=0.335  Sum_probs=9.7

Q ss_pred             CCceEEeeeCcEEE
Q psy2440           2 KIMRQVETVGQVYM   15 (60)
Q Consensus         2 ~~v~KvktiGD~ym   15 (60)
                      +++++++++|-.=+
T Consensus        44 ~~Il~ik~Lg~~~V   57 (69)
T smart00596       44 KEILNIKTLGGQRV   57 (69)
T ss_pred             cceEeehhhCCeeE
Confidence            45788888875543


No 59 
>PRK12419 riboflavin synthase subunit beta; Provisional
Probab=20.75  E-value=1.6e+02  Score=17.38  Aligned_cols=20  Identities=5%  Similarity=0.137  Sum_probs=16.5

Q ss_pred             hHHHHHHHHHHHHHHHHHhh
Q psy2440          27 HACNISDLSLSFIETVENMK   46 (60)
Q Consensus        27 ha~~~~~~al~m~~~~~~~~   46 (60)
                      +-..++..|++|....+++.
T Consensus       136 KG~eaA~aalem~~l~~~l~  155 (158)
T PRK12419        136 KGAEAAHACADTLLSRERLR  155 (158)
T ss_pred             cHHHHHHHHHHHHHHHHHhc
Confidence            45778999999999888775


No 60 
>PF10379 nec1:  Virulence protein nec1;  InterPro: IPR018836  The Nec1 protein has necrogenic activity on excised potato tuber tissue, and the encoding gene is highly conserved in plant-pathogenic Streptomyces spp. The G+C content of nec1 indicates lateral transfer from an unrelated taxon, but its origins are unclear. Deletion analysis of nec1 demonstrated that the 151-amino-acid C-terminal region of the Nec1 protein is sufficient to confer necrogenic activity. Streptomyces turgidiscabies containing a nec1 deletion was greatly compromised in virulence on Arabidopsis thaliana (Mouse-ear cress), Nicotiana tabacum (Common tobacco), and Raphanus sativus (Radish) seedlings. The wild-type strain, S. turgidiscabies Car8, aggressively colonized and infected the root meristem of radish, whereas the delta-nec1 mutant Car811 did not. Taken together, the data suggest that Nec1 is a secreted virulence protein with a conserved plant cell target that acts early in plant infection []. 
Probab=20.24  E-value=69  Score=18.82  Aligned_cols=21  Identities=29%  Similarity=0.602  Sum_probs=13.9

Q ss_pred             eEEeeeCcEEEEEeCC-CCCCch
Q psy2440           5 RQVETVGQVYMAVSGA-PEETPH   26 (60)
Q Consensus         5 ~KvktiGD~ym~~~Gl-p~~~~~   26 (60)
                      .||+|+||. |-.+|. |..+..
T Consensus         3 lkirtlgdl-mrtsgvtpktqsS   24 (184)
T PF10379_consen    3 LKIRTLGDL-MRTSGVTPKTQSS   24 (184)
T ss_pred             ceeeehhhH-HhhcCCCcccccc
Confidence            489999996 555666 544443


No 61 
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed
Probab=20.13  E-value=1.3e+02  Score=20.21  Aligned_cols=10  Identities=40%  Similarity=0.471  Sum_probs=8.0

Q ss_pred             CceEEEEecC
Q psy2440          51 NNIQIRIDEG   60 (60)
Q Consensus        51 ~~~~iRIGi~   60 (60)
                      ..+.||||+|
T Consensus       129 ~~ipIRIGvN  138 (360)
T PRK00366        129 YGIPIRIGVN  138 (360)
T ss_pred             CCCCEEEecC
Confidence            5678899986


Done!