Psyllid ID: psy2485
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 85 | ||||||
| 195396833 | 718 | GJ16859 [Drosophila virilis] gi|19414680 | 0.882 | 0.104 | 0.620 | 5e-23 | |
| 221112854 | 306 | PREDICTED: serine/threonine-protein kina | 0.870 | 0.241 | 0.607 | 1e-22 | |
| 198470054 | 738 | GA14417 [Drosophila pseudoobscura pseudo | 0.882 | 0.101 | 0.607 | 1e-22 | |
| 195163830 | 738 | GL14583 [Drosophila persimilis] gi|19410 | 0.882 | 0.101 | 0.607 | 1e-22 | |
| 195448497 | 708 | GK10114 [Drosophila willistoni] gi|19416 | 0.917 | 0.110 | 0.585 | 2e-22 | |
| 41054958 | 440 | serine/threonine-protein kinase Nek2 [Da | 0.941 | 0.181 | 0.611 | 3e-22 | |
| 291222225 | 430 | PREDICTED: NIMA-related kinase 2-like [S | 0.882 | 0.174 | 0.632 | 3e-22 | |
| 195134712 | 717 | GI11217 [Drosophila mojavensis] gi|19390 | 0.882 | 0.104 | 0.607 | 4e-22 | |
| 195045255 | 726 | GH24478 [Drosophila grimshawi] gi|193892 | 0.894 | 0.104 | 0.6 | 4e-22 | |
| 432945154 | 442 | PREDICTED: serine/threonine-protein kina | 0.882 | 0.169 | 0.625 | 5e-22 |
| >gi|195396833|ref|XP_002057033.1| GJ16859 [Drosophila virilis] gi|194146800|gb|EDW62519.1| GJ16859 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
Score = 111 bits (278), Expect = 5e-23, Method: Compositional matrix adjust.
Identities = 49/79 (62%), Positives = 62/79 (78%), Gaps = 4/79 (5%)
Query: 11 QYLDERFIWKVLYQLSKALQVCH----SSCILHRDIKPANVFLDENNNVKLGDFGLARIL 66
Q +E +IW+VL+QL +ALQVCH S ILHRDIKPAN+FLD + NVKLGDFGLAR+L
Sbjct: 131 QRFEEPYIWRVLFQLCRALQVCHNKIPSGTILHRDIKPANIFLDASGNVKLGDFGLARVL 190
Query: 67 NMNESHSYTLVGTPYYMSP 85
++S + + VGTP+YMSP
Sbjct: 191 RRDQSFAASFVGTPHYMSP 209
|
Source: Drosophila virilis Species: Drosophila virilis Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|221112854|ref|XP_002158299.1| PREDICTED: serine/threonine-protein kinase Nek2-like, partial [Hydra magnipapillata] | Back alignment and taxonomy information |
|---|
| >gi|198470054|ref|XP_001355206.2| GA14417 [Drosophila pseudoobscura pseudoobscura] gi|198147159|gb|EAL32263.2| GA14417 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195163830|ref|XP_002022752.1| GL14583 [Drosophila persimilis] gi|194104775|gb|EDW26818.1| GL14583 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|195448497|ref|XP_002071684.1| GK10114 [Drosophila willistoni] gi|194167769|gb|EDW82670.1| GK10114 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|41054958|ref|NP_957344.1| serine/threonine-protein kinase Nek2 [Danio rerio] gi|28856171|gb|AAH48055.1| NIMA (never in mitosis gene a)-related kinase 2 [Danio rerio] gi|182891444|gb|AAI64531.1| Nek2 protein [Danio rerio] | Back alignment and taxonomy information |
|---|
| >gi|291222225|ref|XP_002731116.1| PREDICTED: NIMA-related kinase 2-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|195134712|ref|XP_002011781.1| GI11217 [Drosophila mojavensis] gi|193906904|gb|EDW05771.1| GI11217 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|195045255|ref|XP_001991941.1| GH24478 [Drosophila grimshawi] gi|193892782|gb|EDV91648.1| GH24478 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|432945154|ref|XP_004083490.1| PREDICTED: serine/threonine-protein kinase Nek2-like isoform 2 [Oryzias latipes] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 85 | ||||||
| ZFIN|ZDB-GENE-040426-752 | 440 | nek2 "NIMA (never in mitosis g | 0.941 | 0.181 | 0.611 | 1.2e-21 | |
| UNIPROTKB|Q2KIQ0 | 383 | NEK2 "Uncharacterized protein" | 0.882 | 0.195 | 0.625 | 5.3e-21 | |
| UNIPROTKB|B4DZU0 | 402 | NEK2 "Serine/threonine-protein | 0.882 | 0.186 | 0.625 | 7.5e-21 | |
| UNIPROTKB|F1S2U5 | 445 | NEK2 "Uncharacterized protein" | 0.964 | 0.184 | 0.586 | 7.6e-21 | |
| MGI|MGI:109359 | 443 | Nek2 "NIMA (never in mitosis g | 0.964 | 0.185 | 0.574 | 9.6e-21 | |
| UNIPROTKB|P51955 | 445 | NEK2 "Serine/threonine-protein | 0.882 | 0.168 | 0.625 | 1.3e-20 | |
| RGD|1582899 | 443 | Nek2l1 "NIMA (never in mitosis | 0.882 | 0.169 | 0.612 | 1.6e-20 | |
| UNIPROTKB|G3V6L2 | 443 | Nek2 "RCG20225" [Rattus norveg | 0.882 | 0.169 | 0.612 | 1.6e-20 | |
| DICTYBASE|DDB_G0270814 | 418 | nek2 "NEK family protein kinas | 0.858 | 0.174 | 0.610 | 3.5e-20 | |
| UNIPROTKB|E2RSC1 | 444 | NEK2 "Uncharacterized protein" | 0.882 | 0.168 | 0.612 | 3.5e-20 |
| ZFIN|ZDB-GENE-040426-752 nek2 "NIMA (never in mitosis gene a)-related kinase 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 257 (95.5 bits), Expect = 1.2e-21, P = 1.2e-21
Identities = 52/85 (61%), Positives = 64/85 (75%)
Query: 6 SAETEQYLDERFIWKVLYQLSKALQVCH-----SSCILHRDIKPANVFLDENNNVKLGDF 60
S + ++YL+E FI +V+ QLS AL+ CH SS +LHRD+KPAN+FLD NVKLGDF
Sbjct: 101 SIKDKRYLEEEFILRVMAQLSLALKECHGRSNGSSTVLHRDLKPANIFLDAKQNVKLGDF 160
Query: 61 GLARILNMNESHSYTLVGTPYYMSP 85
GLARILN + S + T VGTPYYMSP
Sbjct: 161 GLARILNHDTSFAKTFVGTPYYMSP 185
|
|
| UNIPROTKB|Q2KIQ0 NEK2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4DZU0 NEK2 "Serine/threonine-protein kinase Nek2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S2U5 NEK2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:109359 Nek2 "NIMA (never in mitosis gene a)-related expressed kinase 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P51955 NEK2 "Serine/threonine-protein kinase Nek2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1582899 Nek2l1 "NIMA (never in mitosis gene a)-related kinase 2-like 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V6L2 Nek2 "RCG20225" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0270814 nek2 "NEK family protein kinase Nek2" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RSC1 NEK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 85 | |||
| cd08217 | 265 | cd08217, STKc_Nek2, Catalytic domain of the Protei | 2e-39 | |
| cd08215 | 258 | cd08215, STKc_Nek, Catalytic domain of the Protein | 7e-34 | |
| smart00220 | 254 | smart00220, S_TKc, Serine/Threonine protein kinase | 1e-31 | |
| cd08224 | 267 | cd08224, STKc_Nek6_Nek7, Catalytic domain of the P | 2e-27 | |
| cd00180 | 215 | cd00180, PKc, Catalytic domain of Protein Kinases | 6e-27 | |
| pfam00069 | 260 | pfam00069, Pkinase, Protein kinase domain | 7e-27 | |
| cd08221 | 256 | cd08221, STKc_Nek9, Catalytic domain of the Protei | 2e-25 | |
| cd08529 | 256 | cd08529, STKc_FA2-like, Catalytic domain of the Pr | 4e-25 | |
| cd06606 | 260 | cd06606, STKc_MAPKKK, Catalytic domain of the Prot | 2e-22 | |
| cd08228 | 267 | cd08228, STKc_Nek6, Catalytic domain of the Protei | 3e-22 | |
| cd08229 | 267 | cd08229, STKc_Nek7, Catalytic domain of the Protei | 1e-21 | |
| cd07829 | 282 | cd07829, STKc_CDK_like, Catalytic domain of Cyclin | 3e-21 | |
| cd08530 | 256 | cd08530, STKc_CNK2-like, Catalytic domain of the P | 3e-21 | |
| cd06612 | 256 | cd06612, STKc_MST1_2, Catalytic domain of the Prot | 7e-21 | |
| cd06626 | 264 | cd06626, STKc_MEKK4, Catalytic domain of the Prote | 2e-20 | |
| cd07834 | 330 | cd07834, STKc_MAPK, Catalytic domain of the Serine | 7e-20 | |
| cd06609 | 274 | cd06609, STKc_MST3_like, Catalytic domain of Mamma | 1e-19 | |
| cd07832 | 286 | cd07832, STKc_CCRK, Catalytic domain of the Serine | 1e-19 | |
| cd06917 | 277 | cd06917, STKc_NAK1_like, Catalytic domain of Funga | 6e-19 | |
| cd05122 | 253 | cd05122, PKc_STE, Catalytic domain of STE family P | 6e-19 | |
| cd08223 | 257 | cd08223, STKc_Nek4, Catalytic domain of the Protei | 1e-18 | |
| cd07847 | 286 | cd07847, STKc_CDKL1_4, Catalytic domain of the Ser | 3e-18 | |
| cd07835 | 283 | cd07835, STKc_CDK1_like, Catalytic domain of Cycli | 3e-18 | |
| cd07840 | 287 | cd07840, STKc_CDK9_like, Catalytic domain of Cycli | 4e-18 | |
| cd08218 | 256 | cd08218, STKc_Nek1, Catalytic domain of the Protei | 5e-18 | |
| cd06614 | 286 | cd06614, STKc_PAK, Catalytic domain of the Protein | 8e-18 | |
| cd08225 | 257 | cd08225, STKc_Nek5, Catalytic domain of the Protei | 8e-18 | |
| cd06627 | 254 | cd06627, STKc_Cdc7_like, Catalytic domain of Cell | 9e-18 | |
| cd06625 | 263 | cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ | 2e-17 | |
| cd06611 | 280 | cd06611, STKc_SLK_like, Catalytic domain of Ste20- | 2e-17 | |
| cd07852 | 337 | cd07852, STKc_MAPK15, Catalytic domain of the Seri | 2e-17 | |
| cd07833 | 288 | cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep | 3e-17 | |
| cd08220 | 256 | cd08220, STKc_Nek8, Catalytic domain of the Protei | 4e-17 | |
| cd08219 | 255 | cd08219, STKc_Nek3, Catalytic domain of the Protei | 7e-17 | |
| cd06610 | 267 | cd06610, STKc_OSR1_SPAK, Catalytic domain of the P | 8e-17 | |
| cd07841 | 298 | cd07841, STKc_CDK7, Catalytic domain of the Serine | 4e-16 | |
| PLN00034 | 353 | PLN00034, PLN00034, mitogen-activated protein kina | 5e-16 | |
| cd06623 | 264 | cd06623, PKc_MAPKK_plant_like, Catalytic domain of | 5e-16 | |
| cd05579 | 265 | cd05579, STKc_MAST_like, Catalytic domain of Micro | 5e-16 | |
| COG0515 | 384 | COG0515, SPS1, Serine/threonine protein kinase [Ge | 5e-16 | |
| cd07856 | 328 | cd07856, STKc_Sty1_Hog1, Catalytic domain of the S | 6e-16 | |
| cd07846 | 286 | cd07846, STKc_CDKL2_3, Catalytic domain of the Ser | 7e-16 | |
| cd05123 | 250 | cd05123, STKc_AGC, Catalytic domain of AGC family | 7e-16 | |
| cd06642 | 277 | cd06642, STKc_STK25-YSK1, Catalytic domain of the | 1e-15 | |
| cd06608 | 275 | cd06608, STKc_myosinIII_like, Catalytic domain of | 2e-15 | |
| cd05118 | 283 | cd05118, STKc_CMGC, Catalytic domain of CMGC famil | 2e-15 | |
| cd05572 | 262 | cd05572, STKc_cGK_PKG, Catalytic domain of the Pro | 2e-15 | |
| cd06647 | 293 | cd06647, STKc_PAK_I, Catalytic domain of the Prote | 5e-15 | |
| cd05611 | 260 | cd05611, STKc_Rim15_like, Catalytic domain of fung | 7e-15 | |
| cd07854 | 342 | cd07854, STKc_MAPK4_6, Catalytic domain of the Ser | 8e-15 | |
| cd07855 | 334 | cd07855, STKc_ERK5, Catalytic domain of the Serine | 2e-14 | |
| cd07861 | 285 | cd07861, STKc_CDK1_euk, Catalytic domain of the Se | 2e-14 | |
| cd07849 | 336 | cd07849, STKc_ERK1_2_like, Catalytic domain of Ext | 2e-14 | |
| cd06613 | 262 | cd06613, STKc_MAP4K3_like, Catalytic domain of Mit | 2e-14 | |
| cd07858 | 337 | cd07858, STKc_TEY_MAPK_plant, Catalytic domain of | 2e-14 | |
| cd06640 | 277 | cd06640, STKc_MST4, Catalytic domain of the Protei | 3e-14 | |
| cd08222 | 260 | cd08222, STKc_Nek11, Catalytic domain of the Prote | 3e-14 | |
| cd05580 | 290 | cd05580, STKc_PKA, Catalytic domain of the Protein | 3e-14 | |
| cd05578 | 258 | cd05578, STKc_Yank1, Catalytic domain of the Prote | 3e-14 | |
| cd06621 | 287 | cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of | 5e-14 | |
| cd06641 | 277 | cd06641, STKc_MST3, Catalytic domain of the Protei | 5e-14 | |
| cd06632 | 258 | cd06632, STKc_MEKK1_plant, Catalytic domain of the | 6e-14 | |
| cd06655 | 296 | cd06655, STKc_PAK2, Catalytic domain of the Protei | 7e-14 | |
| cd06656 | 297 | cd06656, STKc_PAK3, Catalytic domain of the Protei | 7e-14 | |
| cd05581 | 280 | cd05581, STKc_PDK1, Catalytic domain of the Protei | 8e-14 | |
| cd06607 | 307 | cd06607, STKc_TAO, Catalytic domain of the Protein | 1e-13 | |
| cd06651 | 266 | cd06651, STKc_MEKK3, Catalytic domain of the Prote | 1e-13 | |
| cd07853 | 372 | cd07853, STKc_NLK, Catalytic domain of the Serine/ | 2e-13 | |
| cd07839 | 284 | cd07839, STKc_CDK5, Catalytic domain of the Serine | 2e-13 | |
| cd06648 | 285 | cd06648, STKc_PAK_II, Catalytic domain of the Prot | 2e-13 | |
| cd06654 | 296 | cd06654, STKc_PAK1, Catalytic domain of the Protei | 3e-13 | |
| cd07848 | 287 | cd07848, STKc_CDKL5, Catalytic domain of the Serin | 3e-13 | |
| cd06653 | 264 | cd06653, STKc_MEKK3_like_1, Catalytic domain of MA | 3e-13 | |
| cd06652 | 265 | cd06652, STKc_MEKK2, Catalytic domain of the Prote | 5e-13 | |
| cd05582 | 318 | cd05582, STKc_RSK_N, N-terminal catalytic domain o | 8e-13 | |
| cd07851 | 343 | cd07851, STKc_p38, Catalytic domain of the Serine/ | 8e-13 | |
| cd06605 | 265 | cd06605, PKc_MAPKK, Catalytic domain of the dual-s | 8e-13 | |
| cd06657 | 292 | cd06657, STKc_PAK4, Catalytic domain of the Protei | 1e-12 | |
| PLN00009 | 294 | PLN00009, PLN00009, cyclin-dependent kinase A; Pro | 1e-12 | |
| cd06637 | 272 | cd06637, STKc_TNIK, Catalytic domain of the Protei | 2e-12 | |
| cd07860 | 284 | cd07860, STKc_CDK2_3, Catalytic domain of the Seri | 2e-12 | |
| cd07864 | 302 | cd07864, STKc_CDK12, Catalytic domain of the Serin | 3e-12 | |
| cd06636 | 282 | cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr | 3e-12 | |
| cd06639 | 291 | cd06639, STKc_myosinIIIB, Catalytic domain of the | 3e-12 | |
| cd05596 | 370 | cd05596, STKc_ROCK, Catalytic domain of the Protei | 4e-12 | |
| PTZ00267 | 478 | PTZ00267, PTZ00267, NIMA-related protein kinase; P | 4e-12 | |
| cd06646 | 267 | cd06646, STKc_MAP4K5, Catalytic domain of the Prot | 6e-12 | |
| cd07838 | 287 | cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc | 6e-12 | |
| cd07831 | 282 | cd07831, STKc_MOK, Catalytic domain of the Serine/ | 6e-12 | |
| cd07842 | 316 | cd07842, STKc_CDK8_like, Catalytic domain of Cycli | 7e-12 | |
| cd07844 | 291 | cd07844, STKc_PCTAIRE_like, Catalytic domain of PC | 8e-12 | |
| cd05601 | 330 | cd05601, STKc_CRIK, Catalytic domain of the Protei | 8e-12 | |
| PTZ00263 | 329 | PTZ00263, PTZ00263, protein kinase A catalytic sub | 1e-11 | |
| cd07836 | 284 | cd07836, STKc_Pho85, Catalytic domain of the Serin | 1e-11 | |
| cd05612 | 291 | cd05612, STKc_PRKX_like, Catalytic domain of PRKX- | 1e-11 | |
| cd06618 | 296 | cd06618, PKc_MKK7, Catalytic domain of the dual-sp | 1e-11 | |
| cd07863 | 288 | cd07863, STKc_CDK4, Catalytic domain of the Serine | 2e-11 | |
| cd07866 | 311 | cd07866, STKc_BUR1, Catalytic domain of the Serine | 2e-11 | |
| PTZ00283 | 496 | PTZ00283, PTZ00283, serine/threonine protein kinas | 2e-11 | |
| cd06644 | 292 | cd06644, STKc_STK10_LOK, Catalytic domain of the P | 2e-11 | |
| cd06631 | 265 | cd06631, STKc_YSK4, Catalytic domain of the Protei | 3e-11 | |
| cd06633 | 313 | cd06633, STKc_TAO3, Catalytic domain of the Protei | 3e-11 | |
| cd07865 | 310 | cd07865, STKc_CDK9, Catalytic domain of the Serine | 3e-11 | |
| cd06645 | 267 | cd06645, STKc_MAP4K3, Catalytic domain of the Prot | 5e-11 | |
| PTZ00266 | 1021 | PTZ00266, PTZ00266, NIMA-related protein kinase; P | 5e-11 | |
| cd07873 | 301 | cd07873, STKc_PCTAIRE1, Catalytic domain of the Se | 6e-11 | |
| cd07862 | 290 | cd07862, STKc_CDK6, Catalytic domain of the Serine | 6e-11 | |
| cd06659 | 297 | cd06659, STKc_PAK6, Catalytic domain of the Protei | 7e-11 | |
| cd06628 | 267 | cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o | 7e-11 | |
| PTZ00024 | 335 | PTZ00024, PTZ00024, cyclin-dependent protein kinas | 8e-11 | |
| cd06658 | 292 | cd06658, STKc_PAK5, Catalytic domain of the Protei | 9e-11 | |
| cd06643 | 282 | cd06643, STKc_SLK, Catalytic domain of the Protein | 9e-11 | |
| cd08528 | 269 | cd08528, STKc_Nek10, Catalytic domain of the Prote | 9e-11 | |
| cd05608 | 280 | cd05608, STKc_GRK1, Catalytic domain of the Protei | 1e-10 | |
| cd07872 | 309 | cd07872, STKc_PCTAIRE2, Catalytic domain of the Se | 1e-10 | |
| cd06634 | 308 | cd06634, STKc_TAO2, Catalytic domain of the Protei | 1e-10 | |
| cd07871 | 288 | cd07871, STKc_PCTAIRE3, Catalytic domain of the Se | 1e-10 | |
| cd05592 | 316 | cd05592, STKc_nPKC_theta_delta, Catalytic domain o | 1e-10 | |
| cd05584 | 323 | cd05584, STKc_p70S6K, Catalytic domain of the Prot | 1e-10 | |
| cd05600 | 333 | cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun | 1e-10 | |
| cd07830 | 283 | cd07830, STKc_MAK_like, Catalytic domain of Male g | 1e-10 | |
| cd05621 | 370 | cd05621, STKc_ROCK2, Catalytic domain of the Prote | 2e-10 | |
| cd05583 | 288 | cd05583, STKc_MSK_N, N-terminal catalytic domain o | 2e-10 | |
| cd07859 | 338 | cd07859, STKc_TDY_MAPK_plant, Catalytic domain of | 2e-10 | |
| cd07878 | 343 | cd07878, STKc_p38beta_MAPK11, Catalytic domain of | 2e-10 | |
| cd06635 | 317 | cd06635, STKc_TAO1, Catalytic domain of the Protei | 3e-10 | |
| cd05585 | 312 | cd05585, STKc_YPK1_like, Catalytic domain of Yeast | 3e-10 | |
| cd07880 | 343 | cd07880, STKc_p38gamma_MAPK12, Catalytic domain of | 3e-10 | |
| cd07845 | 309 | cd07845, STKc_CDK10, Catalytic domain of the Serin | 4e-10 | |
| cd05056 | 270 | cd05056, PTKc_FAK, Catalytic domain of the Protein | 5e-10 | |
| PTZ00426 | 340 | PTZ00426, PTZ00426, cAMP-dependent protein kinase | 5e-10 | |
| cd06616 | 288 | cd06616, PKc_MKK4, Catalytic domain of the dual-sp | 6e-10 | |
| cd07837 | 295 | cd07837, STKc_CdkB_plant, Catalytic domain of the | 6e-10 | |
| cd05577 | 277 | cd05577, STKc_GRK, Catalytic domain of the Protein | 6e-10 | |
| cd06638 | 286 | cd06638, STKc_myosinIIIA, Catalytic domain of the | 6e-10 | |
| cd05597 | 331 | cd05597, STKc_DMPK_like, Catalytic domain of Myoto | 7e-10 | |
| cd07857 | 332 | cd07857, STKc_MPK1, Catalytic domain of the Serine | 1e-09 | |
| cd07869 | 303 | cd07869, STKc_PFTAIRE1, Catalytic domain of the Se | 1e-09 | |
| smart00219 | 257 | smart00219, TyrKc, Tyrosine kinase, catalytic doma | 1e-09 | |
| cd05620 | 316 | cd05620, STKc_nPKC_delta, Catalytic domain of the | 2e-09 | |
| cd07877 | 345 | cd07877, STKc_p38alpha_MAPK14, Catalytic domain of | 2e-09 | |
| pfam07714 | 258 | pfam07714, Pkinase_Tyr, Protein tyrosine kinase | 2e-09 | |
| cd07879 | 342 | cd07879, STKc_p38delta_MAPK13, Catalytic domain of | 2e-09 | |
| cd05573 | 350 | cd05573, STKc_ROCK_NDR_like, Catalytic domain of R | 2e-09 | |
| cd05624 | 331 | cd05624, STKc_MRCK_beta, Catalytic domain of the P | 2e-09 | |
| PHA03207 | 392 | PHA03207, PHA03207, serine/threonine kinase US3; P | 3e-09 | |
| smart00221 | 258 | smart00221, STYKc, Protein kinase; unclassified sp | 3e-09 | |
| cd05622 | 371 | cd05622, STKc_ROCK1, Catalytic domain of the Prote | 3e-09 | |
| cd05603 | 321 | cd05603, STKc_SGK2, Catalytic domain of the Protei | 3e-09 | |
| cd05595 | 323 | cd05595, STKc_PKB_beta, Catalytic domain of the Pr | 3e-09 | |
| cd07850 | 353 | cd07850, STKc_JNK, Catalytic domain of the Serine/ | 3e-09 | |
| cd05619 | 316 | cd05619, STKc_nPKC_theta, Catalytic domain of the | 4e-09 | |
| cd07843 | 293 | cd07843, STKc_CDC2L1, Catalytic domain of the Seri | 4e-09 | |
| cd00192 | 262 | cd00192, PTKc, Catalytic domain of Protein Tyrosin | 4e-09 | |
| cd07876 | 359 | cd07876, STKc_JNK2, Catalytic domain of the Serine | 6e-09 | |
| cd05606 | 278 | cd05606, STKc_beta_ARK, Catalytic domain of the Pr | 6e-09 | |
| cd05610 | 669 | cd05610, STKc_MASTL, Catalytic domain of the Prote | 7e-09 | |
| cd06615 | 308 | cd06615, PKc_MEK, Catalytic domain of the dual-spe | 8e-09 | |
| cd05602 | 325 | cd05602, STKc_SGK1, Catalytic domain of the Protei | 9e-09 | |
| cd05575 | 323 | cd05575, STKc_SGK, Catalytic domain of the Protein | 9e-09 | |
| PHA03210 | 501 | PHA03210, PHA03210, serine/threonine kinase US3; P | 9e-09 | |
| cd06620 | 284 | cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of | 1e-08 | |
| cd07875 | 364 | cd07875, STKc_JNK1, Catalytic domain of the Serine | 1e-08 | |
| cd07874 | 355 | cd07874, STKc_JNK3, Catalytic domain of the Serine | 1e-08 | |
| cd05591 | 321 | cd05591, STKc_nPKC_epsilon, Catalytic domain of th | 1e-08 | |
| cd05570 | 318 | cd05570, STKc_PKC, Catalytic domain of the Protein | 1e-08 | |
| cd05040 | 257 | cd05040, PTKc_Ack_like, Catalytic domain of the Pr | 1e-08 | |
| cd05604 | 325 | cd05604, STKc_SGK3, Catalytic domain of the Protei | 1e-08 | |
| cd05586 | 330 | cd05586, STKc_Sck1_like, Catalytic domain of Suppr | 2e-08 | |
| cd05614 | 332 | cd05614, STKc_MSK2_N, N-terminal catalytic domain | 2e-08 | |
| cd05623 | 332 | cd05623, STKc_MRCK_alpha, Catalytic domain of the | 2e-08 | |
| cd05633 | 279 | cd05633, STKc_GRK3, Catalytic domain of the Protei | 2e-08 | |
| cd06619 | 279 | cd06619, PKc_MKK5, Catalytic domain of the dual-sp | 2e-08 | |
| cd05613 | 290 | cd05613, STKc_MSK1_N, N-terminal catalytic domain | 2e-08 | |
| cd05038 | 284 | cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai | 3e-08 | |
| cd05590 | 320 | cd05590, STKc_nPKC_eta, Catalytic domain of the Pr | 3e-08 | |
| cd05609 | 305 | cd05609, STKc_MAST, Catalytic domain of the Protei | 3e-08 | |
| cd05593 | 328 | cd05593, STKc_PKB_gamma, Catalytic domain of the P | 4e-08 | |
| PHA03209 | 357 | PHA03209, PHA03209, serine/threonine kinase US3; P | 5e-08 | |
| cd05607 | 277 | cd05607, STKc_GRK7, Catalytic domain of the Protei | 6e-08 | |
| cd06617 | 283 | cd06617, PKc_MKK3_6, Catalytic domain of the dual- | 6e-08 | |
| cd07870 | 291 | cd07870, STKc_PFTAIRE2, Catalytic domain of the Se | 8e-08 | |
| cd05587 | 324 | cd05587, STKc_cPKC, Catalytic domain of the Protei | 9e-08 | |
| cd05034 | 261 | cd05034, PTKc_Src_like, Catalytic domain of Src ki | 1e-07 | |
| cd06622 | 286 | cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of | 1e-07 | |
| cd06650 | 333 | cd06650, PKc_MEK1, Catalytic domain of the dual-sp | 1e-07 | |
| PHA03212 | 391 | PHA03212, PHA03212, serine/threonine kinase US3; P | 1e-07 | |
| PHA03390 | 267 | PHA03390, pk1, serine/threonine-protein kinase 1; | 1e-07 | |
| cd06649 | 331 | cd06649, PKc_MEK2, Catalytic domain of the dual-sp | 2e-07 | |
| cd05571 | 323 | cd05571, STKc_PKB, Catalytic domain of the Protein | 2e-07 | |
| PRK13184 | 932 | PRK13184, pknD, serine/threonine-protein kinase; R | 2e-07 | |
| cd07867 | 317 | cd07867, STKc_CDC2L6, Catalytic domain of Serine/T | 2e-07 | |
| cd05101 | 304 | cd05101, PTKc_FGFR2, Catalytic domain of the Prote | 2e-07 | |
| cd07868 | 317 | cd07868, STKc_CDK8, Catalytic domain of the Serine | 3e-07 | |
| PTZ00036 | 440 | PTZ00036, PTZ00036, glycogen synthase kinase; Prov | 3e-07 | |
| cd05599 | 364 | cd05599, STKc_NDR_like, Catalytic domain of Nuclea | 3e-07 | |
| cd05605 | 285 | cd05605, STKc_GRK4_like, Catalytic domain of G pro | 4e-07 | |
| cd05589 | 324 | cd05589, STKc_PKN, Catalytic domain of the Protein | 4e-07 | |
| cd05615 | 323 | cd05615, STKc_cPKC_alpha, Catalytic domain of the | 5e-07 | |
| cd06629 | 272 | cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o | 5e-07 | |
| PLN03225 | 566 | PLN03225, PLN03225, Serine/threonine-protein kinas | 6e-07 | |
| cd05588 | 329 | cd05588, STKc_aPKC, Catalytic domain of the Protei | 6e-07 | |
| PHA03211 | 461 | PHA03211, PHA03211, serine/threonine kinase US3; P | 7e-07 | |
| cd05617 | 327 | cd05617, STKc_aPKC_zeta, Catalytic domain of the P | 8e-07 | |
| cd05103 | 343 | cd05103, PTKc_VEGFR2, Catalytic domain of the Prot | 8e-07 | |
| cd05616 | 323 | cd05616, STKc_cPKC_beta, Catalytic domain of the P | 9e-07 | |
| TIGR03903 | 1266 | TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas | 1e-06 | |
| cd05080 | 283 | cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma | 1e-06 | |
| cd05629 | 377 | cd05629, STKc_NDR_like_fungal, Catalytic domain of | 1e-06 | |
| cd05109 | 279 | cd05109, PTKc_HER2, Catalytic domain of the Protei | 1e-06 | |
