BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy2445
         (654 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3I7A|A Chain A, Crystal Structure Of Putative Metal-Dependent
           Phosphohydrolase (Yp_926882.1) From Shewanella
           Amazonensis Sb2b At 2.06 A Resolution
          Length = 281

 Score = 33.1 bits (74), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 29/70 (41%), Gaps = 1/70 (1%)

Query: 404 TSFMYVIAMLSLLKIYQSRHPDINATAYSTFVALAFVIFVGMVGVLDETLTFYVIFTVIH 463
           TS     A  SLL+IY  +HP  +   Y T      V  +G + VL E       FT I 
Sbjct: 121 TSIDVTAAACSLLQIYNKKHPG-SGLNYDTLTLAGLVHNIGALPVLTEAEAHPEXFTTIE 179

Query: 464 VLVCMVLSAQ 473
            L  +V   Q
Sbjct: 180 HLRSLVRKXQ 189


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.331    0.143    0.464 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 18,576,945
Number of Sequences: 62578
Number of extensions: 724367
Number of successful extensions: 1379
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1379
Number of HSP's gapped (non-prelim): 2
length of query: 654
length of database: 14,973,337
effective HSP length: 105
effective length of query: 549
effective length of database: 8,402,647
effective search space: 4613053203
effective search space used: 4613053203
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 55 (25.8 bits)