Diaphorina citri psyllid: psy2469

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MPKVISRSIVCSDTKDKEEYGEEKPLHIYYCVCGQMTLILDCAVEKLPLRRRDGARVIDGPKHAHKLTCEPDEVFHLKRPEGIERQHRFKCKKCGLFLYYKHDPSSNIIFIVQGAVVKSSGEMPKMDIYNQVAVAKPKKIMVTKHTKNMGKFSSVTVSTIDEEEDEIEAREIADSYANNARIIEKQLERKGMNKRKSDSTTLNTGETEVKKPVRGTLIDK
ccccEEEEEEEccccccccccccccCEEEEEEcccEEEEEcccccccccccccccEEEcccccEEEEEcccccEEEEEccccHHccccccccccccEEEEECcccccEEEEEccEEEEcccccccccccHHHHcccccEEEEEEEECcccccCEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccc
*****SR*IVCS********GEEKPLHIYYCVCGQMTLILDCAVEKLPLRRRDGARVIDGPKHAHKLTCEPDEVFHLKRPEGIERQHRFKCKKCGLFLYYKHDPSSNIIFIVQGAVVKSSGEMPKMDIYNQVAVAKPKKIMVTKH********SVTVSTIDEEEDEIEA**IADSYANNARI*******************************RGTLI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKVISRSIVCSDTKDKEEYGEEKPLHIYYCVCGQMTLILDCAVEKLPLRRRDGARVIDGPKHAHKLTCEPDEVFHLKRPEGIERQHRFKCKKCGLFLYYKHDPSSNIIFIVQGAVVKSSGEMPKMDIYNQVAVAKPKKIMVTKHTKNMGKFSSVTVSTIDEEEDEIEAREIADSYANNARIIEKQLERKGMNKRKSDSTTLNTGETEVKKPVRGTLIDK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UPF0428 protein CXorf56 homolog very confidentQ3T197
UPF0428 protein CXorf56 very confidentQ9H5V9
UPF0428 protein CXorf56 homolog very confidentQ66I61

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1X6M, chain A
Confidence level:probable
Coverage over the Query: 87-132
View the alignment between query and template
View the model in PyMOL