| cd05627 | 360 | cd05627, STKc_NDR2, Catalytic domain of the Protei | 1e-06 | |
| cd05102 | 338 | cd05102, PTKc_VEGFR3, Catalytic domain of the Prot | 1e-06 | |
| cd05054 | 337 | cd05054, PTKc_VEGFR, Catalytic domain of the Prote | 2e-06 | |
| cd05053 | 293 | cd05053, PTKc_FGFR, Catalytic domain of the Protei | 2e-06 | |
| cd05598 | 376 | cd05598, STKc_LATS, Catalytic domain of the Protei | 2e-06 | |
| cd05625 | 382 | cd05625, STKc_LATS1, Catalytic domain of the Prote | 2e-06 | |
| cd05068 | 261 | cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re | 2e-06 | |
| cd05618 | 329 | cd05618, STKc_aPKC_iota, Catalytic domain of the P | 3e-06 | |
| cd05626 | 381 | cd05626, STKc_LATS2, Catalytic domain of the Prote | 3e-06 | |
| cd05630 | 285 | cd05630, STKc_GRK6, Catalytic domain of the Protei | 3e-06 | |
| cd05099 | 314 | cd05099, PTKc_FGFR4, Catalytic domain of the Prote | 3e-06 | |
| cd05055 | 302 | cd05055, PTKc_PDGFR, Catalytic domain of the Prote | 4e-06 | |
| cd05059 | 256 | cd05059, PTKc_Tec_like, Catalytic domain of Tec-li | 6e-06 | |
| cd06624 | 268 | cd06624, STKc_ASK, Catalytic domain of the Protein | 7e-06 | |
| cd05594 | 325 | cd05594, STKc_PKB_alpha, Catalytic domain of the P | 7e-06 | |
| cd05100 | 334 | cd05100, PTKc_FGFR3, Catalytic domain of the Prote | 8e-06 | |
| cd05632 | 285 | cd05632, STKc_GRK5, Catalytic domain of the Protei | 8e-06 | |
| cd05098 | 307 | cd05098, PTKc_FGFR1, Catalytic domain of the Prote | 8e-06 | |
| cd05058 | 262 | cd05058, PTKc_Met_Ron, Catalytic domain of the Pro | 1e-05 | |
| cd05110 | 303 | cd05110, PTKc_HER4, Catalytic domain of the Protei | 1e-05 | |
| cd05057 | 279 | cd05057, PTKc_EGFR_like, Catalytic domain of Epide | 1e-05 | |
| cd05628 | 363 | cd05628, STKc_NDR1, Catalytic domain of the Protei | 1e-05 | |
| cd05108 | 316 | cd05108, PTKc_EGFR, Catalytic domain of the Protei | 1e-05 | |
| cd05067 | 260 | cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro | 1e-05 | |
| cd05075 | 272 | cd05075, PTKc_Axl, Catalytic domain of the Protein | 2e-05 | |
| PLN03224 | 507 | PLN03224, PLN03224, probable serine/threonine prot | 2e-05 | |
| cd05631 | 285 | cd05631, STKc_GRK4, Catalytic domain of the Protei | 2e-05 | |
| cd05148 | 261 | cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro | 2e-05 | |
| cd06630 | 268 | cd06630, STKc_MEKK1, Catalytic domain of the Prote | 3e-05 | |
| cd05069 | 260 | cd05069, PTKc_Yes, Catalytic domain of the Protein | 3e-05 | |
| cd05079 | 284 | cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma | 4e-05 | |
| cd05052 | 263 | cd05052, PTKc_Abl, Catalytic domain of the Protein | 4e-05 | |
| cd05071 | 262 | cd05071, PTKc_Src, Catalytic domain of the Protein | 4e-05 | |
| cd05072 | 261 | cd05072, PTKc_Lyn, Catalytic domain of the Protein | 5e-05 | |
| cd05106 | 374 | cd05106, PTKc_CSF-1R, Catalytic domain of the Prot | 6e-05 | |
| cd05104 | 375 | cd05104, PTKc_Kit, Catalytic domain of the Protein | 9e-05 | |
| cd05043 | 280 | cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece | 1e-04 | |
| cd05105 | 400 | cd05105, PTKc_PDGFR_alpha, Catalytic domain of the | 1e-04 | |
| cd05112 | 256 | cd05112, PTKc_Itk, Catalytic domain of the Protein | 2e-04 | |
| cd05039 | 256 | cd05039, PTKc_Csk_like, Catalytic domain of C-term | 2e-04 | |
| cd05045 | 290 | cd05045, PTKc_RET, Catalytic domain of the Protein | 2e-04 | |
| cd05081 | 284 | cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) | 2e-04 | |
| pfam01636 | 238 | pfam01636, APH, Phosphotransferase enzyme family | 2e-04 | |
| cd05083 | 254 | cd05083, PTKc_Chk, Catalytic domain of the Protein | 2e-04 | |
| cd05070 | 260 | cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro | 2e-04 | |
| cd05107 | 401 | cd05107, PTKc_PDGFR_beta, Catalytic domain of the | 2e-04 | |
| cd05073 | 260 | cd05073, PTKc_Hck, Catalytic domain of the Protein | 3e-04 | |
| cd05041 | 251 | cd05041, PTKc_Fes_like, Catalytic domain of Fes-li | 3e-04 | |
| cd05574 | 316 | cd05574, STKc_phototropin_like, Catalytic domain o | 4e-04 | |
| cd05032 | 277 | cd05032, PTKc_InsR_like, Catalytic domain of Insul | 6e-04 | |
| cd05063 | 268 | cd05063, PTKc_EphR_A2, Catalytic domain of the Pro | 6e-04 | |
| cd05066 | 267 | cd05066, PTKc_EphR_A, Catalytic domain of the Prot | 6e-04 | |
| cd05116 | 257 | cd05116, PTKc_Syk, Catalytic domain of the Protein | 7e-04 | |
| cd05084 | 252 | cd05084, PTKc_Fes, Catalytic domain of the Protein | 7e-04 | |
| cd05048 | 283 | cd05048, PTKc_Ror, Catalytic Domain of the Protein | 7e-04 | |
| cd05060 | 257 | cd05060, PTKc_Syk_like, Catalytic domain of Spleen | 8e-04 | |
| cd05033 | 266 | cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec | 0.001 | |
| cd05074 | 273 | cd05074, PTKc_Tyro3, Catalytic domain of the Prote | 0.001 | |
| cd05082 | 256 | cd05082, PTKc_Csk, Catalytic domain of the Protein | 0.001 | |
| cd05113 | 256 | cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro | 0.001 | |
| cd05035 | 273 | cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li | 0.001 | |
| PHA02882 | 294 | PHA02882, PHA02882, putative serine/threonine kina | 0.002 | |
| cd05115 | 257 | cd05115, PTKc_Zap-70, Catalytic domain of the Prot | 0.002 | |
| cd05047 | 270 | cd05047, PTKc_Tie, Catalytic domain of Tie Protein | 0.004 |
| >gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
Score = 130 bits (329), Expect = 2e-39
Identities = 48/83 (57%), Positives = 61/83 (73%), Gaps = 5/83 (6%)
Query: 8 ETEQYLDERFIWKVLYQLSKALQVCH-----SSCILHRDIKPANVFLDENNNVKLGDFGL 62
+ +Y++E FIW++L QL AL CH + +LHRD+KPAN+FLD NNNVKLGDFGL
Sbjct: 97 KERKYIEEEFIWRILTQLLLALYECHNRSDPGNTVLHRDLKPANIFLDANNNVKLGDFGL 156
Query: 63 ARILNMNESHSYTLVGTPYYMSP 85
A+IL + S + T VGTPYYMSP
Sbjct: 157 AKILGHDSSFAKTYVGTPYYMSP 179
|
Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exit. NIMA is involved in nuclear membrane fission. Vertebrate Nek2 is a cell cycle-regulated STK, localized in centrosomes and kinetochores, that regulates centrosome splitting at the G2/M phase. It also interacts with other mitotic kinases such as Polo-like kinase 1 and may play a role in spindle checkpoint. An increase in the expression of the human NEK2 gene is strongly associated with the progression of non-Hodgkin lymphoma. Length = 265 |
| >gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain | Back alignment and domain information |
|---|
| >gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 | Back alignment and domain information |
|---|
| >gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 | Back alignment and domain information |
|---|
| >gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 | Back alignment and domain information |
|---|
| >gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 | Back alignment and domain information |
|---|
| >gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 | Back alignment and domain information |
|---|
| >gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein | Back alignment and domain information |
|---|
| >gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl | Back alignment and domain information |
|---|
| >gnl|CDD|178763 PLN03224, PLN03224, probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|216618 pfam01636, APH, Phosphotransferase enzyme family | Back alignment and domain information |
|---|
| >gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes | Back alignment and domain information |
|---|
| >gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 | Back alignment and domain information |
|---|
| >gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|165211 PHA02882, PHA02882, putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa | Back alignment and domain information |
|---|
| >gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 85 | |||
| KOG0598|consensus | 357 | 99.83 | ||
| KOG0616|consensus | 355 | 99.8 | ||
| KOG0595|consensus | 429 | 99.8 | ||
| KOG0615|consensus | 475 | 99.78 | ||
| KOG0694|consensus | 694 | 99.78 | ||
| KOG0593|consensus | 396 | 99.78 | ||
| KOG0583|consensus | 370 | 99.78 | ||
| KOG0661|consensus | 538 | 99.78 | ||
| KOG0575|consensus | 592 | 99.78 | ||
| KOG0581|consensus | 364 | 99.77 | ||
| KOG0594|consensus | 323 | 99.77 | ||
| KOG0578|consensus | 550 | 99.77 | ||
| KOG0591|consensus | 375 | 99.77 | ||
| KOG0600|consensus | 560 | 99.76 | ||
| KOG0599|consensus | 411 | 99.76 | ||
| KOG0198|consensus | 313 | 99.74 | ||
| KOG0663|consensus | 419 | 99.73 | ||
| KOG0659|consensus | 318 | 99.72 | ||
| KOG0611|consensus | 668 | 99.71 | ||
| KOG0592|consensus | 604 | 99.71 | ||
| KOG0585|consensus | 576 | 99.7 | ||
| KOG0986|consensus | 591 | 99.69 | ||
| KOG0588|consensus | 786 | 99.69 | ||
| KOG0192|consensus | 362 | 99.69 | ||
| KOG0690|consensus | 516 | 99.68 | ||
| KOG0589|consensus | 426 | 99.68 | ||
| KOG0579|consensus | 1187 | 99.68 | ||
| KOG0582|consensus | 516 | 99.66 | ||
| cd05571 | 323 | STKc_PKB Catalytic domain of the Protein Serine/Th | 99.65 | |
| KOG0033|consensus | 355 | 99.65 | ||
| cd05586 | 330 | STKc_Sck1_like Catalytic domain of Suppressor of l | 99.63 | |
| cd05592 | 316 | STKc_nPKC_theta_delta Catalytic domain of the Prot | 99.63 | |
| cd05593 | 328 | STKc_PKB_gamma Catalytic domain of the Protein Ser | 99.62 | |
| cd05594 | 325 | STKc_PKB_alpha Catalytic domain of the Protein Ser | 99.62 | |
| cd05604 | 325 | STKc_SGK3 Catalytic domain of the Protein Serine/T | 99.62 | |
| KOG0597|consensus | 808 | 99.62 | ||
| cd05590 | 320 | STKc_nPKC_eta Catalytic domain of the Protein Seri | 99.61 | |
| cd07862 | 290 | STKc_CDK6 Catalytic domain of the Serine/Threonine | 99.61 | |
| cd05602 | 325 | STKc_SGK1 Catalytic domain of the Protein Serine/T | 99.61 | |
| cd05587 | 324 | STKc_cPKC Catalytic domain of the Protein Serine/T | 99.61 | |
| cd05595 | 323 | STKc_PKB_beta Catalytic domain of the Protein Seri | 99.61 | |
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 99.61 | |
| cd05616 | 323 | STKc_cPKC_beta Catalytic domain of the Protein Ser | 99.61 | |
| cd05585 | 312 | STKc_YPK1_like Catalytic domain of Yeast Protein K | 99.61 | |
| KOG0614|consensus | 732 | 99.61 | ||
| cd05575 | 323 | STKc_SGK Catalytic domain of the Protein Serine/Th | 99.61 | |
| cd05617 | 327 | STKc_aPKC_zeta Catalytic domain of the Protein Ser | 99.61 | |
| cd05591 | 321 | STKc_nPKC_epsilon Catalytic domain of the Protein | 99.6 | |
| cd05584 | 323 | STKc_p70S6K Catalytic domain of the Protein Serine | 99.6 | |
| cd05618 | 329 | STKc_aPKC_iota Catalytic domain of the Protein Ser | 99.6 | |
| cd05620 | 316 | STKc_nPKC_delta Catalytic domain of the Protein Se | 99.6 | |
| cd05603 | 321 | STKc_SGK2 Catalytic domain of the Protein Serine/T | 99.6 | |
| KOG0660|consensus | 359 | 99.6 | ||
| cd05608 | 280 | STKc_GRK1 Catalytic domain of the Protein Serine/T | 99.6 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 99.6 | |
| KOG0696|consensus | 683 | 99.59 | ||
| cd05588 | 329 | STKc_aPKC Catalytic domain of the Protein Serine/T | 99.59 | |
| cd07871 | 288 | STKc_PCTAIRE3 Catalytic domain of the Serine/Threo | 99.59 | |
| cd05589 | 324 | STKc_PKN Catalytic domain of the Protein Serine/Th | 99.59 | |
| cd05615 | 323 | STKc_cPKC_alpha Catalytic domain of the Protein Se | 99.59 | |
| cd05614 | 332 | STKc_MSK2_N N-terminal catalytic domain of the Pro | 99.58 | |
| KOG0658|consensus | 364 | 99.58 | ||
| cd05619 | 316 | STKc_nPKC_theta Catalytic domain of the Protein Se | 99.57 | |
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 99.57 | |
| cd05582 | 318 | STKc_RSK_N N-terminal catalytic domain of the Prot | 99.57 | |
| cd07868 | 317 | STKc_CDK8 Catalytic domain of the Serine/Threonine | 99.57 | |
| cd05631 | 285 | STKc_GRK4 Catalytic domain of the Protein Serine/T | 99.57 | |
| KOG0032|consensus | 382 | 99.56 | ||
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 99.56 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 99.56 | |
| PHA02882 | 294 | putative serine/threonine kinase; Provisional | 99.56 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 99.56 | |
| cd05597 | 331 | STKc_DMPK_like Catalytic domain of Myotonic Dystro | 99.56 | |
| KOG0604|consensus | 400 | 99.56 | ||
| KOG0695|consensus | 593 | 99.55 | ||
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 99.55 | |
| KOG0201|consensus | 467 | 99.55 | ||
| cd05570 | 318 | STKc_PKC Catalytic domain of the Protein Serine/Th | 99.55 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 99.55 | |
| KOG0580|consensus | 281 | 99.55 | ||
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 99.55 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 99.55 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 99.54 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 99.54 | |
| cd05624 | 331 | STKc_MRCK_beta Catalytic domain of the Protein Ser | 99.54 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 99.54 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 99.54 | |
| KOG4236|consensus | 888 | 99.54 | ||
| cd05627 | 360 | STKc_NDR2 Catalytic domain of the Protein Serine/T | 99.53 | |
| cd07863 | 288 | STKc_CDK4 Catalytic domain of the Serine/Threonine | 99.53 | |
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 99.53 | |
| cd07859 | 338 | STKc_TDY_MAPK_plant Catalytic domain of the Serine | 99.53 | |
| cd08223 | 257 | STKc_Nek4 Catalytic domain of the Protein Serine/T | 99.53 | |
| cd05623 | 332 | STKc_MRCK_alpha Catalytic domain of the Protein Se | 99.53 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 99.53 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 99.53 | |
| cd05573 | 350 | STKc_ROCK_NDR_like Catalytic domain of ROCK- and N | 99.53 | |
| KOG1187|consensus | 361 | 99.53 | ||
| cd05102 | 338 | PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi | 99.53 | |
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 99.52 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 99.52 | |
| cd05601 | 330 | STKc_CRIK Catalytic domain of the Protein Serine/T | 99.52 | |
| KOG0612|consensus | 1317 | 99.52 | ||
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 99.52 | |
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 99.52 | |
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 99.51 | |
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 99.51 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 99.51 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 99.51 | |
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 99.51 | |
| KOG0197|consensus | 468 | 99.51 | ||
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 99.51 | |
| KOG0662|consensus | 292 | 99.5 | ||
| KOG0667|consensus | 586 | 99.5 | ||
| cd07867 | 317 | STKc_CDC2L6 Catalytic domain of Serine/Threonine K | 99.5 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 99.5 | |
| cd07853 | 372 | STKc_NLK Catalytic domain of the Serine/Threonine | 99.49 | |
| KOG0577|consensus | 948 | 99.49 | ||
| cd07848 | 287 | STKc_CDKL5 Catalytic domain of the Serine/Threonin | 99.49 | |
| KOG0193|consensus | 678 | 99.49 | ||
| cd06637 | 272 | STKc_TNIK Catalytic domain of the Protein Serine/T | 99.48 | |
| KOG4721|consensus | 904 | 99.48 | ||
| cd06645 | 267 | STKc_MAP4K3 Catalytic domain of the Protein Serine | 99.48 | |
| KOG0983|consensus | 391 | 99.48 | ||
| cd07839 | 284 | STKc_CDK5 Catalytic domain of the Serine/Threonine | 99.48 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 99.48 | |
| cd05607 | 277 | STKc_GRK7 Catalytic domain of the Protein Serine/T | 99.48 | |
| KOG0666|consensus | 438 | 99.48 | ||
| cd05605 | 285 | STKc_GRK4_like Catalytic domain of G protein-coupl | 99.48 | |
| cd06643 | 282 | STKc_SLK Catalytic domain of the Protein Serine/Th | 99.48 | |
| cd05630 | 285 | STKc_GRK6 Catalytic domain of the Protein Serine/T | 99.47 | |
| cd05632 | 285 | STKc_GRK5 Catalytic domain of the Protein Serine/T | 99.47 | |
| cd07861 | 285 | STKc_CDK1_euk Catalytic domain of the Serine/Threo | 99.47 | |
| cd08219 | 255 | STKc_Nek3 Catalytic domain of the Protein Serine/T | 99.46 | |
| KOG0665|consensus | 369 | 99.46 | ||
| KOG4717|consensus | 864 | 99.46 | ||
| KOG4250|consensus | 732 | 99.46 | ||
| KOG0587|consensus | 953 | 99.46 | ||
| KOG0586|consensus | 596 | 99.45 | ||
| KOG0584|consensus | 632 | 99.45 | ||
| cd08529 | 256 | STKc_FA2-like Catalytic domain of the Protein Seri | 99.45 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 99.45 | |
| cd05610 | 669 | STKc_MASTL Catalytic domain of the Protein Serine/ | 99.44 | |
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 99.44 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 99.44 | |
| KOG0984|consensus | 282 | 99.44 | ||
| cd05109 | 279 | PTKc_HER2 Catalytic domain of the Protein Tyrosine | 99.44 | |
| cd05096 | 304 | PTKc_DDR1 Catalytic domain of the Protein Tyrosine | 99.44 | |
| KOG1035|consensus | 1351 | 99.44 | ||
| PF00069 | 260 | Pkinase: Protein kinase domain Protein kinase; unc | 99.44 | |
| PTZ00284 | 467 | protein kinase; Provisional | 99.43 | |
| cd07873 | 301 | STKc_PCTAIRE1 Catalytic domain of the Serine/Threo | 99.43 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 99.43 | |
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 99.43 | |
| cd07837 | 295 | STKc_CdkB_plant Catalytic domain of the Serine/Thr | 99.43 | |
| KOG1165|consensus | 449 | 99.43 | ||
| cd05054 | 337 | PTKc_VEGFR Catalytic domain of the Protein Tyrosin | 99.43 | |
| cd07870 | 291 | STKc_PFTAIRE2 Catalytic domain of the Serine/Threo | 99.43 | |
| cd06646 | 267 | STKc_MAP4K5 Catalytic domain of the Protein Serine | 99.42 | |
| cd05111 | 279 | PTK_HER3 Pseudokinase domain of the Protein Tyrosi | 99.42 | |
| cd05633 | 279 | STKc_GRK3 Catalytic domain of the Protein Serine/T | 99.42 | |
| cd07843 | 293 | STKc_CDC2L1 Catalytic domain of the Serine/Threoni | 99.42 | |
| cd05606 | 278 | STKc_beta_ARK Catalytic domain of the Protein Seri | 99.42 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 99.41 | |
| cd06636 | 282 | STKc_MAP4K4_6 Catalytic domain of the Protein Seri | 99.41 | |
| KOG0574|consensus | 502 | 99.41 | ||
| cd07847 | 286 | STKc_CDKL1_4 Catalytic domain of the Serine/Threon | 99.41 | |
| cd08228 | 267 | STKc_Nek6 Catalytic domain of the Protein Serine/T | 99.41 | |
| cd05108 | 316 | PTKc_EGFR Catalytic domain of the Protein Tyrosine | 99.41 | |
| cd06611 | 280 | STKc_SLK_like Catalytic domain of Ste20-like kinas | 99.41 | |
| cd08229 | 267 | STKc_Nek7 Catalytic domain of the Protein Serine/T | 99.41 | |
| cd08224 | 267 | STKc_Nek6_Nek7 Catalytic domain of the Protein Ser | 99.41 | |
| cd07857 | 332 | STKc_MPK1 Catalytic domain of the Serine/Threonine | 99.41 | |
| cd08221 | 256 | STKc_Nek9 Catalytic domain of the Protein Serine/T | 99.4 | |
| KOG4279|consensus | 1226 | 99.4 | ||
| cd05091 | 283 | PTKc_Ror2 Catalytic domain of the Protein Tyrosine | 99.4 | |
| KOG3653|consensus | 534 | 99.4 | ||
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 99.4 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 99.4 | |
| cd07844 | 291 | STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like | 99.4 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 99.4 | |
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 99.4 | |
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 99.4 | |
| cd07841 | 298 | STKc_CDK7 Catalytic domain of the Serine/Threonine | 99.4 | |
| cd06613 | 262 | STKc_MAP4K3_like Catalytic domain of Mitogen-activ | 99.4 | |
| cd07860 | 284 | STKc_CDK2_3 Catalytic domain of the Serine/Threoni | 99.39 | |
| cd00192 | 262 | PTKc Catalytic domain of Protein Tyrosine Kinases. | 99.39 | |
| cd06659 | 297 | STKc_PAK6 Catalytic domain of the Protein Serine/T | 99.39 | |
| cd05071 | 262 | PTKc_Src Catalytic domain of the Protein Tyrosine | 99.39 | |
| cd05052 | 263 | PTKc_Abl Catalytic domain of the Protein Tyrosine | 99.39 | |
| cd05048 | 283 | PTKc_Ror Catalytic Domain of the Protein Tyrosine | 99.39 | |
| cd05051 | 296 | PTKc_DDR Catalytic domain of the Protein Tyrosine | 99.39 | |
| cd05094 | 291 | PTKc_TrkC Catalytic domain of the Protein Tyrosine | 99.38 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 99.38 | |
| cd06655 | 296 | STKc_PAK2 Catalytic domain of the Protein Serine/T | 99.38 | |
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 99.38 | |
| cd06608 | 275 | STKc_myosinIII_like Catalytic domain of Class III | 99.38 | |
| cd05069 | 260 | PTKc_Yes Catalytic domain of the Protein Tyrosine | 99.38 | |
| cd05148 | 261 | PTKc_Srm_Brk Catalytic domain of the Protein Tyros | 99.38 | |
| cd05115 | 257 | PTKc_Zap-70 Catalytic domain of the Protein Tyrosi | 99.38 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 99.38 | |
| cd05075 | 272 | PTKc_Axl Catalytic domain of the Protein Tyrosine | 99.38 | |
| cd05082 | 256 | PTKc_Csk Catalytic domain of the Protein Tyrosine | 99.38 | |
| cd06619 | 279 | PKc_MKK5 Catalytic domain of the dual-specificity | 99.38 | |
| cd05580 | 290 | STKc_PKA Catalytic domain of the Protein Serine/Th | 99.38 | |
| cd05093 | 288 | PTKc_TrkB Catalytic domain of the Protein Tyrosine | 99.38 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 99.37 | |
| cd05101 | 304 | PTKc_FGFR2 Catalytic domain of the Protein Tyrosin | 99.37 | |
| KOG1989|consensus | 738 | 99.37 | ||
| cd07834 | 330 | STKc_MAPK Catalytic domain of the Serine/Threonine | 99.37 | |
| cd07846 | 286 | STKc_CDKL2_3 Catalytic domain of the Serine/Threon | 99.37 | |
| cd08218 | 256 | STKc_Nek1 Catalytic domain of the Protein Serine/T | 99.36 | |
| cd05067 | 260 | PTKc_Lck_Blk Catalytic domain of the Protein Tyros | 99.36 | |
| cd06917 | 277 | STKc_NAK1_like Catalytic domain of Fungal Nak1-lik | 99.36 | |
| cd05110 | 303 | PTKc_HER4 Catalytic domain of the Protein Tyrosine | 99.36 | |
| cd07842 | 316 | STKc_CDK8_like Catalytic domain of Cyclin-Dependen | 99.36 | |
| cd07835 | 283 | STKc_CDK1_like Catalytic domain of Cyclin-Dependen | 99.36 | |
| cd05072 | 261 | PTKc_Lyn Catalytic domain of the Protein Tyrosine | 99.36 | |
| cd05042 | 269 | PTKc_Aatyk Catalytic domain of the Protein Tyrosin | 99.36 | |
| cd05077 | 262 | PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th | 99.36 | |
| cd05070 | 260 | PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros | 99.35 | |
| cd05116 | 257 | PTKc_Syk Catalytic domain of the Protein Tyrosine | 99.35 | |
| cd07833 | 288 | STKc_CDKL Catalytic domain of Cyclin-Dependent pro | 99.35 | |
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 99.35 | |
| cd05035 | 273 | PTKc_Axl_like Catalytic Domain of Axl-like Protein | 99.35 | |
| cd07836 | 284 | STKc_Pho85 Catalytic domain of the Serine/Threonin | 99.35 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 99.35 | |
| PLN00009 | 294 | cyclin-dependent kinase A; Provisional | 99.35 | |
| KOG2052|consensus | 513 | 99.34 | ||
