Diaphorina citri psyllid: psy247


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410---
MTEKIPYIFRQNTDFFYFTGCLEPDSAVVIHGASDENFKSELFVKRKDAKAELWDGPRTGKAQLNGYVPRRKDYSWNVPKQLFHQLRLYKSDSEQEMMRETCRIASEGFKETIGFSKPGRTEHELFTKFDYEVRMRGAQILAYPPVVASGDNANVIHYVHNNQKCCHGDLLLMDAGFSKPGRTEHELFTKFDYEVRMRGAQILAYPPVVASGDNANVIHYVHNNQKCCHGDLLLMDAGCELNGYDSDITRTWPISGQFTDHQKVLYEIVLDTQLKLLKLCEKSDSALNFIYRYAYVFQIGFKFCPHHSSHYLGMDVHDCAAIPRTIPVAPGVVFTVEPGMDVHDCAAIPRTIPVAPGMVFTVEPGVYISKDCKETRPEFRGMGIRIEDDILIDKSSNVENLSAMCPKNIDEIE
cccccccccccccccEEccccccccCEEEEEccccccEEEEEEEccccccccccccccccHHHHHHHccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccEEccccccccccEEccccccccccEEEEEcccccccccccccEEccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccCEEECccccccccccccccccccccccEEEccccEEEccccccccccccccEEEEcccEEEccccccccccccccccccccc
MTEKIPYIFRQNTDFFYFTGCLEPDSAVVIHGASDENFKSELFVKRKDAKAELWDGPRTGKAQLNGYVPRRKDYSWNVPKQLFHQLRLYKSDSEQEMMRETCRIASEGFKETIGFSKPGRTEHELFTKFDYEVRMRGAQILAYPPVVASGDNANVIHYVHNNQKCCHGDLLLMDAGFSKPGRTEHELFTKFDYEVRMRGAQILAYPPVVASGDNANVIHYVHNNQKCCHGDLLLMDAGCELNGYDSDITRTWPISGQFTDHQKVLYEIVLDTQLKLLKLCEKSDSALNFIYRYAYVFQIGFKFCPHHSSHYLGMDVHDCAAIPRTIPVAPGVVFTVEPGMDVHDCAAIPRTIPVAPGMVFTVEPGVYISKDCKETRPEFRGMGIRIEDDILIDKSSNVENLSAMCPKNIDEIE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTEKIPYIFRQNTDFFYFTGCLEPDSAVVIHGASDENFKSELFVKRKDAKAELWDGPRTGKAQLNGYVPRRKDYSWNVPKQLFHQLRLYKSDSEQEMMRETCRIASEGFKETIGFSKPGRTEHELFTKFDYEVRMRGAQILAYPPVVASGDNANVIHYVHNNQKCCHGDLLLMDAGFSKPGRTEHELFTKFDYEVRMRGAQILAYPPVVASGDNANVIHYVHNNQKCCHGDLLLMDAGCELNGYDSDITRTWPISGQFTDHQKVLYEIVLDTQLKLLKLCEKSDSALNFIYRYAYVFQIGFKFCPHHSSHYLGMDVHDCAAIPRTIPVAPGVVFTVEPGMDVHDCAAIPRTIPVAPGMVFTVEPGVYISKDCKETRPEFRGMGIRIEDDILIDKSSNVENLSAMCPKNIDEIE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable Xaa-Pro aminopeptidase 3 confidentB5DEQ3
Probable Xaa-Pro aminopeptidase 3 confidentB7ZMP1
Probable Xaa-Pro aminopeptidase 3 confidentQ54T46

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WN1, chain A
Confidence level:very confident
Coverage over the Query: 4-142,205-323,348-371,382-412
View the alignment between query and template
View the model in PyMOL
Template: 2IW2, chain A
Confidence level:very confident
Coverage over the Query: 2-152,215-413
View the alignment between query and template
View the model in PyMOL
Template: 3Q6D, chain A
Confidence level:very confident
Coverage over the Query: 178-200
View the alignment between query and template
View the model in PyMOL
Template: 1CHM, chain A
Confidence level:confident
Coverage over the Query: 141-192
View the alignment between query and template
View the model in PyMOL