BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy2480
         (337 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1QU2|A Chain A, Insights Into Editing From An Ile-Trna Synthetase
           Structure With Trna(Ile) And Mupirocin
 pdb|1QU3|A Chain A, Insights Into Editing From An Ile-Trna Synthetase
           Structure With Trna(Ile) And Mupirocin
 pdb|1FFY|A Chain A, Insights Into Editing From An Ile-Trna Synthetase
           Structure With Trna(Ile) And Mupirocin
          Length = 917

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 147 LNSWLGFTNIGDDLSTPLSMQTNEKAI--ALPVWTTLKSMGQTGIQDILT 194
           L+ W  F N+ DD++  L    NEK I  +L    T+ S  +    + LT
Sbjct: 795 LDKWRTFMNLRDDVNRALETARNEKVIGKSLEAKVTIASNDKFNASEFLT 844


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.136    0.418 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,916,448
Number of Sequences: 62578
Number of extensions: 401183
Number of successful extensions: 946
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 945
Number of HSP's gapped (non-prelim): 2
length of query: 337
length of database: 14,973,337
effective HSP length: 99
effective length of query: 238
effective length of database: 8,778,115
effective search space: 2089191370
effective search space used: 2089191370
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)