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 99.34 | |
| KOG1152|consensus | 772 | 99.34 | ||
| cd05068 | 261 | PTKc_Frk_like Catalytic domain of Fyn-related kina | 99.34 | |
| cd06617 | 283 | PKc_MKK3_6 Catalytic domain of the dual-specificit | 99.34 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 99.34 | |
| cd06648 | 285 | STKc_PAK_II Catalytic domain of the Protein Serine | 99.34 | |
| cd06625 | 263 | STKc_MEKK3_like Catalytic domain of MAP/ERK kinase | 99.34 | |
| cd05092 | 280 | PTKc_TrkA Catalytic domain of the Protein Tyrosine | 99.34 | |
| cd06612 | 256 | STKc_MST1_2 Catalytic domain of the Protein Serine | 99.34 | |
| cd06609 | 274 | STKc_MST3_like Catalytic domain of Mammalian Ste20 | 99.33 | |
| cd06657 | 292 | STKc_PAK4 Catalytic domain of the Protein Serine/T | 99.33 | |
| cd05613 | 290 | STKc_MSK1_N N-terminal catalytic domain of the Pro | 99.33 | |
| cd05088 | 303 | PTKc_Tie2 Catalytic domain of the Protein Tyrosine | 99.33 | |
| cd05053 | 293 | PTKc_FGFR Catalytic domain of the Protein Tyrosine | 99.33 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 99.33 | |
| cd05118 | 283 | STKc_CMGC Catalytic domain of CMGC family Serine/T | 99.33 | |
| cd06647 | 293 | STKc_PAK_I Catalytic domain of the Protein Serine/ | 99.33 | |
| KOG4645|consensus | 1509 | 99.33 | ||
| cd08216 | 314 | PK_STRAD Pseudokinase domain of STE20-related kina | 99.32 | |
| cd08217 | 265 | STKc_Nek2 Catalytic domain of the Protein Serine/T | 99.32 | |
| KOG0669|consensus | 376 | 99.32 | ||
| cd07865 | 310 | STKc_CDK9 Catalytic domain of the Serine/Threonine | 99.32 | |
| cd08215 | 258 | STKc_Nek Catalytic domain of the Protein Serine/Th | 99.32 | |
| cd07829 | 282 | STKc_CDK_like Catalytic domain of Cyclin-Dependent | 99.32 | |
| cd05057 | 279 | PTKc_EGFR_like Catalytic domain of Epidermal Growt | 99.32 | |
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 99.32 | |
| cd05086 | 268 | PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi | 99.32 | |
| cd05045 | 290 | PTKc_RET Catalytic domain of the Protein Tyrosine | 99.32 | |
| cd05574 | 316 | STKc_phototropin_like Catalytic domain of Phototro | 99.32 | |
| cd05083 | 254 | PTKc_Chk Catalytic domain of the Protein Tyrosine | 99.32 | |
| cd05079 | 284 | PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the | 99.32 | |
| cd05098 | 307 | PTKc_FGFR1 Catalytic domain of the Protein Tyrosin | 99.32 | |
| cd05037 | 259 | PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the | 99.32 | |
| cd06627 | 254 | STKc_Cdc7_like Catalytic domain of Cell division c | 99.32 | |
| cd05062 | 277 | PTKc_IGF-1R Catalytic domain of the Protein Tyrosi | 99.32 | |
| cd05090 | 283 | PTKc_Ror1 Catalytic domain of the Protein Tyrosine | 99.32 | |
| cd07832 | 286 | STKc_CCRK Catalytic domain of the Serine/Threonine | 99.32 | |
| cd07831 | 282 | STKc_MOK Catalytic domain of the Serine/Threonine | 99.31 | |
| cd07838 | 287 | STKc_CDK4_6_like Catalytic domain of Cyclin-Depend | 99.31 | |
| cd05572 | 262 | STKc_cGK_PKG Catalytic domain of the Protein Serin | 99.31 | |
| cd06642 | 277 | STKc_STK25-YSK1 Catalytic domain of the Protein Se | 99.31 | |
| cd05089 | 297 | PTKc_Tie1 Catalytic domain of the Protein Tyrosine | 99.31 | |
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 99.31 | |
| cd06628 | 267 | STKc_MAPKKK_Byr2_like Catalytic domain of fungal B | 99.31 | |
| PHA03390 | 267 | pk1 serine/threonine-protein kinase 1; Provisional | 99.31 | |
| cd05032 | 277 | PTKc_InsR_like Catalytic domain of Insulin Recepto | 99.31 | |
| cd05080 | 283 | PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the | 99.31 | |
| cd05103 | 343 | PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi | 99.31 | |
| cd06652 | 265 | STKc_MEKK2 Catalytic domain of the Protein Serine/ | 99.3 | |
| cd05033 | 266 | PTKc_EphR Catalytic domain of Ephrin Receptor Prot | 99.3 | |
| smart00219 | 258 | TyrKc Tyrosine kinase, catalytic domain. Phosphotr | 99.3 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 99.3 | |
| cd07830 | 283 | STKc_MAK_like Catalytic domain of Male germ cell-A | 99.3 | |
| cd07866 | 311 | STKc_BUR1 Catalytic domain of the Serine/Threonine | 99.3 | |
| cd05073 | 260 | PTKc_Hck Catalytic domain of the Protein Tyrosine | 99.3 | |
| cd05059 | 256 | PTKc_Tec_like Catalytic domain of Tec-like Protein | 99.3 | |
| KOG0605|consensus | 550 | 99.29 | ||
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 99.29 | |
| cd05049 | 280 | PTKc_Trk Catalytic domain of the Protein Tyrosine | 99.29 | |
| cd05074 | 273 | PTKc_Tyro3 Catalytic domain of the Protein Tyrosin | 99.29 | |
| cd05095 | 296 | PTKc_DDR2 Catalytic domain of the Protein Tyrosine | 99.29 | |
| cd06640 | 277 | STKc_MST4 Catalytic domain of the Protein Serine/T | 99.29 | |
| cd05064 | 266 | PTKc_EphR_A10 Catalytic domain of the Protein Tyro | 99.29 | |
| cd05113 | 256 | PTKc_Btk_Bmx Catalytic domain of the Protein Tyros | 99.29 | |
| cd05611 | 260 | STKc_Rim15_like Catalytic domain of fungal Rim15-l | 99.29 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 99.29 | |
| KOG0196|consensus | 996 | 99.29 | ||
| cd05081 | 284 | PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of | 99.29 | |
| cd05040 | 257 | PTKc_Ack_like Catalytic domain of the Protein Tyro | 99.29 | |
| cd05058 | 262 | PTKc_Met_Ron Catalytic domain of the Protein Tyros | 99.29 | |
| KOG1164|consensus | 322 | 99.29 | ||
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 99.29 | |
| cd07852 | 337 | STKc_MAPK15 Catalytic domain of the Serine/Threoni | 99.29 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 99.28 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 99.28 | |
| cd05123 | 250 | STKc_AGC Catalytic domain of AGC family Protein Se | 99.28 | |
| cd05039 | 256 | PTKc_Csk_like Catalytic domain of C-terminal Src k | 99.28 | |
| cd05576 | 237 | STKc_RPK118_like Catalytic domain of the Protein S | 99.28 | |
| cd05047 | 270 | PTKc_Tie Catalytic domain of Tie Protein Tyrosine | 99.28 | |
| cd08225 | 257 | STKc_Nek5 Catalytic domain of the Protein Serine/T | 99.28 | |
| KOG0194|consensus | 474 | 99.28 | ||
| cd05577 | 277 | STKc_GRK Catalytic domain of the Protein Serine/Th | 99.28 | |
| cd06624 | 268 | STKc_ASK Catalytic domain of the Protein Serine/Th | 99.28 | |
| cd06653 | 264 | STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina | 99.28 | |
| cd06651 | 266 | STKc_MEKK3 Catalytic domain of the Protein Serine/ | 99.28 | |
| cd05087 | 269 | PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein | 99.28 | |
| cd05114 | 256 | PTKc_Tec_Rlk Catalytic domain of the Protein Tyros | 99.28 | |
| cd05043 | 280 | PTK_Ryk Pseudokinase domain of Ryk (Receptor relat | 99.28 | |
| cd05579 | 265 | STKc_MAST_like Catalytic domain of Microtubule-ass | 99.27 | |
| cd05060 | 257 | PTKc_Syk_like Catalytic domain of Spleen Tyrosine | 99.27 | |
| cd06615 | 308 | PKc_MEK Catalytic domain of the dual-specificity P | 99.27 | |
| cd06623 | 264 | PKc_MAPKK_plant_like Catalytic domain of Plant dua | 99.27 | |
| cd06641 | 277 | STKc_MST3 Catalytic domain of the Protein Serine/T | 99.27 | |
| cd05034 | 261 | PTKc_Src_like Catalytic domain of Src kinase-like | 99.27 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 99.27 | |
| cd07840 | 287 | STKc_CDK9_like Catalytic domain of Cyclin-Dependen | 99.27 | |
| cd08227 | 327 | PK_STRAD_alpha Pseudokinase domain of STE20-relate | 99.27 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 99.27 | |
| KOG0596|consensus | 677 | 99.27 | ||
| KOG0664|consensus | 449 | 99.27 | ||
| cd05056 | 270 | PTKc_FAK Catalytic domain of the Protein Tyrosine | 99.26 | |
| cd07864 | 302 | STKc_CDK12 Catalytic domain of the Serine/Threonin | 99.26 | |
| cd06610 | 267 | STKc_OSR1_SPAK Catalytic domain of the Protein Ser | 99.26 | |
| cd06616 | 288 | PKc_MKK4 Catalytic domain of the dual-specificity | 99.26 | |
| cd08222 | 260 | STKc_Nek11 Catalytic domain of the Protein Serine/ | 99.26 | |
| cd06632 | 258 | STKc_MEKK1_plant Catalytic domain of the Protein S | 99.26 | |
| cd05097 | 295 | PTKc_DDR_like Catalytic domain of Discoidin Domain | 99.26 | |
| KOG0603|consensus | 612 | 99.26 | ||
| cd05066 | 267 | PTKc_EphR_A Catalytic domain of the Protein Tyrosi | 99.26 | |
| cd06622 | 286 | PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS | 99.26 | |
| KOG0610|consensus | 459 | 99.26 | ||
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 99.26 | |
| cd05061 | 288 | PTKc_InsR Catalytic domain of the Protein Tyrosine | 99.26 | |
| cd05085 | 250 | PTKc_Fer Catalytic domain of the Protein Tyrosine | 99.25 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 99.25 | |
| cd05063 | 268 | PTKc_EphR_A2 Catalytic domain of the Protein Tyros | 99.25 | |
| cd05078 | 258 | PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain | 99.25 | |
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 99.25 | |
| cd06626 | 264 | STKc_MEKK4 Catalytic domain of the Protein Serine/ | 99.24 | |
| cd05084 | 252 | PTKc_Fes Catalytic domain of the Protein Tyrosine | 99.23 | |
| cd05050 | 288 | PTKc_Musk Catalytic domain of the Protein Tyrosine | 99.23 | |
| cd08220 | 256 | STKc_Nek8 Catalytic domain of the Protein Serine/T | 99.23 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 99.23 | |
| PHA02988 | 283 | hypothetical protein; Provisional | 99.23 | |
| cd05583 | 288 | STKc_MSK_N N-terminal catalytic domain of the Prot | 99.23 | |
| cd05076 | 274 | PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th | 99.22 | |
| cd08528 | 269 | STKc_Nek10 Catalytic domain of the Protein Serine/ | 99.22 | |
| KOG0576|consensus | 829 | 99.22 | ||
| cd05046 | 275 | PTK_CCK4 Pseudokinase domain of the Protein Tyrosi | 99.22 | |
| cd05122 | 253 | PKc_STE Catalytic domain of STE family Protein Kin | 99.22 | |
| KOG0671|consensus | 415 | 99.22 | ||
| PF07714 | 259 | Pkinase_Tyr: Protein tyrosine kinase Protein kinas | 99.21 | |
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 99.21 | |
| cd05581 | 280 | STKc_PDK1 Catalytic domain of the Protein Serine/T | 99.21 | |
| cd06629 | 272 | STKc_MAPKKK_Bck1_like Catalytic domain of fungal B | 99.21 | |
| cd08530 | 256 | STKc_CNK2-like Catalytic domain of the Protein Ser | 99.21 | |
| cd06614 | 286 | STKc_PAK Catalytic domain of the Protein Serine/Th | 99.21 | |
| KOG0607|consensus | 463 | 99.21 | ||
| cd05609 | 305 | STKc_MAST Catalytic domain of the Protein Serine/T | 99.21 | |
| KOG1027|consensus | 903 | 99.21 | ||
| KOG0608|consensus | 1034 | 99.21 | ||
| cd05041 | 251 | PTKc_Fes_like Catalytic domain of Fes-like Protein | 99.2 | |
| cd05578 | 258 | STKc_Yank1 Catalytic domain of the Protein Serine/ | 99.2 | |
| cd05112 | 256 | PTKc_Itk Catalytic domain of the Protein Tyrosine | 99.2 | |
| cd06605 | 265 | PKc_MAPKK Catalytic domain of the dual-specificity | 99.19 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 99.18 | |
| cd06630 | 268 | STKc_MEKK1 Catalytic domain of the Protein Serine/ | 99.18 | |
| cd06631 | 265 | STKc_YSK4 Catalytic domain of the Protein Serine/T | 99.18 | |
| cd05065 | 269 | PTKc_EphR_B Catalytic domain of the Protein Tyrosi | 99.18 | |
| cd05044 | 269 | PTKc_c-ros Catalytic domain of the Protein Tyrosin | 99.17 | |
| cd05038 | 284 | PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P | 99.17 | |
| smart00750 | 176 | KIND kinase non-catalytic C-lobe domain. It is an | 99.16 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 99.15 | |
| cd08226 | 328 | PK_STRAD_beta Pseudokinase domain of STE20-related | 99.14 | |
| cd05147 | 190 | RIO1_euk RIO kinase family; eukaryotic RIO1, catal | 99.14 | |
| cd06606 | 260 | STKc_MAPKKK Catalytic domain of the Protein Serine | 99.14 | |
| KOG1163|consensus | 341 | 99.14 | ||
| cd06621 | 287 | PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek | 99.13 | |
| cd05036 | 277 | PTKc_ALK_LTK Catalytic domain of the Protein Tyros | 99.13 | |
| cd05145 | 190 | RIO1_like RIO kinase family; RIO1, RIO3 and simila | 99.12 | |
| KOG2345|consensus | 302 | 99.11 | ||
| KOG1006|consensus | 361 | 99.1 | ||
| cd06620 | 284 | PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr | 99.08 | |
| KOG1151|consensus | 775 | 99.06 | ||
| KOG1345|consensus | 378 | 99.03 | ||
| KOG0668|consensus | 338 | 99.02 | ||
| smart00220 | 244 | S_TKc Serine/Threonine protein kinases, catalytic | 98.99 | |
| KOG1026|consensus | 774 | 98.98 | ||
| KOG1095|consensus | 1025 | 98.98 | ||
| cd00180 | 215 | PKc Catalytic domain of Protein Kinases. Protein K | 98.97 | |
| KOG0200|consensus | 609 | 98.97 | ||
| PRK12274 | 218 | serine/threonine protein kinase; Provisional | 98.93 | |
| KOG0670|consensus | 752 | 98.9 | ||
| KOG0590|consensus | 601 | 98.89 | ||
| COG0515 | 384 | SPS1 Serine/threonine protein kinase [General func | 98.89 | |
| KOG4257|consensus | 974 | 98.89 | ||
| smart00221 | 225 | STYKc Protein kinase; unclassified specificity. Ph | 98.86 | |
| smart00090 | 237 | RIO RIO-like kinase. | 98.84 | |
| KOG0199|consensus | 1039 | 98.8 | ||
| KOG1094|consensus | 807 | 98.76 | ||
| PRK01723 | 239 | 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed | 98.7 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.69 | |
| KOG1025|consensus | 1177 | 98.67 | ||
| cd05144 | 198 | RIO2_C RIO kinase family; RIO2, C-terminal catalyt | 98.66 | |
| KOG4278|consensus | 1157 | 98.65 | ||
| cd05119 | 187 | RIO RIO kinase family, catalytic domain. The RIO k | 98.56 | |
| KOG1167|consensus | 418 | 98.53 | ||
| PRK09605 | 535 | bifunctional UGMP family protein/serine/threonine | 98.52 | |
| PRK14879 | 211 | serine/threonine protein kinase; Provisional | 98.5 | |
| PRK10345 | 210 | hypothetical protein; Provisional | 98.49 | |
| KOG1290|consensus | 590 | 98.49 | ||
| TIGR03724 | 199 | arch_bud32 Kae1-associated kinase Bud32. Members o | 98.45 | |
| KOG1024|consensus | 563 | 98.42 | ||
| KOG4158|consensus | 598 | 98.39 | ||
| KOG1166|consensus | 974 | 98.37 | ||
| KOG1033|consensus | 516 | 98.36 | ||
| PRK10359 | 232 | lipopolysaccharide core biosynthesis protein; Prov | 98.31 | |
| KOG0603|consensus | 612 | 98.28 | ||
| cd05146 | 197 | RIO3_euk RIO kinase family; eukaryotic RIO3, catal | 98.15 | |
| KOG0606|consensus | 1205 | 98.09 | ||
| PF14531 | 288 | Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ | 98.04 | |
| cd05120 | 155 | APH_ChoK_like Aminoglycoside 3'-phosphotransferase | 98.02 | |
| PF06293 | 206 | Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; | 98.0 | |
| PRK15123 | 268 | lipopolysaccharide core heptose(I) kinase RfaP; Pr | 97.99 | |
| COG3642 | 204 | Mn2+-dependent serine/threonine protein kinase [Si | 97.97 | |
| KOG3087|consensus | 229 | 97.85 | ||
| cd05151 | 170 | ChoK Choline Kinase (ChoK). The ChoK subfamily is | 97.76 | |
| KOG1240|consensus | 1431 | 97.68 | ||
| TIGR01982 | 437 | UbiB 2-polyprenylphenol 6-hydroxylase. This model | 97.47 | |
| KOG0590|consensus | 601 | 97.4 | ||
| PF01163 | 188 | RIO1: RIO1 family; InterPro: IPR018934 Protein pho | 97.38 | |
| KOG3741|consensus | 655 | 97.37 | ||
| PRK09902 | 216 | hypothetical protein; Provisional | 97.34 | |
| KOG0601|consensus | 524 | 97.04 | ||
| KOG1023|consensus | 484 | 96.88 | ||
| COG4248 | 637 | Uncharacterized protein with protein kinase and he | 96.74 | |
| PF06176 | 229 | WaaY: Lipopolysaccharide core biosynthesis protein | 96.38 | |
| PRK04750 | 537 | ubiB putative ubiquinone biosynthesis protein UbiB | 95.71 | |
| COG0478 | 304 | RIO-like serine/threonine protein kinase fused to | 95.52 | |
| PF12260 | 188 | PIP49_C: Protein-kinase domain of FAM69; InterPro: | 94.63 | |
| KOG1243|consensus | 690 | 94.55 | ||
| KOG1266|consensus | 458 | 94.29 | ||
| COG1718 | 268 | RIO1 Serine/threonine protein kinase involved in c | 92.74 | |
| KOG0601|consensus | 524 | 91.71 | ||
| cd05154 | 223 | ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an | 90.84 | |
| PRK05231 | 319 | homoserine kinase; Provisional | 90.54 | |
| cd05155 | 235 | APH_ChoK_like_1 Uncharacterized bacterial proteins | 90.3 | |
| COG5072 | 488 | ALK1 Serine/threonine kinase of the haspin family | 89.96 | |
| KOG2137|consensus | 700 | 87.41 | ||
| cd05156 | 302 | ChoK_euk Choline Kinase (ChoK) in eukaryotes. The | 87.3 | |
| TIGR00938 | 307 | thrB_alt homoserine kinase, Neisseria type. Homose | 87.27 | |
| cd05157 | 235 | ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. | 87.03 | |
| cd05153 | 296 | HomoserineK_II Homoserine Kinase, type II. Homoser | 86.65 | |
| TIGR02906 | 313 | spore_CotS spore coat protein, CotS family. Member | 86.38 | |
| PF01636 | 239 | APH: Phosphotransferase enzyme family This family | 86.22 | |
| cd05150 | 244 | APH Aminoglycoside 3'-phosphotransferase (APH). Th | 85.63 | |
| COG2334 | 331 | Putative homoserine kinase type II (protein kinase | 85.56 | |
| COG3173 | 321 | Predicted aminoglycoside phosphotransferase [Gener | 85.03 | |
| KOG2268|consensus | 465 | 84.85 | ||
| TIGR02172 | 226 | Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou | 84.26 | |
| PRK06149 | 972 | hypothetical protein; Provisional | 81.03 | |
| TIGR02721 | 256 | ycfN_thiK thiamine kinase. Members of this family | 80.66 | |
| COG0510 | 269 | ycfN Thiamine kinase and related kinases [Coenzyme | 80.49 | |
| PF13095 | 207 | FTA2: Kinetochore Sim4 complex subunit FTA2 | 80.32 | |
| cd05152 | 276 | MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH | 80.15 |
| >KOG0598|consensus | Back alignment and domain information |
|---|
Probab=99.83 E-value=1.2e-20 Score=105.75 Aligned_cols=78 Identities=37% Similarity=0.536 Sum_probs=71.5
Q ss_pred cccccCCHHHHHHHHHHHHHHHHHHHhCCcEeccCCCCcEEeCCCCCEEEeeecceEEecCCCCCcccccccCcccCC
Q psy2485 8 ETEQYLDERFIWKVLYQLSKALQVCHSSCILHRDIKPANVFLDENNNVKLGDFGLARILNMNESHSYTLVGTPYYMSP 85 (85)
Q Consensus 8 ~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~l~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~y~ap 85 (85)
++.+.++|..+..++.+++.|+.|+|+.+++|||+||+||+++..+.+++.|||+++..........++|||+.||||
T Consensus 117 ~~eg~F~E~~arfYlaEi~lAL~~LH~~gIiyRDlKPENILLd~~GHi~LtDFgL~k~~~~~~~~t~tfcGT~eYmAP 194 (357)
T KOG0598|consen 117 QREGRFSEDRARFYLAEIVLALGYLHSKGIIYRDLKPENILLDEQGHIKLTDFGLCKEDLKDGDATRTFCGTPEYMAP 194 (357)
T ss_pred HhcCCcchhHHHHHHHHHHHHHHHHHhCCeeeccCCHHHeeecCCCcEEEeccccchhcccCCCccccccCCccccCh
Confidence 345678999999999999999999999999999999999999999999999999999877666666778999999998
|
|
| >KOG0616|consensus | Back alignment and domain information |
|---|
| >KOG0595|consensus | Back alignment and domain information |
|---|
| >KOG0615|consensus | Back alignment and domain information |
|---|
| >KOG0694|consensus | Back alignment and domain information |
|---|
| >KOG0593|consensus | Back alignment and domain information |
|---|
| >KOG0583|consensus | Back alignment and domain information |
|---|
| >KOG0661|consensus | Back alignment and domain information |
|---|
| >KOG0575|consensus | Back alignment and domain information |
|---|
| >KOG0581|consensus | Back alignment and domain information |
|---|
| >KOG0594|consensus | Back alignment and domain information |
|---|
| >KOG0578|consensus | Back alignment and domain information |
|---|
| >KOG0591|consensus | Back alignment and domain information |
|---|
| >KOG0600|consensus | Back alignment and domain information |
|---|
| >KOG0599|consensus | Back alignment and domain information |
|---|
| >KOG0198|consensus | Back alignment and domain information |
|---|
| >KOG0663|consensus | Back alignment and domain information |
|---|
| >KOG0659|consensus | Back alignment and domain information |
|---|
| >KOG0611|consensus | Back alignment and domain information |
|---|
| >KOG0592|consensus | Back alignment and domain information |
|---|
| >KOG0585|consensus | Back alignment and domain information |
|---|
| >KOG0986|consensus | Back alignment and domain information |
|---|
| >KOG0588|consensus | Back alignment and domain information |
|---|
| >KOG0192|consensus | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >KOG0589|consensus | Back alignment and domain information |
|---|
| >KOG0579|consensus | Back alignment and domain information |
|---|
| >KOG0582|consensus | Back alignment and domain information |
|---|
| >cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >KOG0033|consensus | Back alignment and domain information |
|---|
| >cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >KOG0597|consensus | Back alignment and domain information |
|---|
| >cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0614|consensus | Back alignment and domain information |
|---|
| >cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >KOG0660|consensus | Back alignment and domain information |
|---|
| >cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >KOG0658|consensus | Back alignment and domain information |
|---|
| >cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 | Back alignment and domain information |
|---|
| >cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >KOG0032|consensus | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PHA02882 putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0604|consensus | Back alignment and domain information |
|---|
| >KOG0695|consensus | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0201|consensus | Back alignment and domain information |
|---|
| >cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0580|consensus | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG4236|consensus | Back alignment and domain information |
|---|
| >cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 | Back alignment and domain information |
|---|
| >cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG1187|consensus | Back alignment and domain information |
|---|
| >cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >KOG0662|consensus | Back alignment and domain information |
|---|
| >KOG0667|consensus | Back alignment and domain information |
|---|
| >cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >KOG0577|consensus | Back alignment and domain information |
|---|
| >cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >KOG0193|consensus | Back alignment and domain information |
|---|
| >cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >KOG4721|consensus | Back alignment and domain information |
|---|
| >cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >KOG0983|consensus | Back alignment and domain information |
|---|
| >cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >KOG0666|consensus | Back alignment and domain information |
|---|
| >cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 | Back alignment and domain information |
|---|
| >KOG0665|consensus | Back alignment and domain information |
|---|
| >KOG4717|consensus | Back alignment and domain information |
|---|
| >KOG4250|consensus | Back alignment and domain information |
|---|
| >KOG0587|consensus | Back alignment and domain information |
|---|
| >KOG0586|consensus | Back alignment and domain information |
|---|
| >KOG0584|consensus | Back alignment and domain information |
|---|
| >cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0984|consensus | Back alignment and domain information |
|---|
| >cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >KOG1035|consensus | Back alignment and domain information |
|---|
| >PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >KOG1165|consensus | Back alignment and domain information |
|---|
| >cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >KOG0574|consensus | Back alignment and domain information |
|---|
| >cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 | Back alignment and domain information |
|---|
| >KOG4279|consensus | Back alignment and domain information |
|---|
| >cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >KOG3653|consensus | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl | Back alignment and domain information |
|---|
| >cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >KOG1989|consensus | Back alignment and domain information |
|---|
| >cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 | Back alignment and domain information |
|---|
| >cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases | Back alignment and domain information |
|---|
| >cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase | Back alignment and domain information |
|---|
| >cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >PLN00009 cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >KOG2052|consensus | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >KOG1152|consensus | Back alignment and domain information |
|---|
| >cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >KOG4645|consensus | Back alignment and domain information |
|---|
| >cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein | Back alignment and domain information |
|---|
| >cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >KOG0669|consensus | Back alignment and domain information |
|---|
| >cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 | Back alignment and domain information |
|---|
| >cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase | Back alignment and domain information |
|---|
| >cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >PHA03390 pk1 serine/threonine-protein kinase 1; Provisional | Back alignment and domain information |
|---|
| >cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >smart00219 TyrKc Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >KOG0605|consensus | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 | Back alignment and domain information |
|---|
| >cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 | Back alignment and domain information |
|---|
| >cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >KOG1164|consensus | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins | Back alignment and domain information |
|---|
| >cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 | Back alignment and domain information |
|---|
| >KOG0194|consensus | Back alignment and domain information |
|---|
| >cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 | Back alignment and domain information |
|---|
| >cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG0596|consensus | Back alignment and domain information |
|---|
| >KOG0664|consensus | Back alignment and domain information |
|---|
| >cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 | Back alignment and domain information |
|---|
| >cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >KOG0603|consensus | Back alignment and domain information |
|---|
| >cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >KOG0610|consensus | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes | Back alignment and domain information |
|---|
| >cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 | Back alignment and domain information |
|---|
| >KOG0576|consensus | Back alignment and domain information |
|---|
| >cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >cd05122 PKc_STE Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >KOG0671|consensus | Back alignment and domain information |
|---|
| >PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >KOG0607|consensus | Back alignment and domain information |
|---|
| >cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >KOG1027|consensus | Back alignment and domain information |
|---|
| >KOG0608|consensus | Back alignment and domain information |
|---|
| >cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >smart00750 KIND kinase non-catalytic C-lobe domain | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta | Back alignment and domain information |
|---|
| >cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain | Back alignment and domain information |
|---|
| >cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >KOG1163|consensus | Back alignment and domain information |
|---|
| >cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain | Back alignment and domain information |
|---|
| >KOG2345|consensus | Back alignment and domain information |
|---|
| >KOG1006|consensus | Back alignment and domain information |
|---|
| >cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >KOG1151|consensus | Back alignment and domain information |
|---|
| >KOG1345|consensus | Back alignment and domain information |
|---|
| >KOG0668|consensus | Back alignment and domain information |
|---|
| >smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >KOG1026|consensus | Back alignment and domain information |
|---|
| >KOG1095|consensus | Back alignment and domain information |
|---|
| >cd00180 PKc Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >KOG0200|consensus | Back alignment and domain information |
|---|
| >PRK12274 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0670|consensus | Back alignment and domain information |
|---|
| >KOG0590|consensus | Back alignment and domain information |
|---|
| >COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG4257|consensus | Back alignment and domain information |
|---|
| >smart00221 STYKc Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >smart00090 RIO RIO-like kinase | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >KOG1094|consensus | Back alignment and domain information |
|---|
| >PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1025|consensus | Back alignment and domain information |
|---|
| >cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >cd05119 RIO RIO kinase family, catalytic domain | Back alignment and domain information |
|---|
| >KOG1167|consensus | Back alignment and domain information |
|---|
| >PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated | Back alignment and domain information |
|---|
| >PRK14879 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10345 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1290|consensus | Back alignment and domain information |
|---|
| >TIGR03724 arch_bud32 Kae1-associated kinase Bud32 | Back alignment and domain information |
|---|
| >KOG1024|consensus | Back alignment and domain information |
|---|
| >KOG4158|consensus | Back alignment and domain information |
|---|
| >KOG1166|consensus | Back alignment and domain information |
|---|
| >KOG1033|consensus | Back alignment and domain information |
|---|
| >PRK10359 lipopolysaccharide core biosynthesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG0603|consensus | Back alignment and domain information |
|---|
| >cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A | Back alignment and domain information |
|---|
| >cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family | Back alignment and domain information |
|---|
| >PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional | Back alignment and domain information |
|---|
| >COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3087|consensus | Back alignment and domain information |
|---|
| >cd05151 ChoK Choline Kinase (ChoK) | Back alignment and domain information |
|---|
| >KOG1240|consensus | Back alignment and domain information |
|---|
| >TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase | Back alignment and domain information |
|---|
| >KOG0590|consensus | Back alignment and domain information |
|---|
| >PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >KOG3741|consensus | Back alignment and domain information |
|---|
| >PRK09902 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0601|consensus | Back alignment and domain information |
|---|
| >KOG1023|consensus | Back alignment and domain information |
|---|
| >COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] | Back alignment and domain information |
|---|
| >PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) | Back alignment and domain information |
|---|
| >PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed | Back alignment and domain information |
|---|
| >COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) | Back alignment and domain information |
|---|
| >KOG1243|consensus | Back alignment and domain information |
|---|
| >KOG1266|consensus | Back alignment and domain information |
|---|
| >COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0601|consensus | Back alignment and domain information |
|---|
| >cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins | Back alignment and domain information |
|---|
| >PRK05231 homoserine kinase; Provisional | Back alignment and domain information |
|---|
| >cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members | Back alignment and domain information |
|---|
| >COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2137|consensus | Back alignment and domain information |
|---|
| >cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00938 thrB_alt homoserine kinase, Neisseria type | Back alignment and domain information |
|---|
| >cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes | Back alignment and domain information |
|---|
| >cd05153 HomoserineK_II Homoserine Kinase, type II | Back alignment and domain information |
|---|
| >TIGR02906 spore_CotS spore coat protein, CotS family | Back alignment and domain information |
|---|
| >PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily | Back alignment and domain information |
|---|
| >cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) | Back alignment and domain information |
|---|
| >COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only] | Back alignment and domain information |
|---|
| >COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2268|consensus | Back alignment and domain information |
|---|
| >TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 | Back alignment and domain information |
|---|
| >PRK06149 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02721 ycfN_thiK thiamine kinase | Back alignment and domain information |
|---|
| >COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 | Back alignment and domain information |
|---|
| >cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 85 | ||||
| 2w5a_A | 279 | Human Nek2 Kinase Adp-Bound Length = 279 | 6e-24 | ||
| 4a4x_A | 279 | Nek2-Ede Bound To Cct248662 Length = 279 | 2e-23 | ||
| 2jav_A | 279 | Human Kinase With Pyrrole-Indolinone Ligand Length | 2e-23 | ||
| 2wqm_A | 310 | Structure Of Apo Human Nek7 Length = 310 | 5e-18 | ||
| 4apc_A | 350 | Crystal Structure Of Human Nima-Related Kinase 1 (N | 1e-13 | ||
| 3ckw_A | 304 | Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 | 3e-12 | ||
| 3zhp_C | 294 | Human Mst3 (stk24) In Complex With Mo25beta Length | 3e-12 | ||
| 1f3m_C | 297 | Crystal Structure Of Human SerineTHREONINE KINASE P | 3e-12 | ||
| 2xik_A | 294 | Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K | 5e-12 | ||
| 1zyc_A | 303 | Crystal Structure Of Eif2alpha Protein Kinase Gcn2: | 8e-12 | ||
| 1zy4_A | 303 | Crystal Structure Of Eif2alpha Protein Kinase Gcn2: | 8e-12 | ||
| 3ggf_A | 301 | Crystal Structure Of Human SerineTHREONINE-Protein | 1e-11 | ||
| 3ckx_A | 304 | Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 | 1e-11 | ||
| 3a7f_A | 303 | Human Mst3 Kinase Length = 303 | 1e-11 | ||
| 3q4z_A | 306 | Structure Of Unphosphorylated Pak1 Kinase Domain Le | 1e-11 | ||
| 3q52_A | 306 | Structure Of Phosphorylated Pak1 Kinase Domain Leng | 2e-11 | ||
| 3fxz_A | 297 | Crystal Structure Of Pak1 Kinase Domain With Ruthen | 2e-11 | ||
| 1yhv_A | 297 | Crystal Structure Of Pak1 Kinase Domain With Two Po | 2e-11 | ||
| 2i6l_A | 320 | Crystal Structure Of Human Mitogen Activated Protei | 5e-11 | ||
| 3cok_A | 278 | Crystal Structure Of Plk4 Kinase Length = 278 | 8e-11 | ||
| 4ic7_A | 442 | Crystal Structure Of The Erk5 Kinase Domain In Comp | 9e-11 | ||
| 4h3q_A | 362 | Crystal Structure Of Human Erk2 Complexed With A Ma | 9e-11 | ||
| 3sa0_A | 360 | Complex Of Erk2 With Norathyriol Length = 360 | 1e-10 | ||
| 1h4l_A | 292 | Structure And Regulation Of The Cdk5-P25(Nck5a) Com | 1e-10 | ||
| 4b99_A | 398 | Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le | 1e-10 | ||
| 4gsb_A | 364 | Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 | 1e-10 | ||
| 4fv7_A | 360 | Crystal Structure Of The Erk2 Complexed With E94 Le | 1e-10 | ||
| 4fux_A | 360 | Crystal Structure Of The Erk2 Complexed With E75 Le | 1e-10 | ||
| 2pk9_A | 317 | Structure Of The Pho85-pho80 Cdk-cyclin Complex Of | 1e-10 | ||
| 1pme_A | 380 | Structure Of Penta Mutant Human Erk2 Map Kinase Com | 1e-10 | ||
| 3qyw_A | 364 | Crystal Structure Of Erk2 In Complex With An Inhibi | 1e-10 | ||
| 2x7f_A | 326 | Crystal Structure Of The Kinase Domain Of Human Tra | 2e-10 | ||
| 1zxe_A | 303 | Crystal Structure Of Eif2alpha Protein Kinase Gcn2: | 2e-10 | ||
| 3tei_A | 362 | Crystal Structure Of Human Erk2 Complexed With A Ma | 2e-10 | ||
| 2ojg_A | 380 | Crystal Structure Of Erk2 In Complex With N,n-dimet | 2e-10 | ||
| 2y9q_A | 362 | Crystal Structure Of Human Erk2 Complexed With A Ma | 2e-10 | ||
| 1wzy_A | 368 | Crystal Structure Of Human Erk2 Complexed With A Py | 2e-10 | ||
| 1tvo_A | 368 | The Structure Of Erk2 In Complex With A Small Molec | 2e-10 | ||
| 3r63_A | 358 | Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 | 2e-10 | ||
| 4fv6_A | 360 | Crystal Structure Of The Erk2 Complexed With E57 Le | 2e-10 | ||
| 3zu7_A | 365 | Crystal Structure Of A Designed Selected Ankyrin Re | 2e-10 | ||
| 2z7l_A | 366 | Unphosphorylated Mitogen Activated Protein Kinase E | 2e-10 | ||
| 3c9w_A | 357 | Crystal Structure Of Erk-2 With Hypothemycin Covale | 2e-10 | ||
| 2fys_B | 364 | Crystal Structure Of Erk2 Complex With Kim Peptide | 2e-10 | ||
| 1gol_A | 364 | Coordinates Of Rat Map Kinase Erk2 With An Arginine | 2e-10 | ||
| 2gph_A | 364 | Docking Motif Interactions In The Map Kinase Erk2 L | 2e-10 | ||
| 3o71_A | 358 | Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length | 2e-10 | ||
| 3zuv_A | 364 | Crystal Structure Of A Designed Selected Ankyrin Re | 2e-10 | ||
| 2erk_A | 365 | Phosphorylated Map Kinase Erk2 Length = 365 | 2e-10 | ||
| 3mfr_A | 351 | Cask-4m Cam Kinase Domain, Native Length = 351 | 2e-10 | ||
| 3d5u_A | 317 | Crystal Structure Of A Wildtype Polo-Like Kinase 1 | 3e-10 | ||
| 3ubd_A | 304 | Structure Of N-Terminal Domain Of Rsk2 Kinase In Co | 4e-10 | ||
| 4el9_A | 305 | Structure Of N-Terminal Kinase Domain Of Rsk2 With | 4e-10 | ||
| 3g51_A | 325 | Structural Diversity Of The Active Conformation Of | 4e-10 | ||
| 1ung_A | 292 | Structural Mechanism For The Inhibition Of Cdk5-P25 | 4e-10 | ||
| 3qd2_B | 332 | Crsytal Structure Of Mouse Perk Kinase Domain Lengt | 5e-10 | ||
| 3uiu_A | 306 | Crystal Structure Of Apo-Pkr Kinase Domain Length = | 6e-10 | ||
| 4g31_A | 299 | Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 | 6e-10 | ||
| 2zoq_A | 382 | Structural Dissection Of Human Mitogen-Activated Ki | 8e-10 | ||
| 2yac_A | 311 | Crystal Structure Of Polo-Like Kinase 1 In Complex | 9e-10 | ||
| 4aaa_A | 331 | Crystal Structure Of The Human Cdkl2 Kinase Domain | 9e-10 | ||
| 3kb7_A | 311 | Crystal Structure Of Polo-Like Kinase 1 In Complex | 9e-10 | ||
| 2v5q_A | 315 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 1e-09 | ||
| 2z7q_A | 321 | Crystal Structure Of The N-Terminal Kinase Domain O | 1e-09 | ||
| 2x4z_A | 296 | Crystal Structure Of The Human P21-Activated Kinase | 1e-09 | ||
| 2q0n_A | 301 | Structure Of Human P21 Activating Kinase 4 (Pak4) I | 1e-09 | ||
| 2cdz_A | 303 | Crystal Structure Of The Human P21-Activated Kinase | 1e-09 | ||
| 2bva_A | 292 | Crystal Structure Of The Human P21-Activated Kinase | 1e-09 | ||
| 3h4j_B | 336 | Crystal Structure Of Pombe Ampk Kdaid Fragment Leng | 1e-09 | ||
| 3d5w_A | 317 | Crystal Structure Of A Phosphorylated Polo-Like Kin | 1e-09 | ||
| 3dae_A | 283 | Crystal Structure Of Phosphorylated Snf1 Kinase Dom | 1e-09 | ||
| 3d5v_A | 317 | Crystal Structure Of An Activated (Thr->asp) Polo-L | 2e-09 | ||
| 3db6_A | 301 | Crystal Structure Of An Activated (Thr->asp) Polo-L | 2e-09 | ||
| 3hyh_A | 275 | Crystal Structure Of The Protein Kinase Domain Of Y | 2e-09 | ||
| 3mn3_A | 271 | An Inhibited Conformation For The Protein Kinase Do | 2e-09 | ||
| 2fh9_A | 274 | Structure And Dimerization Of The Kinase Domain Fro | 2e-09 | ||
| 3rp9_A | 458 | Crystal Structure Of The Apo Mapk From Toxoplasma G | 2e-09 | ||
| 4fie_A | 423 | Full-Length Human Pak4 Length = 423 | 2e-09 | ||
| 3gc9_A | 370 | The Structure Of P38beta C119s, C162s In Complex Wi | 2e-09 | ||
| 4fif_A | 346 | Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid | 2e-09 | ||
| 3gc8_A | 370 | The Structure Of P38beta C162s In Complex With A Di | 2e-09 | ||
| 2b9h_A | 353 | Crystal Structure Of Fus3 With A Docking Motif From | 3e-09 | ||
| 2a19_B | 284 | Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng | 3e-09 | ||
| 1fot_A | 318 | Structure Of The Unliganded Camp-Dependent Protein | 3e-09 | ||
| 2f2u_A | 402 | Crystal Structure Of The Rho-Kinase Kinase Domain L | 3e-09 | ||
| 2rku_A | 294 | Structure Of Plk1 In Complex With Bi2536 Length = 2 | 3e-09 | ||
| 2b9f_A | 353 | Crystal Structure Of Non-Phosphorylated Fus3 Length | 3e-09 | ||
| 2f9g_A | 353 | Crystal Structure Of Fus3 Phosphorylated On Tyr182 | 3e-09 | ||
| 2ou7_A | 335 | Structure Of The Catalytic Domain Of Human Polo-Lik | 3e-09 | ||
| 3g33_A | 308 | Crystal Structure Of Cdk4CYCLIN D3 Length = 308 | 3e-09 | ||
| 3thb_A | 333 | Structure Of Plk1 Kinase Domain In Complex With A B | 4e-09 | ||
| 2jgz_A | 289 | Crystal Structure Of Phospho-Cdk2 In Complex With C | 4e-09 | ||
| 1w98_A | 298 | The Structural Basis Of Cdk2 Activation By Cyclin E | 4e-09 | ||
| 4i3z_A | 296 | Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES | 4e-09 | ||
| 1jst_A | 298 | Phosphorylated Cyclin-Dependent Kinase-2 Bound To C | 4e-09 | ||
| 4eoq_A | 301 | Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co | 4e-09 | ||
| 4bcq_A | 301 | Structure Of Cdk2 In Complex With Cyclin A And A 2- | 4e-09 | ||
| 1e9h_A | 297 | Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex | 4e-09 | ||
| 3qhr_A | 298 | Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic | 4e-09 | ||
| 1qmz_A | 299 | Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com | 4e-09 | ||
| 4eon_A | 300 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum | 4e-09 | ||
| 4eoj_A | 302 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma | 4e-09 | ||
| 3bht_A | 300 | Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN | 4e-09 | ||
| 4eoo_A | 299 | Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 | 4e-09 | ||
| 1ogu_A | 302 | Structure Of Human Thr160-phospho Cdk2/cyclin A Com | 4e-09 | ||
| 3d14_A | 272 | Crystal Structure Of Mouse Aurora A (Asn186->gly, L | 4e-09 | ||
| 2iw6_A | 302 | Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com | 4e-09 | ||
| 4eos_A | 300 | Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co | 4e-09 | ||
| 4eom_A | 301 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum | 4e-09 | ||
| 4eok_A | 300 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma | 4e-09 | ||
| 3mtl_A | 324 | Crystal Structure Of The Pctaire1 Kinase In Complex | 4e-09 | ||
| 1oit_A | 299 | Imidazopyridines: A Potent And Selective Class Of C | 4e-09 | ||
| 1h1p_A | 303 | Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP | 4e-09 | ||
| 4eoi_A | 299 | Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc | 4e-09 | ||
| 4eop_A | 300 | Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 | 5e-09 | ||
| 2iw8_A | 302 | Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 | 5e-09 | ||
| 2y94_A | 476 | Structure Of An Active Form Of Mammalian Ampk Lengt | 5e-09 | ||
| 3ezr_A | 300 | Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ | 5e-09 | ||
| 1oir_A | 299 | Imidazopyridines: A Potent And Selective Class Of C | 5e-09 | ||
| 1h01_A | 298 | Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili | 5e-09 | ||
| 1gii_A | 298 | Human Cyclin Dependent Kinase 2 Complexed With The | 5e-09 | ||
| 2w17_A | 299 | Cdk2 In Complex With The Imidazole Pyrimidine Amide | 5e-09 | ||
| 1fin_A | 298 | Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = | 5e-09 | ||
| 3t8o_A | 543 | Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu | 5e-09 | ||
| 3qc9_A | 543 | Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 | 5e-09 | ||
| 3pxf_A | 306 | Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N | 5e-09 | ||
| 3c4x_A | 543 | Crystal Structure Of G Protein Coupled Receptor Kin | 5e-09 | ||
| 3c4w_A | 543 | Crystal Structure Of G Protein Coupled Receptor Kin | 5e-09 | ||
| 3pj8_A | 299 | Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] | 5e-09 | ||
| 3c4c_A | 280 | B-Raf Kinase In Complex With Plx4720 Length = 280 | 5e-09 | ||
| 1u5q_A | 348 | Crystal Structure Of The Tao2 Kinase Domain: Activa | 6e-09 | ||
| 3nie_A | 429 | Crystal Structure Of Pf11_0147 Length = 429 | 6e-09 | ||
| 2w9f_B | 306 | Crystal Structure Of Cdk4 In Complex With A D-Type | 6e-09 | ||
| 3is5_A | 285 | Crystal Structure Of Cdpk Kinase Domain From Toxopl | 7e-09 | ||
| 3daj_A | 272 | Crystal Structure Of Aurora A Complexed With An Inh | 7e-09 | ||
| 3nax_A | 311 | Pdk1 In Complex With Inhibitor Mp7 Length = 311 | 7e-09 | ||
| 4erw_A | 306 | Cdk2 In Complex With Staurosporine Length = 306 | 7e-09 | ||
| 2gcd_A | 309 | Tao2 Kinase Domain-Staurosporine Structure Length = | 7e-09 | ||
| 1vyw_A | 309 | Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = | 7e-09 | ||
| 3gp0_A | 348 | Crystal Structure Of Human Mitogen Activated Protei | 7e-09 | ||
| 1pf8_A | 298 | Crystal Structure Of Human Cyclin-dependent Kinase | 7e-09 | ||
| 1gz8_A | 299 | Human Cyclin Dependent Kinase 2 Complexed With The | 8e-09 | ||
| 2y7j_A | 365 | Structure Of Human Phosphorylase Kinase, Gamma 2 Le | 8e-09 | ||
| 3niz_A | 311 | Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 | 8e-09 | ||
| 2r7b_A | 312 | Crystal Structure Of The Phosphoinositide-Dependent | 8e-09 | ||
| 2w99_B | 306 | Crystal Structure Of Cdk4 In Complex With A D-Type | 8e-09 | ||
| 2qkr_A | 313 | Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 | 9e-09 | ||
| 1ql6_A | 298 | The Catalytic Mechanism Of Phosphorylase Kinase Pro | 9e-09 | ||
| 3pwy_A | 311 | Crystal Structure Of An Extender (Spd28345)-Modifie | 9e-09 | ||
| 1ove_A | 366 | The Structure Of P38 Alpha In Complex With A Dihydr | 1e-08 | ||
| 2j51_A | 325 | Crystal Structure Of Human Ste20-Like Kinase Bound | 1e-08 | ||
| 2c30_A | 321 | Crystal Structure Of The Human P21-Activated Kinase | 1e-08 | ||
| 3orm_A | 311 | Mycobacterium Tuberculosis Pknb Kinase Domain D76a | 1e-08 | ||
| 3ori_A | 311 | Mycobacterium Tuberculosis Pknb Kinase Domain L33d | 1e-08 | ||
| 3f61_A | 311 | Crystal Structure Of M. Tuberculosis Pknb Leu33aspV | 1e-08 | ||
| 1o6y_A | 299 | Catalytic Domain Of Pknb Kinase From Mycobacterium | 1e-08 | ||
| 1mru_A | 311 | Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob | 1e-08 | ||
| 2y8o_A | 362 | Crystal Structure Of Human P38alpha Complexed With | 1e-08 | ||
| 4agu_A | 311 | Crystal Structure Of The Human Cdkl1 Kinase Domain | 1e-08 | ||
| 2f57_A | 317 | Crystal Structure Of The Human P21-activated Kinase | 1e-08 | ||
| 2w0j_A | 323 | Crystal Structure Of Chk2 In Complex With Nsc 10955 | 1e-08 | ||
| 4a07_A | 311 | Human Pdk1 Kinase Domain In Complex With Allosteric | 1e-08 | ||
| 2ycf_A | 322 | Crystal Structure Of Checkpoint Kinase 2 In Complex | 1e-08 | ||
| 3hrc_A | 311 | Crystal Structure Of A Mutant Of Human Pdk1 Kinase | 1e-08 | ||
| 3n9x_A | 432 | Crystal Structure Of Map Kinase From Plasmodium Ber | 1e-08 | ||
| 2w96_B | 306 | Crystal Structure Of Cdk4 In Complex With A D-Type | 1e-08 | ||
| 2vwi_A | 303 | Structure Of The Osr1 Kinase, A Hypertension Drug T | 1e-08 | ||
| 2ycr_A | 323 | Crystal Structure Of Checkpoint Kinase 2 In Complex | 1e-08 | ||
| 2xk9_A | 322 | Structural Analysis Of Checkpoint Kinase 2 (Chk2) I | 1e-08 | ||
| 2h6d_A | 276 | Protein Kinase Domain Of The Human 5'-Amp-Activated | 1e-08 | ||
| 3qc4_A | 314 | Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = | 1e-08 | ||
| 2cn5_A | 329 | Crystal Structure Of Human Chk2 In Complex With Adp | 1e-08 | ||
| 1bi8_A | 326 | Mechanism Of G1 Cyclin Dependent Kinase Inhibition | 1e-08 | ||
| 2biy_A | 310 | Structure Of Pdk1-S241a Mutant Kinase Domain Length | 1e-08 | ||
| 2jfm_A | 325 | Crystal Structure Of Human Ste20-Like Kinase (Unlig | 1e-08 | ||
| 3dak_A | 290 | Crystal Structure Of Domain-Swapped Osr1 Kinase Dom | 1e-08 | ||
| 1jow_B | 308 | Crystal Structure Of A Complex Of Human Cdk6 And A | 1e-08 | ||
| 3nup_A | 307 | Cdk6 (Monomeric) In Complex With Inhibitor Length = | 1e-08 | ||
| 3iop_A | 312 | Pdk-1 In Complex With The Inhibitor Compound-8i Len | 1e-08 | ||
| 3d83_A | 360 | Crystal Structure Of P38 Kinase In Complex With A B | 1e-08 | ||
| 3sc1_A | 311 | Novel Isoquinolone Pdk1 Inhibitors Discovered Throu | 1e-08 | ||
| 3h9o_A | 311 | Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) | 1e-08 | ||
| 3orx_A | 316 | Pdk1 Mutant Bound To Allosteric Disulfide Fragment | 1e-08 | ||
| 1phk_A | 298 | Two Structures Of The Catalytic Domain Of Phosphory | 2e-08 | ||
| 2bal_A | 365 | P38alpha Map Kinase Bound To Pyrazoloamine Length = | 2e-08 | ||
| 1uu3_A | 310 | Structure Of Human Pdk1 Kinase Domain In Complex Wi | 2e-08 | ||
| 2xck_A | 309 | Crystal Structure Of Pdk1 In Complex With A Pyrazol | 2e-08 | ||
| 3rwp_A | 311 | Discovery Of A Novel, Potent And Selective Inhibito | 2e-08 | ||
| 2xch_A | 309 | Crystal Structure Of Pdk1 In Complex With A Pyrazol | 2e-08 | ||
| 3e92_A | 371 | Crystal Structure Of P38 Kinase In Complex With A B | 2e-08 | ||
| 2phk_A | 277 | The Crystal Structure Of A Phosphorylase Kinase Pep | 2e-08 | ||
| 2baq_A | 365 | P38alpha Bound To Ro3201195 Length = 365 | 2e-08 | ||
| 1h1w_A | 289 | High Resolution Crystal Structure Of The Human Pdk1 | 2e-08 | ||
| 1z5m_A | 286 | Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr | 2e-08 | ||
| 3tac_A | 361 | Crystal Structure Of The Liprin-AlphaCASK COMPLEX L | 2e-08 | ||
| 1uu9_A | 286 | Structure Of Human Pdk1 Kinase Domain In Complex Wi | 2e-08 | ||
| 3nus_A | 286 | Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra | 2e-08 | ||
| 3f69_A | 311 | Crystal Structure Of The Mycobacterium Tuberculosis | 2e-08 | ||
| 3i6w_A | 443 | Structure And Activation Mechanism Of The Chk2 Dna- | 2e-08 | ||
| 3c0g_A | 351 | Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len | 2e-08 | ||
| 3og7_A | 289 | B-Raf Kinase V600e Oncogenic Mutant In Complex With | 2e-08 | ||
| 2zv2_A | 298 | Crystal Structure Of Human CalciumCALMODULIN-Depend | 2e-08 | ||
| 3nun_A | 292 | Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea | 2e-08 | ||
| 2jfl_A | 325 | Crystal Structure Of Human Ste20-Like Kinase ( Diph | 2e-08 | ||
| 3i6u_A | 419 | Structure And Activation Mechanism Of The Chk2 Dna- | 2e-08 | ||
| 4fk3_A | 292 | B-Raf Kinase V600e Oncogenic Mutant In Complex With | 2e-08 | ||
| 2wtw_A | 285 | Aurora-A Inhibitor Structure (2nd Crystal Form) Len | 2e-08 | ||
| 3nay_A | 311 | Pdk1 In Complex With Inhibitor Mp6 Length = 311 | 2e-08 | ||
| 2x6d_A | 285 | Aurora-A Bound To An Inhibitor Length = 285 | 2e-08 | ||
| 1muo_A | 297 | Crystal Structure Of Aurora-2, An Oncogenic Serine- | 2e-08 | ||
| 2j4z_A | 306 | Structure Of Aurora-2 In Complex With Pha-680626 Le | 2e-08 | ||
| 2xng_A | 283 | Structure Of Aurora-A Bound To A Selective Imidazop | 2e-08 | ||
| 2j50_A | 280 | Structure Of Aurora-2 In Complex With Pha-739358 Le | 2e-08 | ||
| 4ewq_A | 383 | Human P38 Alpha Mapk In Complex With A Pyridazine B | 3e-08 | ||
| 1mq4_A | 272 | Crystal Structure Of Aurora-A Protein Kinase Length | 3e-08 | ||
| 3o50_A | 267 | Crystal Structure Of Benzamide 9 Bound To Auroraa L | 3e-08 | ||
| 4ft3_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 3e-08 | ||
| 4fsz_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 3e-08 | ||
| 2w1d_A | 275 | Structure Determination Of Aurora Kinase In Complex | 3e-08 | ||
| 4e5a_X | 360 | The W197a Mutant Of P38a Map Kinase Length = 360 | 3e-08 | ||
| 3ody_X | 360 | Crystal Structure Of P38alpha Y323q Active Mutant L | 3e-08 | ||
| 3d7z_A | 360 | Crystal Structure Of P38 Kinase In Complex With A B | 3e-08 | ||
| 1m7q_A | 366 | Crystal Structure Of P38 Map Kinase In Complex With | 3e-08 | ||
| 3vum_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M7 | 3e-08 | ||
| 3vul_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M1 | 3e-08 | ||
| 1oz1_A | 372 | P38 Mitogen-Activated Kinase In Complex With 4-Azai | 3e-08 | ||
| 3oef_X | 360 | Crystal Structure Of Y323f Inactive Mutant Of P38al | 3e-08 | ||
| 3od6_X | 360 | Crystal Structure Of P38alpha Y323t Active Mutant L | 3e-08 | ||
| 2gfs_A | 372 | P38 Kinase Crystal Structure In Complex With Ro3201 | 3e-08 | ||
| 2wqe_A | 262 | Structure Of S155r Aurora-A Somatic Mutant Length = | 3e-08 | ||
| 3odz_X | 360 | Crystal Structure Of P38alpha Y323r Active Mutant L | 3e-08 | ||
| 2npq_A | 367 | A Novel Lipid Binding Site In The P38 Alpha Map Kin | 3e-08 | ||
| 1di9_A | 360 | The Structure Of P38 Mitogen-Activated Protein Kina | 3e-08 | ||
| 4fsw_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 3e-08 | ||
| 4bc6_A | 293 | Crystal Structure Of Human Serine Threonine Kinase- | 3e-08 | ||
| 4fsy_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 3e-08 | ||
| 3mpt_A | 371 | Crystal Structure Of P38 Kinase In Complex With A P | 3e-08 | ||
| 3fi4_A | 372 | P38 Kinase Crystal Structure In Complex With Ro4499 | 3e-08 | ||
| 4fst_A | 269 | Crystal Structure Of The Chk1 Length = 269 | 3e-08 | ||
| 3k3j_A | 362 | P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 | 3e-08 | ||
| 1lew_A | 360 | Crystal Structure Of Map Kinase P38 Complexed To Th | 3e-08 | ||
| 3p4k_A | 370 | The Third Conformation Of P38a Map Kinase Observed | 3e-08 | ||
| 3gcu_A | 360 | Human P38 Map Kinase In Complex With Rl48 Length = | 3e-08 | ||
| 3tg1_A | 380 | Crystal Structure Of P38alpha In Complex With A Map | 3e-08 | ||
| 3kq7_A | 380 | Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ | 3e-08 | ||
| 3hvc_A | 362 | Crystal Structure Of Human P38alpha Map Kinase Leng | 3e-08 | ||
| 1ian_A | 366 | Human P38 Map Kinase Inhibitor Complex Length = 366 | 3e-08 | ||
| 3zsg_A | 362 | X-Ray Structure Of P38alpha Bound To Tak-715 Length | 3e-08 | ||
| 2baj_A | 365 | P38alpha Bound To Pyrazolourea Length = 365 | 3e-08 | ||
| 2lgc_A | 359 | Joint Nmr And X-Ray Refinement Reveals The Structur | 3e-08 | ||
| 3hrb_A | 359 | P38 Kinase Crystal Structure In Complex With Small | 3e-08 | ||
| 3dt1_A | 383 | P38 Complexed With A Quinazoline Inhibitor Length = | 3e-08 | ||
| 2oza_B | 366 | Structure Of P38alpha Complex Length = 366 | 3e-08 | ||
| 1bl6_A | 379 | The Complex Structure Of The Map Kinase P38SB216995 | 3e-08 | ||
| 3vuk_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M5 | 3e-08 | ||
| 1zys_A | 273 | Co-Crystal Structure Of Checkpoint Kinase Chk1 With | 3e-08 | ||
| 3oht_A | 389 | Crystal Structure Of Salmo Salar P38alpha Length = | 3e-08 | ||
| 2ghg_A | 269 | H-Chk1 Complexed With A431994 Length = 269 | 3e-08 | ||
| 1bmk_A | 379 | The Complex Structure Of The Map Kinase P38SB218655 | 3e-08 | ||
| 4fsn_A | 278 | Crystal Structure Of The Chk1 Length = 278 | 3e-08 | ||
| 3ot3_A | 273 | X-Ray Crystal Structure Of Compound 22k Bound To Hu | 3e-08 | ||
| 2x8e_A | 276 | Discovery Of A Novel Class Of Triazolones As Checkp | 3e-08 | ||
| 3jvr_A | 271 | Characterization Of The Chk1 Allosteric Inhibitor B | 3e-08 | ||
| 2e9v_A | 268 | Structure Of H-Chk1 Complexed With A859017 Length = | 3e-08 | ||
| 2ayp_A | 269 | Crystal Structure Of Chk1 With An Indol Inhibitor L | 3e-08 | ||
| 2br1_A | 297 | Structure-Based Design Of Novel Chk1 Inhibitors: In | 3e-08 | ||
| 1ia8_A | 289 | The 1.7 A Crystal Structure Of Human Cell Cycle Che | 3e-08 | ||
| 4fsu_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 3e-08 | ||
| 2uv2_A | 287 | Crystal Structure Of Human Ste20-Like Kinase Bound | 3e-08 | ||
| 1zlt_A | 295 | Crystal Structure Of Chk1 Complexed With A Hymenald | 3e-08 | ||
| 4fsm_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 3e-08 | ||
| 3nnu_A | 354 | Crystal Structure Of P38 Alpha In Complex With Dp13 | 3e-08 | ||
| 2hog_A | 322 | Crystal Structure Of Chek1 In Complex With Inhibito | 3e-08 | ||
| 1ywr_A | 360 | Crystal Structure Analysis Of Inactive P38 Kinase D | 3e-08 | ||
| 1yw2_A | 360 | Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 | 3e-08 | ||
| 2r0u_A | 323 | Crystal Structure Of Chek1 In Complex With Inhibito | 3e-08 | ||
| 3hec_A | 348 | P38 In Complex With Imatinib Length = 348 | 3e-08 | ||
| 2j7t_A | 302 | Crystal Structure Of Human Serine Threonine Kinase- | 3e-08 | ||
| 3s3i_A | 349 | P38 Kinase Crystal Structure In Complex With Small | 3e-08 | ||
| 1zzl_A | 351 | Crystal Structure Of P38 With Triazolopyridine Leng | 4e-08 | ||
| 2gtm_A | 348 | Mutated Mouse P38 Map Kinase Domain In Complex With | 4e-08 | ||
| 2fsl_X | 367 | Mitogen Activated Protein Kinase P38alpha (D176a+f3 | 4e-08 | ||
| 3k3i_A | 350 | P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 | 4e-08 | ||
| 2fso_X | 367 | Mitogen Activated Protein Kinase P38alpha (D176a) A | 4e-08 | ||
| 2ydj_A | 276 | Discovery Of Checkpoint Kinase Inhibitor Azd7762 By | 4e-08 | ||
| 2fst_X | 367 | Mitogen Activated Protein Kinase P38alpha (d176a+f3 | 4e-08 | ||
| 2yza_A | 276 | Crystal Structure Of Kinase Domain Of Human 5'-Amp- | 4e-08 | ||
| 2ghl_A | 348 | Mutant Mus Musculus P38 Kinase Domain In Complex Wi | 4e-08 | ||
| 3unz_A | 279 | Aurora A In Complex With Rpm1679 Length = 279 | 4e-08 | ||
| 3gcp_A | 360 | Human P38 Map Kinase In Complex With Sb203580 Lengt | 5e-08 | ||
| 3py3_A | 380 | Crystal Structure Of Phosphorylated P38alpha Map Ki | 5e-08 | ||
| 2v55_A | 406 | Mechanism Of Multi-site Phosphorylation From A Rock | 5e-08 | ||
| 3com_A | 314 | Crystal Structure Of Mst1 Kinase Length = 314 | 5e-08 | ||
| 3vui_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M2 | 5e-08 | ||
| 3v8s_A | 410 | Human Rho-Associated Protein Kinase 1 (Rock 1) In C | 5e-08 | ||
| 1cm8_A | 367 | Phosphorylated Map Kinase P38-Gamma Length = 367 | 5e-08 | ||
| 2esm_A | 415 | Crystal Structure Of Rock 1 Bound To Fasudil Length | 5e-08 | ||
| 3vuh_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M3 | 5e-08 | ||
| 3nnx_A | 354 | Crystal Structure Of Phosphorylated P38 Alpha In Co | 5e-08 | ||
| 3iec_A | 319 | Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K | 6e-08 | ||
| 3qbn_A | 281 | Structure Of Human Aurora A In Complex With A Diami | 6e-08 | ||
| 2puu_A | 348 | Crystal Structure Of P38 Complex With 1-(5-Tert-But | 6e-08 | ||
| 3hko_A | 345 | Crystal Structure Of A Cdpk Kinase Domain From Cryp | 6e-08 | ||
| 2dwb_A | 285 | Aurora-A Kinase Complexed With Amppnp Length = 285 | 6e-08 | ||
| 3oz6_A | 388 | Crystal Structure Of Mapk From Cryptosporidium Parv | 6e-08 | ||
| 1zmv_A | 327 | Catalytic And Ubiqutin-Associated Domains Of Mark2P | 6e-08 | ||
| 1zmu_A | 327 | Catalytic And Ubiqutin-Associated Domains Of Mark2P | 6e-08 | ||
| 2r0i_A | 327 | Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len | 6e-08 | ||
| 3fi3_A | 364 | Crystal Structure Of Jnk3 With Indazole Inhibitor, | 7e-08 | ||
| 3juh_A | 335 | Crystal Structure Of A Mutant Of Human Protein Kina | 7e-08 | ||
| 2hak_A | 328 | Catalytic And Ubiqutin-Associated Domains Of Mark1P | 7e-08 | ||
| 3kvx_A | 364 | Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le | 7e-08 | ||
| 2r9s_A | 356 | C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu | 7e-08 | ||
| 2qnj_A | 328 | Kinase And Ubiquitin-Associated Domains Of Mark3PAR | 7e-08 | ||
| 2wel_A | 327 | Crystal Structure Of Su6656-Bound CalciumCALMODULIN | 8e-08 | ||
| 3h30_A | 334 | Crystal Structure Of The Catalytic Subunit Of Human | 8e-08 | ||
| 2r7i_A | 335 | Crystal Structure Of Catalytic Subunit Of Protein K | 8e-08 | ||
| 3bqc_A | 335 | High Ph-Value Crystal Structure Of Emodin In Comple | 8e-08 | ||
| 1pjk_A | 334 | Crystal Structure Of A C-terminal Deletion Mutant O | 8e-08 | ||
| 3nga_A | 333 | Human Ck2 Catalytic Domain In Complex With Cx-4945 | 8e-08 | ||
| 2bdw_A | 362 | Crystal Structure Of The Auto-Inhibited Kinase Doma | 8e-08 | ||
| 3q9w_A | 336 | Crystal Structure Of Human Ck2 Alpha In Complex Wit | 8e-08 | ||
| 4dgl_C | 335 | Crystal Structure Of The Ck2 Tetrameric Holoenzyme | 8e-08 | ||
| 1na7_A | 329 | Crystal Structure Of The Catalytic Subunit Of Human | 8e-08 | ||
| 3q04_A | 328 | Crystal Structure Of The Apo-Form Of Human Ck2 Alph | 8e-08 | ||
| 3nsz_A | 330 | Human Ck2 Catalytic Domain In Complex With Amppn Le | 8e-08 | ||
| 3kk9_A | 282 | Camkii Substrate Complex B Length = 282 | 8e-08 | ||
| 1jwh_A | 337 | Crystal Structure Of Human Protein Kinase Ck2 Holoe | 8e-08 | ||
| 3mb6_A | 331 | Human Ck2 Catalytic Domain In Complex With A Difura | 8e-08 | ||
| 2vn9_A | 301 | Crystal Structure Of Human Calcium Calmodulin Depen | 8e-08 | ||
| 3mh2_A | 360 | Mutagenesis Of P38 Map Kinase Establishes Key Roles | 8e-08 | ||
| 3vug_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M2 | 8e-08 | ||
| 3kk8_A | 284 | Camkii Substrate Complex A Length = 284 | 8e-08 | ||
| 2wtv_A | 285 | Aurora-A Inhibitor Structure Length = 285 | 8e-08 | ||
| 3nrm_A | 283 | Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito | 8e-08 | ||
| 3kl8_A | 269 | Camkiintide Inhibitor Complex Length = 269 | 8e-08 | ||
| 3gbz_A | 329 | Structure Of The Cmgc Cdk Kinase From Giardia Lambl | 9e-08 | ||
| 2zjw_A | 340 | Crystal Structure Of Human Ck2 Alpha Complexed With | 9e-08 | ||
| 1ol5_A | 282 | Structure Of Aurora-A 122-403, Phosphorylated On Th | 9e-08 | ||
| 3s95_A | 310 | Crystal Structure Of The Human Limk1 Kinase Domain | 9e-08 | ||
| 3u87_A | 349 | Structure Of A Chimeric Construct Of Human Ck2alpha | 1e-07 | ||
| 3bhh_A | 295 | Crystal Structure Of Human Calcium/calmodulin-depen | 1e-07 | ||
| 3h0y_A | 268 | Aurora A In Complex With A Bisanilinopyrimidine Len | 1e-07 | ||
| 1ol6_A | 282 | Structure Of Unphosphorylated D274n Mutant Of Auror | 1e-07 | ||
| 3coh_A | 268 | Crystal Structure Of Aurora-A In Complex With A Pen | 1e-07 | ||
| 3a60_A | 327 | Crystal Structure Of Unphosphorylated P70s6k1 (Form | 1e-07 | ||
| 2w1c_A | 275 | Structure Determination Of Aurora Kinase In Complex | 1e-07 | ||
| 3ha6_A | 268 | Crystal Structure Of Aurora A In Complex With Tpx2 | 1e-07 | ||
| 4exu_A | 371 | Mapk13, Inactive Form Length = 371 | 1e-07 | ||
| 4e7w_A | 394 | Structure Of Gsk3 From Ustilago Maydis Length = 394 | 1e-07 | ||
| 3ii5_A | 306 | The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi | 1e-07 | ||
| 3ofm_A | 350 | Structure Of A Human Ck2alpha Prime, The Paralog Is | 1e-07 | ||
| 3e3b_X | 339 | Crystal Structure Of Catalytic Subunit Of Human Pro | 1e-07 | ||
| 3d4q_A | 307 | Pyrazole-Based Inhibitors Of B-Raf Kinase Length = | 1e-07 | ||
| 3ppz_A | 309 | Crystal Structure Of Ctr1 Kinase Domain In Complex | 1e-07 | ||
| 2xru_A | 280 | Aurora-A T288e Complexed With Pha-828300 Length = 2 | 1e-07 | ||
| 2xne_A | 272 | Structure Of Aurora-A Bound To An Imidazopyrazine I | 1e-07 | ||
| 2fb8_A | 281 | Structure Of The B-Raf Kinase Domain Bound To Sb-59 | 1e-07 | ||
| 3coi_A | 353 | Crystal Structure Of P38delta Kinase Length = 353 | 1e-07 | ||
| 4dbn_A | 284 | Crystal Structure Of The Kinase Domain Of Human B-R | 1e-07 | ||
| 3e5a_A | 268 | Crystal Structure Of Aurora A In Complex With Vx-68 | 1e-07 | ||
| 2c6e_A | 283 | Aurora A Kinase Activated Mutant (T287d) In Complex | 1e-07 | ||
| 3q96_A | 282 | B-Raf Kinase Domain In Complex With A Tetrahydronap | 1e-07 | ||
| 1a06_A | 332 | Calmodulin-Dependent Protein Kinase From Rat Length | 1e-07 | ||
| 1uwh_A | 276 | The Complex Of Wild Type B-Raf And Bay439006 Length | 1e-07 | ||
| 3lau_A | 287 | Crystal Structure Of Aurora2 Kinase In Complex With | 1e-07 | ||
| 3fdn_A | 279 | Structure-Based Drug Design Of Novel Aurora Kinase | 1e-07 | ||
| 4h58_A | 275 | Braf In Complex With Compound 3 Length = 275 | 1e-07 | ||
| 4fg9_A | 320 | Crystal Structure Of Human Calcium/calmodulin-depen | 1e-07 | ||
| 4fg8_A | 315 | Crystal Structure Of Human Calcium/calmodulin-depen | 1e-07 | ||
| 2qc6_A | 332 | Protein Kinase Ck2 In Complex With Dbc Length = 332 | 1e-07 | ||
| 4dgn_A | 326 | Crystal Structure Of Maize Ck2 In Complex With The | 1e-07 | ||
| 3e7o_A | 360 | Crystal Structure Of Jnk2 Length = 360 | 1e-07 | ||
| 3pvg_A | 331 | Crystal Structure Of Z. Mays Ck2 Alpha Subunit In C | 1e-07 | ||
| 3fv8_A | 355 | Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le | 1e-07 | ||
| 2c6d_A | 275 | Aurora A Kinase Activated Mutant (T287d) In Complex | 1e-07 | ||
| 4dgm_A | 326 | Crystal Structure Of Maize Ck2 In Complex With The | 1e-07 | ||
| 3kxg_A | 327 | Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subun | 1e-07 | ||
| 3qfv_A | 415 | Mrck Beta In Complex With Tpca-1 Length = 415 | 2e-07 | ||
| 4anm_A | 335 | Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 | 2e-07 | ||
| 2pvh_A | 352 | Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]tri | 2e-07 | ||
| 1ds5_A | 332 | Dimeric Crystal Structure Of The Alpha Subunit In C | 2e-07 | ||
| 1daw_A | 327 | Crystal Structure Of A Binary Complex Of Protein Ki | 2e-07 | ||
| 1m2p_A | 325 | Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- Anthra | 2e-07 | ||
| 3tku_A | 433 | Mrck Beta In Complex With Fasudil Length = 433 | 2e-07 | ||
| 2r5t_A | 373 | Crystal Structure Of Inactive Serum And Glucocortic | 2e-07 | ||
| 2vz6_A | 313 | Structure Of Human Calcium Calmodulin Dependent Pro | 2e-07 | ||
| 1ua2_A | 346 | Crystal Structure Of Human Cdk7 Length = 346 | 2e-07 | ||
| 3fi2_A | 353 | Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib | 2e-07 | ||
| 1v0b_A | 288 | Crystal Structure Of The T198a Mutant Of Pfpk5 Leng | 2e-07 | ||
| 1v0o_A | 288 | Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho | 2e-07 | ||
| 2bmc_A | 306 | Aurora-2 T287d T288d Complexed With Pha-680632 Leng | 2e-07 | ||
| 3o8p_A | 360 | Conformational Plasticity Of P38 Map Kinase Dfg Mot | 2e-07 | ||
| 3p86_A | 309 | Crystal Structure Of Ctr1 Kinase Domain Mutant D676 | 2e-07 | ||
| 4fr4_A | 384 | Crystal Structure Of Human SerineTHREONINE-Protein | 2e-07 | ||
| 3r21_A | 271 | Design, Synthesis, And Biological Evaluation Of Pyr | 2e-07 | ||
| 3v3v_A | 379 | Structural And Functional Analysis Of Quercetagetin | 3e-07 | ||
| 1ob3_A | 288 | Structure Of P. Falciparum Pfpk5 Length = 288 | 3e-07 | ||
| 4fg7_A | 293 | Crystal Structure Of Human Calcium/calmodulin-depen | 3e-07 | ||
| 3mh0_A | 360 | Mutagenesis Of P38 Map Kinase Eshtablishes Key Role | 3e-07 | ||
| 4aw2_A | 437 | Crystal Structure Of Cdc42 Binding Protein Kinase A | 3e-07 | ||
| 2wzj_A | 327 | Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 | 3e-07 | ||
| 1ukh_A | 369 | Structural Basis For The Selective Inhibition Of Jn | 3e-07 | ||
| 3ttj_A | 464 | Crystal Structure Of Jnk3 Complexed With Cc-359, A | 3e-07 | ||
| 2xrw_A | 371 | Linear Binding Motifs For Jnk And For Calcineurin A | 3e-07 | ||
| 1zmw_A | 327 | Catalytic And Ubiqutin-Associated Domains Of Mark2P | 3e-07 | ||
| 3elj_A | 369 | Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine | 3e-07 | ||
| 3cik_A | 689 | Human Grk2 In Complex With Gbetagamma Subunits Leng | 3e-07 | ||
| 1omw_A | 689 | Crystal Structure Of The Complex Between G Protein- | 3e-07 | ||
| 3psc_A | 695 | Bovine Grk2 In Complex With Gbetagamma Subunits Len | 3e-07 | ||
| 1pmn_A | 364 | Crystal Structure Of Jnk3 In Complex With An Imidaz | 3e-07 | ||
| 3krw_A | 688 | Human Grk2 In Complex With Gbetgamma Subunits And B | 3e-07 | ||
| 3pze_A | 358 | Jnk1 In Complex With Inhibitor Length = 358 | 3e-07 | ||
| 2o0u_A | 364 | Crystal Structure Of Human Jnk3 Complexed With N-{3 | 3e-07 | ||
| 1y8g_A | 327 | Catalytic And Ubiqutin-Associated Domains Of Mark2P | 3e-07 | ||
| 1jnk_A | 423 | The C-Jun N-Terminal Kinase (Jnk3s) Complexed With | 3e-07 | ||
| 2ok1_A | 365 | Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 | 3e-07 | ||
| 3oxi_A | 362 | Design And Synthesis Of Disubstituted Thiophene And | 3e-07 | ||
| 3vud_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M1 | 3e-07 | ||
| 3npc_A | 364 | Crystal Structure Of Jnk2 Complexed With Birb796 Le | 3e-07 | ||
| 3ptg_A | 363 | Design And Synthesis Of A Novel, Orally Efficacious | 3e-07 | ||
| 3mh1_A | 360 | Mutagenesis Of P38 Map Kinase Establishes Key Roles | 3e-07 | ||
| 4h36_A | 356 | Crystal Structure Of Jnk3 In Complex With Atf2 Pept | 3e-07 | ||
| 3mh3_A | 360 | Mutagenesis Of P38 Map Kinase Establishes Key Roles | 3e-07 | ||
| 2b1p_A | 355 | Inhibitor Complex Of Jnk3 Length = 355 | 3e-07 | ||
| 2exc_X | 356 | Inhibitor Complex Of Jnk3 Length = 356 | 4e-07 | ||
| 3fe3_A | 328 | Crystal Structure Of The Kinase Mark3PAR-1: T211a-S | 4e-07 | ||
| 2uzt_A | 336 | Pka Structures Of Akt, Indazole-Pyridine Inhibitors | 4e-07 | ||
| 2f7e_E | 351 | Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu | 4e-07 | ||
| 3o17_A | 370 | Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 | 4e-07 | ||
| 2g01_A | 370 | Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit | 4e-07 | ||
| 2xs0_A | 386 | Linear Binding Motifs For Jnk And For Calcineurin A | 4e-07 | ||
| 3r1n_A | 317 | Mk3 Kinase Bound To Compound 5b Length = 317 | 5e-07 | ||
| 3fhr_A | 336 | High Resolution Crystal Structure Of Mitogen-Activa | 5e-07 | ||
| 3a62_A | 327 | Crystal Structure Of Phosphorylated P70s6k1 Length | 5e-07 | ||
| 3gi3_A | 360 | Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana | 5e-07 | ||
| 4g9r_A | 307 | B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr | 5e-07 | ||
| 3p1a_A | 311 | Structure Of Human Membrane-Associated Tyrosine- An | 5e-07 | ||
| 1q3d_A | 424 | Gsk-3 Beta Complexed With Staurosporine Length = 42 | 5e-07 | ||
| 1xjd_A | 345 | Crystal Structure Of Pkc-Theta Complexed With Staur | 5e-07 | ||
| 1pyx_A | 422 | Gsk-3 Beta Complexed With Amp-Pnp Length = 422 | 5e-07 | ||
| 3tl8_A | 349 | The Avrptob-Bak1 Complex Reveals Two Structurally S | 5e-07 | ||
| 4dit_A | 382 | Crystal Structure Of Gsk3beta In Complex With A Imi | 5e-07 | ||
| 3idp_A | 300 | B-Raf V600e Kinase Domain In Complex With An Aminoi | 5e-07 | ||
| 1i09_A | 420 | Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len | 5e-07 | ||
| 3say_A | 430 | Crystal Structure Of Human Glycogen Synthase Kinase | 5e-07 | ||
| 2jed_A | 352 | The Crystal Structure Of The Kinase Domain Of The P | 5e-07 | ||
| 3zrk_A | 371 | Identification Of 2-(4-Pyridyl)thienopyridinones As | 5e-07 | ||
| 3gb2_A | 353 | Gsk3beta Inhibitor Complex Length = 353 | 6e-07 | ||
| 3f88_A | 349 | Glycogen Synthase Kinase 3beta Inhibitor Complex Le | 6e-07 | ||
| 1uwj_A | 276 | The Complex Of Mutant V599e B-raf And Bay439006 Len | 6e-07 | ||
| 1o9u_A | 350 | Glycogen Synthase Kinase 3 Beta Complexed With Axin | 6e-07 | ||
| 1q5k_A | 414 | Crystal Structure Of Glycogen Synthase Kinase 3 In | 6e-07 | ||
| 4afj_A | 367 | 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec | 6e-07 | ||
| 2ow3_A | 352 | Glycogen Synthase Kinase-3 Beta In Complex With Bis | 6e-07 | ||
| 3zdi_A | 350 | Glycogen Synthase Kinase 3 Beta Complexed With Axin | 6e-07 | ||
| 1gng_A | 378 | Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With | 6e-07 | ||
| 1uv5_A | 350 | Glycogen Synthase Kinase 3 Beta Complexed With 6-Br | 6e-07 | ||
| 3f7z_A | 350 | X-ray Co-crystal Structure Of Glycogen Synthase Kin | 6e-07 | ||
| 4acc_A | 465 | Gsk3b In Complex With Inhibitor Length = 465 | 6e-07 | ||
| 4dfy_A | 371 | Crystal Structure Of R194a Mutant Of Camp-Dependent | 6e-07 | ||
| 1r0e_A | 391 | Glycogen Synthase Kinase-3 Beta In Complex With 3-I | 7e-07 | ||
| 3soa_A | 444 | Full-Length Human Camkii Length = 444 | 7e-07 | ||
| 3sd0_A | 350 | Identification Of A Glycogen Synthase Kinase-3b Inh | 7e-07 | ||
| 1h8f_A | 352 | Glycogen Synthase Kinase 3 Beta. Length = 352 | 7e-07 | ||
| 2o5k_A | 372 | Crystal Structure Of Gsk3beta In Complex With A Ben | 7e-07 | ||
| 1gzk_A | 315 | Molecular Mechanism For The Regulation Of Protein K | 8e-07 | ||
| 4eqm_A | 294 | Structural Analysis Of Staphylococcus Aureus Serine | 8e-07 | ||
| 1xh9_A | 350 | Crystal Structures Of Protein Kinase B Selective In | 8e-07 | ||
| 1smh_A | 350 | Protein Kinase A Variant Complex With Completely Or | 8e-07 | ||
| 1vzo_A | 355 | The Structure Of The N-Terminal Kinase Domain Of Ms | 8e-07 | ||
| 1mrv_A | 339 | Crystal Structure Of An Inactive Akt2 Kinase Domain | 9e-07 | ||
| 1gzn_A | 335 | Structure Of Pkb Kinase Domain Length = 335 | 9e-07 | ||
| 2vd5_A | 412 | Structure Of Human Myotonic Dystrophy Protein Kinas | 9e-07 | ||
| 3ama_A | 351 | Protein Kinase A Sixfold Mutant Model Of Aurora B W | 1e-06 | ||
| 2qr8_A | 342 | 2.0a X-ray Structure Of C-terminal Kinase Domain Of | 1e-06 | ||
| 2qr7_A | 342 | 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of | 1e-06 | ||
| 2gng_A | 350 | Protein Kinase A Fivefold Mutant Model Of Rho-Kinas | 1e-06 | ||
| 2gnf_A | 350 | Protein Kinase A Fivefold Mutant Model Of Rho-Kinas | 1e-06 | ||
| 2gnj_A | 350 | Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 | 1e-06 | ||
| 2nry_A | 307 | Crystal Structure Of Irak-4 Length = 307 | 1e-06 | ||
| 2nru_A | 307 | Crystal Structure Of Irak-4 Length = 307 | 1e-06 | ||
| 2p3g_X | 327 | Crystal Structure Of A Pyrrolopyridine Inhibitor Bo | 1e-06 | ||
| 1kwp_A | 400 | Crystal Structure Of Mapkap2 Length = 400 | 1e-06 | ||
| 3fpm_A | 325 | Crystal Structure Of A Squarate Inhibitor Bound To | 1e-06 | ||
| 2oza_A | 356 | Structure Of P38alpha Complex Length = 356 | 1e-06 | ||
| 3gok_A | 334 | Binding Site Mapping Of Protein Ligands Length = 33 | 1e-06 | ||
| 2jbo_A | 326 | Protein Kinase Mk2 In Complex With An Inhibitor (Cr | 1e-06 | ||
| 2onl_C | 406 | Crystal Structure Of The P38a-Mapkap Kinase 2 Heter | 1e-06 | ||
| 3uim_A | 326 | Structural Basis For The Impact Of Phosphorylation | 1e-06 | ||
| 2pzy_A | 324 | Structure Of Mk2 Complexed With Compound 76 Length | 1e-06 | ||
| 3r2b_A | 318 | Mk2 Kinase Bound To Compound 5b Length = 318 | 1e-06 | ||
| 3r2y_A | 319 | Mk2 Kinase Bound To Compound 1 Length = 319 | 1e-06 | ||
| 4ebw_A | 304 | Structure Of Focal Adhesion Kinase Catalytic Domain | 1e-06 | ||
| 2j0j_A | 656 | Crystal Structure Of A Fragment Of Focal Adhesion K | 1e-06 | ||
| 3pxk_A | 282 | Focal Adhesion Kinase Catalytic Domain In Complex W | 1e-06 | ||
| 1mp8_A | 281 | Crystal Structure Of Focal Adhesion Kinase (Fak) Le | 2e-06 | ||
| 2etm_A | 281 | Crystal Structure Of Focal Adhesion Kinase Domain C | 2e-06 | ||
| 2jkm_A | 276 | Focal Adhesion Kinase Catalytic Domain In Complex W | 2e-06 | ||
| 2j0m_B | 276 | Crystal Structure A Two-Chain Complex Between The F | 2e-06 | ||
| 2c1a_A | 351 | Structure Of Camp-Dependent Protein Kinase Complexe | 2e-06 | ||
| 3bz3_A | 276 | Crystal Structure Analysis Of Focal Adhesion Kinase | 2e-06 | ||
| 2v7o_A | 336 | Crystal Structure Of Human Calcium-Calmodulin-Depen | 2e-06 | ||
| 2j0l_A | 276 | Crystal Structure Of A The Active Conformation Of T | 2e-06 | ||
| 4ae6_A | 343 | Structure And Function Of The Human Sperm-specific | 2e-06 | ||
| 3nx8_A | 351 | Human Camp Dependent Protein Kinase In Complex With | 2e-06 | ||
| 4ae9_A | 343 | Structure And Function Of The Human Sperm-specific | 2e-06 | ||
| 4dg3_E | 371 | Crystal Structure Of R336a Mutant Of Camp-dependent | 2e-06 | ||
| 1szm_A | 350 | Dual Binding Mode Of Bisindolylmaleimide 2 To Prote | 2e-06 | ||
| 3l9m_A | 351 | Crystal Structure Of Pkab3 (Pka Triple Mutant V123a | 2e-06 | ||
| 3mvj_A | 371 | Human Cyclic Amp-Dependent Protein Kinase Pka Inhib | 2e-06 | ||
| 2vo0_A | 351 | Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 | 2e-06 | ||
| 2uvy_A | 351 | Structure Of Pka-pkb Chimera Complexed With Methyl- | 2e-06 | ||
| 1q61_A | 350 | Pka Triple Mutant Model Of Pkb Length = 350 | 2e-06 | ||
| 2gu8_A | 337 | Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel | 2e-06 | ||
| 3f3z_A | 277 | Crystal Structure Of Cryptosporidium Parvum Calcium | 2e-06 | ||
| 2pwl_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 2e-06 | ||
| 2jdt_A | 351 | Structure Of Pka-Pkb Chimera Complexed With Isoquin | 2e-06 | ||
| 2pzp_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 2e-06 | ||
| 2psq_A | 370 | Crystal Structure Of Unphosphorylated Unactivated W | 2e-06 | ||
| 1gjo_A | 316 | The Fgfr2 Tyrosine Kinase Domain Length = 316 | 2e-06 | ||
| 3cly_A | 334 | Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase | 2e-06 | ||
| 2qg5_A | 294 | Cryptosporidium Parvum Calcium Dependent Protein Ki | 2e-06 | ||
| 2pvf_A | 334 | Crystal Structure Of Tyrosine Phosphorylated Activa | 2e-06 | ||
| 2q0b_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 2e-06 | ||
| 2pvy_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 2e-06 | ||
| 3b2t_A | 311 | Structure Of Phosphotransferase Length = 311 | 2e-06 | ||
| 3ri1_A | 313 | Crystal Structure Of The Catalytic Domain Of Fgfr2 | 2e-06 | ||
| 2py3_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 2e-06 | ||
| 3txo_A | 353 | Pkc Eta Kinase In Complex With A Naphthyridine Leng | 2e-06 | ||
| 2pz5_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 3e-06 | ||
| 3rgf_A | 405 | Crystal Structure Of Human Cdk8CYCC Length = 405 | 3e-06 | ||
| 3uib_A | 362 | Map Kinase Lmampk10 From Leishmania Major In Comple | 3e-06 | ||
| 3pg1_A | 362 | Map Kinase Lmampk10 From Leishmania Major (1.95 Ang | 3e-06 | ||
| 3omv_A | 307 | Crystal Structure Of C-Raf (Raf-1) Length = 307 | 3e-06 | ||
| 1nxk_A | 400 | Crystal Structure Of Staurosporine Bound To Map Kap | 3e-06 | ||
| 3sls_A | 304 | Crystal Structure Of Human Mek-1 Kinase In Complex | 3e-06 | ||
| 2oib_A | 301 | Crystal Structure Of Irak4 Kinase Domain Apo Form L | 3e-06 | ||
| 3fhi_A | 350 | Crystal Structure Of A Complex Between The Catalyti | 3e-06 | ||
| 2dyl_A | 318 | Crystal Structure Of Human Mitogen-Activated Protei | 4e-06 | ||
| 2y4i_C | 395 | Ksr2-Mek1 Heterodimer Length = 395 | 4e-06 | ||
| 3eqc_A | 360 | X-Ray Structure Of The Human Mitogen-Activated Prot | 4e-06 | ||
| 2wnt_A | 330 | Crystal Structure Of The Human Ribosomal Protein S6 | 4e-06 | ||
| 3rny_A | 346 | Crystal Structure Of Human Rsk1 C-Terminal Kinase D | 4e-06 | ||
| 2p55_A | 333 | X-Ray Structure Of The Human Mitogen-Activated Prot | 4e-06 | ||
| 2jdo_A | 342 | Structure Of Pkb-Beta (Akt2) Complexed With Isoquin | 4e-06 | ||
| 3e87_A | 335 | Crystal Structures Of The Kinase Domain Of Akt2 In | 4e-06 | ||
| 1s9j_A | 341 | X-Ray Structure Of The Human Mitogen-Activated Prot | 4e-06 | ||
| 1o6k_A | 336 | Structure Of Activated Form Of Pkb Kinase Domain S4 | 4e-06 | ||
| 1apm_E | 350 | 2.0 Angstrom Refined Crystal Structure Of The Catal | 4e-06 | ||
| 1o6l_A | 337 | Crystal Structure Of An Activated Akt/protein Kinas | 4e-06 | ||
| 4dfx_E | 350 | Crystal Structure Of Myristoylated K7c Catalytic Su | 4e-06 | ||
| 2qcs_A | 350 | A Complex Structure Between The Catalytic And Regul | 4e-06 | ||
| 2pzr_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 4e-06 | ||
| 1bkx_A | 350 | A Binary Complex Of The Catalytic Subunit Of Camp-D | 4e-06 | ||
| 1l3r_E | 350 | Crystal Structure Of A Transition State Mimic Of Th | 4e-06 | ||
| 1syk_A | 350 | Crystal Structure Of E230q Mutant Of Camp-Dependent | 4e-06 | ||
| 1fmo_E | 350 | Crystal Structure Of A Polyhistidine-Tagged Recombi | 4e-06 | ||
| 3qam_E | 350 | Crystal Structure Of Glu208ala Mutant Of Catalytic | 4e-06 | ||
| 3mbl_A | 328 | Crystal Structure Of The Human Mitogen-Activated Pr | 4e-06 | ||
| 3dv3_A | 322 | Mek1 With Pf-04622664 Bound Length = 322 | 4e-06 | ||
| 2qur_A | 350 | Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe | 4e-06 | ||
| 1jbp_E | 350 | Crystal Structure Of The Catalytic Subunit Of Camp- | 4e-06 | ||
| 3qal_E | 350 | Crystal Structure Of Arg280ala Mutant Of Catalytic | 4e-06 | ||
| 3ka0_A | 320 | Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 | 4e-06 | ||
| 2erz_E | 351 | Crystal Structure Of C-amp Dependent Kinase (pka) B | 4e-06 | ||
| 3orn_A | 307 | Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In | 4e-06 | ||
| 3pvb_A | 345 | Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca | 4e-06 | ||
| 1ydt_E | 350 | Structure Of Camp-Dependent Protein Kinase, Alpha-C | 4e-06 | ||
| 1cdk_A | 350 | Camp-Dependent Protein Kinase Catalytic Subunit (E. | 4e-06 | ||
| 3agl_A | 351 | Complex Of Pka With The Bisubstrate Protein Kinase | 4e-06 | ||
| 3dnd_A | 350 | Camp-Dependent Protein Kinase Pka Catalytic Subunit | 4e-06 | ||
| 1xh7_A | 350 | Crystal Structures Of Protein Kinase B Selective In | 4e-06 | ||
| 1q8w_A | 350 | The Catalytic Subunit Of Camp-Dependent Protein Kin | 4e-06 | ||
| 3agm_A | 351 | Complex Of Pka With The Bisubstrate Protein Kinase | 4e-06 | ||
| 1cmk_E | 350 | Crystal Structures Of The Myristylated Catalytic Su | 4e-06 | ||
| 1stc_E | 350 | Camp-Dependent Protein Kinase, Alpha-Catalytic Subu | 4e-06 | ||
| 2jds_A | 351 | Structure Of Camp-Dependent Protein Kinase Complexe | 4e-06 | ||
| 3q5i_A | 504 | Crystal Structure Of Pbanka_031420 Length = 504 | 4e-06 | ||
| 1j3h_A | 350 | Crystal Structure Of Apoenzyme Camp-Dependent Prote | 5e-06 | ||
| 1ctp_E | 350 | Structure Of The Mammalian Catalytic Subunit Of Cam | 5e-06 | ||
| 1svh_A | 350 | Crystal Structure Of Protein Kinase A In Complex Wi | 5e-06 | ||
| 3o7l_B | 350 | Crystal Structure Of Phospholamban (1-19):pka C-Sub | 5e-06 | ||
| 3fme_A | 290 | Crystal Structure Of Human Mitogen-Activated Protei | 5e-06 | ||
| 1q24_A | 350 | Pka Double Mutant Model Of Pkb In Complex With Mgat | 5e-06 | ||
| 3vn9_A | 340 | Rifined Crystal Structure Of Non-Phosphorylated Map | 5e-06 | ||
| 4dc2_A | 396 | Structure Of Pkc In Complex With A Substrate Peptid | 6e-06 | ||
| 3igo_A | 486 | Crystal Structure Of Cryptosporidium Parvum Cdpk1, | 6e-06 | ||
| 3iw4_A | 360 | Crystal Structure Of Pkc Alpha In Complex With Nvp- | 7e-06 | ||
| 2jam_A | 304 | Crystal Structure Of Human Calmodulin-Dependent Pro | 7e-06 | ||
| 3eb0_A | 383 | Crystal Structure Of Cgd4_240 From Cryptosporidium | 7e-06 | ||
| 2jkk_A | 276 | Focal Adhesion Kinase Catalytic Domain In Complex W | 7e-06 | ||
| 2j0k_A | 656 | Crystal Structure Of A Fragment Of Focal Adhesion K | 7e-06 | ||
| 4ec8_A | 373 | Structure Of Full Length Cdk9 In Complex With Cycli | 7e-06 | ||
| 3dfa_A | 286 | Crystal Structure Of Kinase Domain Of Calcium-depen | 8e-06 | ||
| 2wei_A | 287 | Crystal Structure Of The Kinase Domain Of Cryptospo | 8e-06 | ||
| 3zgw_A | 347 | Crystal Structure Of Maternal Embryonic Leucine Zip | 8e-06 | ||
| 3mi9_A | 351 | Crystal Structure Of Hiv-1 Tat Complexed With Human | 9e-06 | ||
| 2qkw_B | 321 | Structural Basis For Activation Of Plant Immunity B | 9e-06 | ||
| 4bcf_A | 331 | Structure Of Cdk9 In Complex With Cyclin T And A 2- | 1e-05 | ||
| 3blh_A | 331 | Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 | 1e-05 | ||
| 3hgk_A | 327 | Crystal Structure Of Effect Protein Avrptob Complex | 1e-05 | ||
| 3pp0_A | 338 | Crystal Structure Of The Kinase Domain Of Human Her | 1e-05 | ||
| 2jc6_A | 334 | Crystal Structure Of Human Calmodulin-Dependent Pro | 1e-05 | ||
| 3hng_A | 360 | Crystal Structure Of Vegfr1 In Complex With N-(4-ch | 1e-05 | ||
| 1s9i_A | 354 | X-Ray Structure Of The Human Mitogen-Activated Prot | 1e-05 | ||
| 2w4o_A | 349 | Crystal Structure Of Human Camk4 In Complex With 4- | 2e-05 | ||
| 2o8y_A | 298 | Apo Irak4 Kinase Domain Length = 298 | 2e-05 | ||
| 3aln_A | 327 | Crystal Structure Of Human Non-Phosphorylated Mkk4 | 2e-05 | ||
| 3lij_A | 494 | Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) | 2e-05 | ||
| 2xix_A | 301 | Protein Kinase Pim-1 In Complex With Fragment-1 Fro | 2e-05 | ||
| 3i79_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 2e-05 | ||
| 3ku2_A | 507 | Crystal Structure Of Inactivated Form Of Cdpk1 From | 2e-05 | ||
| 3hx4_A | 508 | Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg | 2e-05 | ||
| 2xiy_A | 301 | Protein Kinase Pim-1 In Complex With Fragment-2 Fro | 2e-05 | ||
| 4a7c_A | 308 | Crystal Structure Of Pim1 Kinase With Etp46546 Leng | 2e-05 | ||
| 2xj0_A | 301 | Protein Kinase Pim-1 In Complex With Fragment-4 Fro | 2e-05 | ||
| 3a99_A | 320 | Structure Of Pim-1 Kinase Crystallized In The Prese | 2e-05 | ||
| 3f2a_A | 300 | Crystal Structure Of Human Pim-1 In Complex With Da | 2e-05 | ||
| 1yhs_A | 273 | Crystal Structure Of Pim-1 Bound To Staurosporine L | 2e-05 | ||
| 4as0_A | 273 | Cyclometalated Phthalimides As Protein Kinase Inhib | 2e-05 | ||
| 3ma6_A | 298 | Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr | 2e-05 | ||
| 2obj_A | 333 | Crystal Structure Of Human Pim-1 Kinase In Complex | 2e-05 | ||
| 1xqz_A | 300 | Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolut | 2e-05 | ||
| 2hw6_A | 307 | Crystal Structure Of Mnk1 Catalytic Domain Length = | 2e-05 | ||
| 4an2_A | 301 | Crystal Structures Of Human Mek1 With Carboxamide-B | 2e-05 | ||
| 3c4e_A | 273 | Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7 | 2e-05 | ||
| 2bfx_B | 284 | Mechanism Of Aurora-B Activation By Incenp And Inhi | 2e-05 | ||
| 3dcv_A | 328 | Crystal Structure Of Human Pim1 Kinase Complexed Wi | 2e-05 | ||
| 2bfy_A | 284 | Complex Of Aurora-B With Incenp And Hesperidin. Len | 2e-05 | ||
| 1ywv_A | 293 | Crystal Structures Of Proto-Oncogene Kinase Pim1: A | 2e-05 | ||
| 3r00_A | 299 | The Discovery Of Novel Benzofuran-2-Carboxylic Acid | 2e-05 | ||
| 1zrz_A | 364 | Crystal Structure Of The Catalytic Domain Of Atypic | 2e-05 | ||
| 4dtk_A | 276 | Novel And Selective Pan-Pim Kinase Inhibitor Length | 2e-05 | ||
| 3jxw_A | 294 | Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4- | 2e-05 | ||
| 3tt0_A | 382 | Co-Structure Of Fibroblast Growth Factor Receptor 1 | 2e-05 | ||
| 2vrx_A | 285 | Structure Of Aurora B Kinase In Complex With Zm4474 | 2e-05 | ||
| 1yxs_A | 293 | Crystal Structure Of Kinase Pim1 With P123m Mutatio | 2e-05 | ||
| 3zh8_A | 349 | A Novel Small Molecule Apkc Inhibitor Length = 349 | 3e-05 | ||
| 3kxx_A | 317 | Structure Of The Mutant Fibroblast Growth Factor Re | 3e-05 | ||
| 3uix_A | 298 | Crystal Structure Of Pim1 Kinase In Complex With Sm | 3e-05 | ||
| 3dls_A | 335 | Crystal Structure Of Human Pas Kinase Bound To Adp | 3e-05 | ||
| 3a8w_A | 345 | Crystal Structure Of Pkciota Kinase Domain Length = | 3e-05 | ||
| 3js2_A | 317 | Crystal Structure Of Minimal Kinase Domain Of Fibro | 3e-05 | ||
| 1fgk_A | 310 | Crystal Structure Of The Tyrosine Kinase Domain Of | 3e-05 | ||
| 4f63_A | 309 | Crystal Structure Of Human Fibroblast Growth Factor | 3e-05 | ||
| 3gql_A | 326 | Crystal Structure Of Activated Receptor Tyrosine Ki | 3e-05 | ||
| 3rhx_B | 306 | Crystal Structure Of The Catalytic Domain Of Fgfr1 | 3e-05 | ||
| 3gqi_A | 326 | Crystal Structure Of Activated Receptor Tyrosine Ki | 3e-05 | ||
| 3c4f_A | 302 | Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M | 3e-05 | ||
| 3cjf_A | 309 | Crystal Structure Of Vegfr2 In Complex With A 3,4,5 | 3e-05 | ||
| 2h8h_A | 535 | Src Kinase In Complex With A Quinazoline Inhibitor | 4e-05 | ||
| 4af3_A | 292 | Human Aurora B Kinase In Complex With Incenp And Vx | 4e-05 | ||
| 3jpv_A | 313 | Crystal Structure Of Human Proto-Oncogene Serine Th | 4e-05 | ||
| 4alv_A | 328 | Benzofuropyrimidinone Inhibitors Of Pim-1 Length = | 4e-05 | ||
| 2bil_B | 313 | The Human Protein Kinase Pim1 In Complex With Its C | 4e-05 | ||
| 3cy3_A | 314 | Crystal Structure Of Human Proto-Oncogene Serine Th | 4e-05 | ||
| 3cxw_A | 314 | Crystal Structure Of Human Proto-Oncogene Serine Th | 4e-05 | ||
| 3fpq_A | 290 | Crystal Structure Of The Kinase Domain Of Wnk1 Leng | 4e-05 | ||
| 3ma3_A | 313 | Crystal Structure Of Human Proto-Oncogene Serine Th | 4e-05 | ||
| 2j2i_B | 312 | Crystal Structure Of The Humab Pim1 In Complex With | 4e-05 | ||
| 1y57_A | 452 | Structure Of Unphosphorylated C-Src In Complex With | 4e-05 | ||
| 1ksw_A | 452 | Structure Of Human C-Src Tyrosine Kinase (Thr338gly | 4e-05 | ||
| 2bik_B | 313 | Human Pim1 Phosphorylated On Ser261 Length = 313 | 4e-05 | ||
| 1xws_A | 313 | Crystal Structure Of The Human Pim1 Kinase Domain L | 4e-05 | ||
| 1fmk_A | 452 | Crystal Structure Of Human Tyrosine-Protein Kinase | 4e-05 | ||
| 1rdq_E | 350 | Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of | 4e-05 | ||
| 4alu_A | 328 | Benzofuropyrimidinone Inhibitors Of Pim-1 Length = | 4e-05 | ||
| 3q4t_A | 322 | Crystal Structure Of Activin Receptor Type-Iia (Acv | 4e-05 | ||
| 3kn5_A | 325 | Crystal Structure Of The C-Terminal Kinase Domain O | 5e-05 | ||
| 4ejn_A | 446 | Crystal Structure Of Autoinhibited Form Of Akt1 In | 5e-05 | ||
| 3uc3_A | 361 | The Crystal Structure Of Snf1-Related Kinase 2.3 Le | 5e-05 | ||
| 3o96_A | 446 | Crystal Structure Of Human Akt1 With An Allosteric | 5e-05 | ||
| 1yi6_A | 276 | C-Term Tail Segment Of Human Tyrosine Kinase (258-5 | 5e-05 | ||
| 3i7c_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 6e-05 | ||
| 3ewh_A | 314 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 6e-05 | ||
| 3c7q_A | 316 | Structure Of Vegfr2 Kinase Domain In Complex With B | 6e-05 | ||
| 2p2h_A | 314 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 6e-05 | ||
| 2p2i_A | 314 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 6e-05 | ||
| 3u6j_A | 314 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 6e-05 | ||
| 3cjg_A | 309 | Crystal Structure Of Vegfr2 In Complex With A 3,4,5 | 6e-05 | ||
| 1y6a_A | 366 | Crystal Structure Of Vegfr2 In Complex With A 2-Ani | 6e-05 | ||
| 1tki_A | 321 | Autoinhibited Serine Kinase Domain Of The Giant Mus | 6e-05 | ||
| 3vhk_A | 368 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 6e-05 | ||
| 3vid_A | 356 | Crystal Structure Of Human Vegfr2 Kinase Domain Wit | 6e-05 | ||
| 3vhe_A | 359 | Crystal Structure Of Human Vegfr2 Kinase Domain Wit | 6e-05 | ||
| 4agc_A | 353 | Crystal Structure Of Vegfr2 (Juxtamembrane And Kina | 6e-05 | ||
| 2bdf_A | 279 | Src Kinase In Complex With Inhibitor Ap23451 Length | 6e-05 | ||
| 2ac5_A | 316 | Structure Of Human Mnk2 Kinase Domain Mutant D228g | 6e-05 | ||
| 3enm_A | 316 | The Structure Of The Map2k Mek6 Reveals An Autoinhi | 6e-05 | ||
| 2xir_A | 316 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 6e-05 | ||
| 1vr2_A | 316 | Human Vascular Endothelial Growth Factor Receptor 2 | 6e-05 | ||
| 1ywn_A | 316 | Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p | 7e-05 | ||
| 3vnt_A | 318 | Crystal Structure Of The Kinase Domain Of Human Veg | 7e-05 | ||
| 2oh4_A | 316 | Crystal Structure Of Vegfr2 With A Benzimidazole-Ur | 7e-05 | ||
| 3bbt_B | 328 | Crystal Structure Of The Erbb4 Kinase In Complex Wi | 7e-05 | ||
| 1yoj_A | 283 | Crystal Structure Of Src Kinase Domain Length = 283 | 8e-05 | ||
| 3nyx_A | 302 | Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T | 8e-05 | ||
| 1yol_A | 283 | Crystal Structure Of Src Kinase Domain In Complex W | 8e-05 | ||
| 3nyn_A | 576 | Crystal Structure Of G Protein-Coupled Receptor Kin | 8e-05 | ||
| 2clq_A | 295 | Structure Of Mitogen-Activated Protein Kinase Kinas | 8e-05 | ||
| 2acx_A | 576 | Crystal Structure Of G Protein Coupled Receptor Kin | 8e-05 | ||
| 3vw6_A | 269 | Crystal Structure Of Human Apoptosis Signal-Regulat | 8e-05 | ||
| 2zv7_A | 279 | Lyn Tyrosine Kinase Domain, Apo Form Length = 279 | 9e-05 | ||
| 2r4b_A | 321 | Erbb4 Kinase Domain Complexed With A Thienopyrimidi | 1e-04 | ||
| 3fzo_A | 277 | Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin | 1e-04 | ||
| 4gv1_A | 340 | Pkb Alpha In Complex With Azd5363 Length = 340 | 1e-04 | ||
| 3ocb_A | 341 | Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor | 1e-04 | ||
| 3cc6_A | 281 | Crystal Structure Of Kinase Domain Of Protein Tyros | 1e-04 | ||
| 4h1j_A | 293 | Crystal Structure Of Pyk2 With The Pyrazole 13a Len | 1e-04 | ||
| 3cqu_A | 342 | Crystal Structure Of Akt-1 Complexed With Substrate | 1e-04 | ||
| 3kga_A | 299 | Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexe | 1e-04 | ||
| 3qa8_A | 676 | Crystal Structure Of Inhibitor Of Kappa B Kinase Be | 1e-04 | ||
| 3rzf_A | 677 | Crystal Structure Of Inhibitor Of Kappab Kinase Bet | 1e-04 | ||
| 2wtk_C | 305 | Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 | 1e-04 | ||
| 3lxn_A | 318 | Structural And Thermodynamic Characterization Of Th | 1e-04 | ||
| 3nz0_A | 302 | Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 | 1e-04 | ||
| 2w1i_A | 326 | Structure Determination Of Aurora Kinase In Complex | 2e-04 | ||
| 3gvu_A | 292 | The Crystal Structure Of Human Abl2 In Complex With | 2e-04 | ||
| 3i5n_A | 309 | Crystal Structure Of C-Met With Triazolopyridazine | 2e-04 | ||
| 2wgj_A | 306 | X-Ray Structure Of Pf-02341066 Bound To The Kinase | 2e-04 | ||
| 3f66_A | 298 | Human C-Met Kinase In Complex With Quinoxaline Inhi | 2e-04 | ||
| 2wd1_A | 292 | Human C-Met Kinase In Complex With Azaindole Inhibi | 2e-04 | ||
| 2b7a_A | 293 | The Structural Basis Of Janus Kinase 2 Inhibition B | 2e-04 | ||
| 3lq8_A | 302 | Structure Of The Kinase Domain Of C-Met Bound To Xl | 2e-04 | ||
| 3c1x_A | 373 | Crystal Structure Of The Tyrosine Kinase Domain Of | 2e-04 | ||
| 3q32_A | 301 | Structure Of Janus Kinase 2 With A Pyrrolotriazine | 2e-04 | ||
| 3lpb_A | 295 | Crystal Structure Of Jak2 Complexed With A Potent 2 | 2e-04 | ||
| 3jy9_A | 311 | Janus Kinase 2 Inhibitors Length = 311 | 2e-04 | ||
| 3io7_A | 313 | 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel | 2e-04 | ||
| 2rfn_A | 310 | X-ray Structure Of C-met With Inhibitor. Length = 3 | 2e-04 | ||
| 3ugc_A | 295 | Structural Basis Of Jak2 Inhibition By The Type Ii | 2e-04 | ||
| 3cth_A | 314 | Crystal Structure Of The Tyrosine Kinase Domain Of | 2e-04 | ||
| 4e6d_A | 298 | Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W | 2e-04 | ||
| 3qti_A | 314 | C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 | 2e-04 | ||
| 3a4o_X | 286 | Lyn Kinase Domain Length = 286 | 2e-04 | ||
| 4hge_A | 300 | Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 | 2e-04 | ||
| 4e4m_A | 302 | Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 | 2e-04 | ||
| 3ujg_A | 361 | Crystal Structure Of Snrk2.6 In Complex With Hab1 L | 2e-04 | ||
| 3tjc_A | 298 | Co-Crystal Structure Of Jak2 With Thienopyridine 8 | 2e-04 | ||
| 2xa4_A | 298 | Inhibitors Of Jak2 Kinase Domain Length = 298 | 2e-04 | ||
| 4aqc_A | 301 | Triazolopyridine-Based Inhibitor Of Janus Kinase 2 | 2e-04 | ||
| 3rvg_A | 303 | Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido | 2e-04 | ||
| 3dkc_A | 317 | Sgx Clone 5698a65kfg1h1 Length = 317 | 2e-04 | ||
| 1r0p_A | 312 | Crystal Structure Of The Tyrosine Kinase Domain Of | 2e-04 | ||
| 3a4p_A | 319 | Human C-Met Kinase Domain Complexed With 6-Benzylox | 2e-04 | ||
| 3e62_A | 293 | Fragment Based Discovery Of Jak-2 Inhibitors Length | 2e-04 | ||
| 3pfq_A | 674 | Crystal Structure And Allosteric Activation Of Prot | 2e-04 | ||
| 3dkg_A | 317 | Sgx Clone 5698a109kfg1h1 Length = 317 | 2e-04 | ||
| 3uc4_A | 362 | The Crystal Structure Of Snf1-Related Kinase 2.6 Le | 2e-04 | ||
| 3q6u_A | 308 | Structure Of The Apo Met Receptor Kinase In The Dua | 2e-04 | ||
| 3lm0_A | 327 | Crystal Structure Of Human SerineTHREONINE KINASE 1 | 2e-04 | ||
| 2g15_A | 318 | Structural Characterization Of Autoinhibited C-Met | 2e-04 | ||
| 4gg5_A | 319 | Crystal Structure Of Cmet In Complex With Novel Inh | 2e-04 | ||
| 1z57_A | 339 | Crystal Structure Of Human Clk1 In Complex With 10z | 2e-04 | ||
| 3e3p_A | 360 | Glycogen Synthase Kinase From Leishmania Major Leng | 2e-04 | ||
| 3lcd_A | 329 | Inhibitor Bound To A Dfg-In Structure Of The Kinase | 2e-04 | ||
| 2ogv_A | 317 | Crystal Structure Of The Autoinhibited Human C-Fms | 2e-04 | ||
| 2z60_A | 288 | Crystal Structure Of The T315i Mutant Of Abl Kinase | 2e-04 | ||
| 2qoh_A | 288 | Crystal Structure Of Abl Kinase Bound With Ppy-a Le | 2e-04 | ||
| 4hzs_A | 341 | Crystal Structure Of Ack1 Kinase Domain With C-term | 2e-04 | ||
| 4hzr_A | 277 | Crystal Structure Of Ack1 Kinase Domain Length = 27 | 2e-04 | ||
| 4id7_A | 273 | Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- | 2e-04 | ||
| 2f4j_A | 287 | Structure Of The Kinase Domain Of An Imatinib-Resis | 2e-04 | ||
| 1u46_A | 291 | Crystal Structure Of The Unphosphorylated Kinase Do | 2e-04 | ||
| 1u54_A | 291 | Crystal Structures Of The Phosphorylated And Unphos | 2e-04 | ||
| 4ewh_B | 275 | Co-Crystal Structure Of Ack1 With Inhibitor Length | 2e-04 | ||
| 3eqp_B | 276 | Crystal Structure Of Ack1 With Compound T95 Length | 2e-04 | ||
| 3qri_A | 277 | The Crystal Structure Of Human Abl1 Kinase Domain I | 2e-04 | ||
| 3oxz_A | 284 | Crystal Structure Of Abl Kinase Domain Bound With A | 2e-04 | ||
| 1fpu_A | 293 | Crystal Structure Of Abl Kinase Domain In Complex W | 2e-04 | ||
| 3pyy_A | 298 | Discovery And Characterization Of A Cell-Permeable, | 2e-04 | ||
| 3oy3_A | 284 | Crystal Structure Of Abl T315i Mutant Kinase Domain | 2e-04 | ||
| 3dk3_A | 293 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 2e-04 | ||
| 2hyy_A | 273 | Human Abl Kinase Domain In Complex With Imatinib (S | 2e-04 | ||
| 2g1t_A | 287 | A Src-Like Inactive Conformation In The Abl Tyrosin | 2e-04 | ||
| 2g2f_A | 287 | A Src-Like Inactive Conformation In The Abl Tyrosin | 2e-04 | ||
| 3dk7_A | 277 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 2e-04 | ||
| 3dk6_A | 293 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 2e-04 | ||
| 2hzi_A | 277 | Abl Kinase Domain In Complex With Pd180970 Length = | 2e-04 | ||
| 2hz0_A | 270 | Abl Kinase Domain In Complex With Nvp-Aeg082 Length | 2e-04 | ||
| 2hiw_A | 287 | Crystal Structure Of Inactive Conformation Abl Kina | 2e-04 | ||
| 3qrj_A | 277 | The Crystal Structure Of Human Abl1 Kinase Domain T | 2e-04 | ||
| 2e2b_A | 293 | Crystal Structure Of The C-Abl Kinase Domain In Com | 2e-04 | ||
| 2og8_A | 265 | Crystal Structure Of Aminoquinazoline 36 Bound To L | 2e-04 | ||
| 2gqg_A | 278 | X-Ray Crystal Structure Of Dasatinib (Bms-354825) B | 2e-04 | ||
| 3q6w_A | 307 | Structure Of Dually-phosphorylated Met Receptor Kin | 2e-04 | ||
| 2v7a_A | 286 | Crystal Structure Of The T315i Abl Mutant In Comple | 2e-04 | ||
| 2i0v_A | 335 | C-Fms Tyrosine Kinase In Complex With A Quinolone I | 2e-04 | ||
| 3dqw_A | 286 | C-Src Kinase Domain Thr338ile Mutant In Complex Wit | 2e-04 | ||
| 2hwo_A | 286 | Crystal Structure Of Src Kinase Domain In Complex W | 3e-04 | ||
| 3svv_A | 286 | Crystal Structure Of T338c C-Src Covalently Bound T | 3e-04 | ||
| 3g6h_A | 286 | Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma | 3e-04 | ||
| 2qq7_A | 286 | Crystal Structure Of Drug Resistant Src Kinase Doma | 3e-04 | ||
| 2oiq_A | 286 | Crystal Structure Of Chicken C-Src Kinase Domain In | 3e-04 | ||
| 3oez_A | 286 | Crystal Structure Of The L317i Mutant Of The Chicke | 3e-04 | ||
| 2pml_X | 348 | Crystal Structure Of Pfpk7 In Complex With An Atp A | 3e-04 | ||
| 3u4w_A | 275 | Src In Complex With Dna-Templated Macrocyclic Inhib | 3e-04 | ||
| 3d7u_B | 277 | Structural Basis For The Recognition Of C-Src By It | 3e-04 | ||
| 3ll6_A | 337 | Crystal Structure Of The Human Cyclin G Associated | 3e-04 | ||
| 2i0e_A | 353 | Structure Of Catalytic Domain Of Human Protein Kina | 3e-04 | ||
| 3hzt_A | 467 | Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 | 4e-04 | ||
| 3kul_A | 325 | Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep | 4e-04 | ||
| 1wvw_A | 278 | Crystal Structures Of Kinase Domain Of Dap Kinase I | 4e-04 | ||
| 2xuu_A | 334 | Crystal Structure Of A Dap-Kinase 1 Mutant Length = | 4e-04 | ||
| 3lck_A | 271 | The Kinase Domain Of Human Lymphocyte Kinase (Lck), | 4e-04 | ||
| 3kmm_A | 288 | Structure Of Human Lck Kinase With A Small Molecule | 4e-04 | ||
| 3kxz_A | 287 | The Complex Crystal Structure Of Lck With A Probe M | 4e-04 | ||
| 3bym_A | 272 | X-Ray Co-Crystal Structure Aminobenzimidazole Triaz | 4e-04 | ||
| 2ofu_A | 273 | X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam | 4e-04 | ||
| 1qpe_A | 279 | Structural Analysis Of The Lymphocyte-Specific Kina | 4e-04 | ||
| 2w4j_A | 277 | X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 | 4e-04 | ||
| 2zm1_A | 285 | Crystal Structure Of Imidazo Pyrazin 1 Bound To The | 4e-04 | ||
| 2iwi_A | 312 | Crystal Structure Of The Human Pim2 In Complex With | 4e-04 | ||
| 1p4f_A | 293 | Death Associated Protein Kinase Catalytic Domain Wi | 4e-04 | ||
| 2yak_A | 285 | Structure Of Death-Associated Protein Kinase 1 (Dap | 4e-04 | ||
| 3dxn_A | 287 | Crystal Structure Of The Calcium-dependent Kinase F | 4e-04 | ||
| 3gu4_A | 295 | Crystal Structure Of Dapkq23v-Amppnp Length = 295 | 4e-04 | ||
| 3dfc_B | 295 | Crystal Structure Of A Glycine-Rich Loop Mutant Of | 4e-04 | ||
| 3bys_A | 277 | Co-Crystal Structure Of Lck And Aminopyrimidine Ami | 4e-04 | ||
| 2of2_A | 271 | Crystal Structure Of Furanopyrimidine 8 Bound To Lc | 4e-04 | ||
| 2ofv_A | 277 | Crystal Structure Of Aminoquinazoline 1 Bound To Lc | 4e-04 | ||
| 2xzs_A | 312 | Death Associated Protein Kinase 1 Residues 1-312 Le | 4e-04 | ||
| 3gu8_A | 295 | Crystal Structure Of Dapkl93g With N6-Cyclopentylad | 4e-04 | ||
| 1ig1_A | 294 | 1.8a X-Ray Structure Of Ternary Complex Of A Cataly | 4e-04 | ||
| 3f5u_A | 295 | Crystal Structure Of The Death Associated Protein K | 4e-04 | ||
| 2pl0_A | 289 | Lck Bound To Imatinib Length = 289 | 4e-04 | ||
| 2x0g_A | 334 | X-ray Structure Of A Dap-kinase Calmodulin Complex | 5e-04 | ||
| 2ptk_A | 453 | Chicken Src Tyrosine Kinase Length = 453 | 5e-04 | ||
| 2y0a_A | 326 | Structure Of Dapk1 Construct Residues 1-304 Length | 5e-04 | ||
| 3udb_A | 317 | Crystal Structure Of Snrk2.6 Length = 317 | 5e-04 | ||
| 4bbe_A | 298 | Aminoalkylpyrimidine Inhibitor Complexes With Jak2 | 5e-04 | ||
| 4hct_A | 269 | Crystal Structure Of Itk In Complex With Compound 5 | 5e-04 | ||
| 3t9t_A | 267 | Crystal Structure Of Btk Mutant (F435t,K596r) Compl | 5e-04 | ||
| 3bea_A | 333 | Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P | 5e-04 | ||
| 2i1m_A | 333 | Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An | 5e-04 | ||
| 4e20_A | 290 | Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda | 5e-04 | ||
| 4fl2_A | 636 | Structural And Biophysical Characterization Of The | 5e-04 | ||
| 2ac3_A | 316 | Structure Of Human Mnk2 Kinase Domain Length = 316 | 5e-04 | ||
| 1sm2_A | 264 | Crystal Structure Of The Phosphorylated Interleukin | 5e-04 | ||
| 3v5j_A | 266 | Crystal Structure Of Interleukin-2 Inducible T-Cell | 5e-04 | ||
| 4fl3_A | 635 | Structural And Biophysical Characterization Of The | 5e-04 | ||
| 4e1z_A | 291 | Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda | 5e-04 | ||
| 1qcf_A | 454 | Crystal Structure Of Hck In Complex With A Src Fami | 6e-04 | ||
| 3lco_A | 324 | Inhibitor Bound To A Dfg-Out Structure Of The Kinas | 6e-04 | ||
| 3qgw_A | 286 | Crystal Structure Of Itk Kinase Bound To An Inhibit | 6e-04 | ||
| 3geq_A | 286 | Structural Basis For The Chemical Rescue Of Src Kin | 6e-04 | ||
| 2ivv_A | 314 | Crystal Structure Of Phosphorylated Ret Tyrosine Ki | 6e-04 | ||
| 3emg_A | 291 | Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylami | 6e-04 | ||
| 3tub_A | 293 | Crystal Structure Of Syk Kinase Domain With 1-(5-(6 | 6e-04 | ||
| 3sv0_A | 483 | Crystal Structure Of Casein Kinase-1 Like Protein I | 6e-04 | ||
| 3vf8_A | 299 | Crystal Structure Of Spleen Tyrosine Kinase Syk Cat | 6e-04 | ||
| 2jiv_A | 328 | Crystal Structure Of Egfr Kinase Domain T790m Mutat | 6e-04 | ||
| 2j5e_A | 327 | Crystal Structure Of Egfr Kinase Domain In Complex | 6e-04 | ||
| 3gop_A | 361 | Crystal Structure Of The Egf Receptor Juxtamembrane | 6e-04 | ||
| 1xba_A | 291 | Crystal Structure Of Apo Syk Tyrosine Kinase Domain | 7e-04 | ||
| 2ivs_A | 314 | Crystal Structure Of Non-Phosphorylated Ret Tyrosin | 7e-04 | ||
| 3srv_B | 277 | Crystal Structure Of Spleen Tyrosine Kinase (Syk) I | 7e-04 | ||
| 2x4f_A | 373 | The Crystal Structure Of The Human Myosin Light Cha | 7e-04 | ||
| 1xkk_A | 352 | Egfr Kinase Domain Complexed With A Quinazoline Inh | 7e-04 | ||
| 4hjo_A | 337 | Crystal Structure Of The Inactive Egfr Tyrosine Kin | 7e-04 | ||
| 4dfl_A | 274 | Crystal Structure Of Spleen Tyrosine Kinase Complex | 7e-04 | ||
| 3bel_A | 315 | X-Ray Structure Of Egfr In Complex With Oxime Inhib | 7e-04 | ||
| 4f4p_A | 273 | Syk In Complex With Ligand Lasw836 Length = 273 | 7e-04 | ||
| 4g5p_A | 330 | Crystal Structure Of Egfr Kinase T790m In Complex W | 7e-04 | ||
| 2gs2_A | 330 | Crystal Structure Of The Active Egfr Kinase Domain | 7e-04 | ||
| 2eb2_A | 334 | Crystal Structure Of Mutated Egfr Kinase Domain (G7 | 7e-04 | ||
| 4g5j_A | 330 | Crystal Structure Of Egfr Kinase In Complex With Bi | 7e-04 | ||
| 2jiu_A | 328 | Crystal Structure Of Egfr Kinase Domain T790m Mutat | 7e-04 | ||
| 2gs7_A | 330 | Crystal Structure Of The Inactive Egfr Kinase Domai | 7e-04 | ||
| 3ika_A | 331 | Crystal Structure Of Egfr 696-1022 T790m Mutant Cov | 7e-04 | ||
| 2jit_A | 327 | Crystal Structure Of Egfr Kinase Domain T790m Mutat | 7e-04 | ||
| 2j5f_A | 327 | Crystal Structure Of Egfr Kinase Domain In Complex | 7e-04 | ||
| 3ug1_A | 334 | Crystal Structure Of The Mutated Egfr Kinase Domain | 7e-04 | ||
| 2itn_A | 327 | Crystal Structure Of Egfr Kinase Domain G719s Mutat | 7e-04 | ||
| 4i24_A | 329 | Structure Of T790m Egfr Kinase Domain Co-crystalliz | 7e-04 | ||
| 3vjo_A | 334 | Crystal Structure Of The Wild-Type Egfr Kinase Doma | 7e-04 | ||
| 3bhy_A | 283 | Crystal Structure Of Human Death Associated Protein | 7e-04 | ||
| 4i23_A | 329 | Crystal Structure Of The Wild-type Egfr Kinase Doma | 7e-04 | ||
| 1m14_A | 333 | Tyrosine Kinase Domain From Epidermal Growth Factor | 7e-04 | ||
| 2w4k_A | 302 | X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 | 7e-04 | ||
| 2j90_A | 304 | Crystal Structure Of Human Zip Kinase In Complex Wi | 7e-04 | ||
| 3pjc_A | 315 | Crystal Structure Of Jak3 Complexed With A Potent A | 8e-04 | ||
| 3lzb_A | 327 | Egfr Kinase Domain Complexed With An Imidazo[2,1-B] | 8e-04 | ||
| 1yrp_A | 278 | Catalytic Domain Of Human Zip Kinase Phosphorylated | 8e-04 | ||
| 3lxk_A | 327 | Structural And Thermodynamic Characterization Of Th | 8e-04 | ||
| 4hvd_A | 314 | Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h | 9e-04 |
| >pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 | Back alignment and structure |
|
| >pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 | Back alignment and structure |
| >pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 | Back alignment and structure |
| >pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 | Back alignment and structure |
| >pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 | Back alignment and structure |
| >pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 | Back alignment and structure |
| >pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 | Back alignment and structure |
| >pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 | Back alignment and structure |
| >pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 | Back alignment and structure |
| >pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 | Back alignment and structure |
| >pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 | Back alignment and structure |
| >pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 | Back alignment and structure |
| >pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 | Back alignment and structure |
| >pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 | Back alignment and structure |
| >pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 | Back alignment and structure |
| >pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 | Back alignment and structure |
| >pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 | Back alignment and structure |
| >pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 | Back alignment and structure |
| >pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 | Back alignment and structure |
| >pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 | Back alignment and structure |
| >pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 | Back alignment and structure |
| >pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 | Back alignment and structure |
| >pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 | Back alignment and structure |
| >pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 | Back alignment and structure |
| >pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 | Back alignment and structure |
| >pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 | Back alignment and structure |
| >pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 | Back alignment and structure |
| >pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 | Back alignment and structure |
| >pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 | Back alignment and structure |
| >pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 | Back alignment and structure |
| >pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 | Back alignment and structure |
| >pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 | Back alignment and structure |
| >pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 | Back alignment and structure |
| >pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 | Back alignment and structure |
| >pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 | Back alignment and structure |
| >pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 | Back alignment and structure |
| >pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 | Back alignment and structure |
| >pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 | Back alignment and structure |
| >pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 | Back alignment and structure |
| >pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 | Back alignment and structure |
| >pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 | Back alignment and structure |
| >pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 | Back alignment and structure |
| >pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 | Back alignment and structure |
| >pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 | Back alignment and structure |
| >pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 | Back alignment and structure |
| >pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 | Back alignment and structure |
| >pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 | Back alignment and structure |
| >pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 | Back alignment and structure |
| >pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 | Back alignment and structure |
| >pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 | Back alignment and structure |
| >pdb|3QD2|B Chain B, Crsytal Structure Of Mouse Perk Kinase Domain Length = 332 | Back alignment and structure |
| >pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 | Back alignment and structure |
| >pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 | Back alignment and structure |
| >pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 | Back alignment and structure |
| >pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 | Back alignment and structure |
| >pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 | Back alignment and structure |
| >pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 | Back alignment and structure |
| >pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 | Back alignment and structure |
| >pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 | Back alignment and structure |
| >pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 | Back alignment and structure |
| >pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 | Back alignment and structure |
| >pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 | Back alignment and structure |
| >pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 | Back alignment and structure |
| >pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 | Back alignment and structure |
| >pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 | Back alignment and structure |
| >pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 | Back alignment and structure |
| >pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 | Back alignment and structure |
| >pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 | Back alignment and structure |
| >pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 | Back alignment and structure |
| >pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 | Back alignment and structure |
| >pdb|3RP9|A Chain A, Crystal Structure Of The Apo Mapk From Toxoplasma Gondii, 25.M01780 Or Tgme49_007820 Length = 458 | Back alignment and structure |
| >pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 | Back alignment and structure |
| >pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 | Back alignment and structure |
| >pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 | Back alignment and structure |
| >pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 | Back alignment and structure |
| >pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 | Back alignment and structure |
| >pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Length = 284 | Back alignment and structure |
| >pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 | Back alignment and structure |
| >pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 | Back alignment and structure |
| >pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 | Back alignment and structure |
| >pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 | Back alignment and structure |
| >pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 | Back alignment and structure |
| >pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 | Back alignment and structure |
| >pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 | Back alignment and structure |
| >pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 | Back alignment and structure |
| >pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 | Back alignment and structure |
| >pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 | Back alignment and structure |
| >pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 | Back alignment and structure |
| >pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 | Back alignment and structure |
| >pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 | Back alignment and structure |
| >pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 | Back alignment and structure |
| >pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 | Back alignment and structure |
| >pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 | Back alignment and structure |
| >pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 | Back alignment and structure |
| >pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 | Back alignment and structure |
| >pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 | Back alignment and structure |
| >pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 | Back alignment and structure |
| >pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 | Back alignment and structure |
| >pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 | Back alignment and structure |
| >pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 | Back alignment and structure |
| >pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 | Back alignment and structure |
| >pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 | Back alignment and structure |
| >pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 | Back alignment and structure |
| >pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 | Back alignment and structure |
| >pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 | Back alignment and structure |
| >pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 | Back alignment and structure |
| >pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 | Back alignment and structure |
| >pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 | Back alignment and structure |
| >pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 | Back alignment and structure |
| >pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 | Back alignment and structure |
| >pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 | Back alignment and structure |
| >pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 | Back alignment and structure |
| >pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 | Back alignment and structure |
| >pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 | Back alignment and structure |
| >pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 | Back alignment and structure |
| >pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 | Back alignment and structure |
| >pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 | Back alignment and structure |
| >pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 | Back alignment and structure |
| >pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 | Back alignment and structure |
| >pdb|3NIE|A Chain A, Crystal Structure Of Pf11_0147 Length = 429 | Back alignment and structure |
| >pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 | Back alignment and structure |
| >pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 | Back alignment and structure |
| >pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 | Back alignment and structure |
| >pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 | Back alignment and structure |
| >pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 | Back alignment and structure |
| >pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 | Back alignment and structure |
| >pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 | Back alignment and structure |
| >pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 | Back alignment and structure |
| >pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 | Back alignment and structure |
| >pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 | Back alignment and structure |
| >pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 | Back alignment and structure |
| >pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 | Back alignment and structure |
| >pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 | Back alignment and structure |
| >pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 | Back alignment and structure |
| >pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 | Back alignment and structure |
| >pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 | Back alignment and structure |
| >pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 | Back alignment and structure |
| >pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 | Back alignment and structure |
| >pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 | Back alignment and structure |
| >pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 | Back alignment and structure |
| >pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 | Back alignment and structure |
| >pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 | Back alignment and structure |
| >pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 | Back alignment and structure |
| >pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 | Back alignment and structure |
| >pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 | Back alignment and structure |
| >pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 | Back alignment and structure |
| >pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 | Back alignment and structure |
| >pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 | Back alignment and structure |
| >pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 | Back alignment and structure |
| >pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 | Back alignment and structure |
| >pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 | Back alignment and structure |
| >pdb|3N9X|A Chain A, Crystal Structure Of Map Kinase From Plasmodium Berghei, Pb000659.00.0 Length = 432 | Back alignment and structure |
| >pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 | Back alignment and structure |
| >pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 | Back alignment and structure |
| >pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 | Back alignment and structure |
| >pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 | Back alignment and structure |
| >pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 | Back alignment and structure |
| >pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 | Back alignment and structure |
| >pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 | Back alignment and structure |
| >pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 | Back alignment and structure |
| >pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 | Back alignment and structure |
| >pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 | Back alignment and structure |
| >pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 | Back alignment and structure |
| >pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 | Back alignment and structure |
| >pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 | Back alignment and structure |
| >pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 | Back alignment and structure |
| >pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 | Back alignment and structure |
| >pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 | Back alignment and structure |
| >pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 | Back alignment and structure |
| >pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 | Back alignment and structure |
| >pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 | Back alignment and structure |
| >pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 | Back alignment and structure |
| >pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 | Back alignment and structure |
| >pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 | Back alignment and structure |
| >pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 | Back alignment and structure |
| >pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 | Back alignment and structure |
| >pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 | Back alignment and structure |
| >pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 | Back alignment and structure |
| >pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 | Back alignment and structure |
| >pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 | Back alignment and structure |
| >pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 | Back alignment and structure |
| >pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 | Back alignment and structure |
| >pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 | Back alignment and structure |
| >pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 | Back alignment and structure |
| >pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 | Back alignment and structure |
| >pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 | Back alignment and structure |
| >pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 | Back alignment and structure |
| >pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 | Back alignment and structure |
| >pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 | Back alignment and structure |
| >pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 | Back alignment and structure |
| >pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 | Back alignment and structure |
| >pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 | Back alignment and structure |
| >pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 | Back alignment and structure |
| >pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 | Back alignment and structure |
| >pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 | Back alignment and structure |
| >pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 | Back alignment and structure |
| >pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 | Back alignment and structure |
| >pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 | Back alignment and structure |
| >pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 | Back alignment and structure |
| >pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 | Back alignment and structure |
| >pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 | Back alignment and structure |
| >pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 | Back alignment and structure |
| >pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 | Back alignment and structure |
| >pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 | Back alignment and structure |
| >pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 | Back alignment and structure |
| >pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 | Back alignment and structure |
| >pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 | Back alignment and structure |
| >pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 | Back alignment and structure |
| >pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 | Back alignment and structure |
| >pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 | Back alignment and structure |
| >pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 | Back alignment and structure |
| >pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 | Back alignment and structure |
| >pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 | Back alignment and structure |
| >pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 | Back alignment and structure |
| >pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 | Back alignment and structure |
| >pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 | Back alignment and structure |
| >pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 | Back alignment and structure |
| >pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 | Back alignment and structure |
| >pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 | Back alignment and structure |
| >pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 | Back alignment and structure |
| >pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 | Back alignment and structure |
| >pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 | Back alignment and structure |
| >pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 | Back alignment and structure |
| >pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 | Back alignment and structure |
| >pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 | Back alignment and structure |
| >pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 | Back alignment and structure |
| >pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 | Back alignment and structure |
| >pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 | Back alignment and structure |
| >pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 | Back alignment and structure |
| >pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 | Back alignment and structure |
| >pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 | Back alignment and structure |
| >pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 | Back alignment and structure |
| >pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 | Back alignment and structure |
| >pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 | Back alignment and structure |
| >pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 | Back alignment and structure |
| >pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 | Back alignment and structure |
| >pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 | Back alignment and structure |
| >pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 | Back alignment and structure |
| >pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 | Back alignment and structure |
| >pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 | Back alignment and structure |
| >pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 | Back alignment and structure |
| >pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 | Back alignment and structure |
| >pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 | Back alignment and structure |
| >pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 | Back alignment and structure |
| >pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 | Back alignment and structure |
| >pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 | Back alignment and structure |
| >pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 | Back alignment and structure |
| >pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 | Back alignment and structure |
| >pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 | Back alignment and structure |
| >pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 | Back alignment and structure |
| >pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 | Back alignment and structure |
| >pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 | Back alignment and structure |
| >pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 | Back alignment and structure |
| >pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 | Back alignment and structure |
| >pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 | Back alignment and structure |
| >pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 | Back alignment and structure |
| >pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 | Back alignment and structure |
| >pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 | Back alignment and structure |
| >pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 | Back alignment and structure |
| >pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 | Back alignment and structure |
| >pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 | Back alignment and structure |
| >pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 | Back alignment and structure |
| >pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 | Back alignment and structure |
| >pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 | Back alignment and structure |
| >pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 | Back alignment and structure |
| >pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 | Back alignment and structure |
| >pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 | Back alignment and structure |
| >pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 | Back alignment and structure |
| >pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 | Back alignment and structure |
| >pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 | Back alignment and structure |
| >pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 | Back alignment and structure |
| >pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 | Back alignment and structure |
| >pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 | Back alignment and structure |
| >pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 | Back alignment and structure |
| >pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 | Back alignment and structure |
| >pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 | Back alignment and structure |
| >pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 | Back alignment and structure |
| >pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 | Back alignment and structure |
| >pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 | Back alignment and structure |
| >pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 | Back alignment and structure |
| >pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 | Back alignment and structure |
| >pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 | Back alignment and structure |
| >pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 | Back alignment and structure |
| >pdb|3JUH|A Chain A, Crystal Structure Of A Mutant Of Human Protein Kinase Ck2alpha With Altered Cosubstrate Specificity Length = 335 | Back alignment and structure |
| >pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 | Back alignment and structure |
| >pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 | Back alignment and structure |
| >pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 | Back alignment and structure |
| >pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 | Back alignment and structure |
| >pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 | Back alignment and structure |
| >pdb|3H30|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 With 5,6-Dichloro-1-Beta-D- Ribofuranosylbenzimidazole Length = 334 | Back alignment and structure |
| >pdb|2R7I|A Chain A, Crystal Structure Of Catalytic Subunit Of Protein Kinase Ck2 Length = 335 | Back alignment and structure |
| >pdb|3BQC|A Chain A, High Ph-Value Crystal Structure Of Emodin In Complex With The Catalytic Subunit Of Protein Kinase Ck2 Length = 335 | Back alignment and structure |
| >pdb|1PJK|A Chain A, Crystal Structure Of A C-terminal Deletion Mutant Of Human Protein Kinase Ck2 Catalytic Subunit Length = 334 | Back alignment and structure |
| >pdb|3NGA|A Chain A, Human Ck2 Catalytic Domain In Complex With Cx-4945 Length = 333 | Back alignment and structure |
| >pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 | Back alignment and structure |
| >pdb|3Q9W|A Chain A, Crystal Structure Of Human Ck2 Alpha In Complex With Emodin At Ph 8.5 Length = 336 | Back alignment and structure |
| >pdb|4DGL|C Chain C, Crystal Structure Of The Ck2 Tetrameric Holoenzyme Length = 335 | Back alignment and structure |
| >pdb|1NA7|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 Length = 329 | Back alignment and structure |
| >pdb|3Q04|A Chain A, Crystal Structure Of The Apo-Form Of Human Ck2 Alpha At Ph 8.5 Length = 328 | Back alignment and structure |
| >pdb|3NSZ|A Chain A, Human Ck2 Catalytic Domain In Complex With Amppn Length = 330 | Back alignment and structure |
| >pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 | Back alignment and structure |
| >pdb|1JWH|A Chain A, Crystal Structure Of Human Protein Kinase Ck2 Holoenzyme Length = 337 | Back alignment and structure |
| >pdb|3MB6|A Chain A, Human Ck2 Catalytic Domain In Complex With A Difurane Derivative Inhibitor (Cpa) Length = 331 | Back alignment and structure |
| >pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 | Back alignment and structure |
| >pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 | Back alignment and structure |
| >pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 | Back alignment and structure |
| >pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 | Back alignment and structure |
| >pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 | Back alignment and structure |
| >pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 | Back alignment and structure |
| >pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 | Back alignment and structure |
| >pdb|2ZJW|A Chain A, Crystal Structure Of Human Ck2 Alpha Complexed With Ellagic Acid Length = 340 | Back alignment and structure |
| >pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 | Back alignment and structure |
| >pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 | Back alignment and structure |
| >pdb|3U87|A Chain A, Structure Of A Chimeric Construct Of Human Ck2alpha And Human Ck2alpha' In Complex With A Non-hydrolysable Atp-analogue Length = 349 | Back alignment and structure |
| >pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 | Back alignment and structure |
| >pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 | Back alignment and structure |
| >pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 | Back alignment and structure |
| >pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 | Back alignment and structure |
| >pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 | Back alignment and structure |
| >pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 | Back alignment and structure |
| >pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 | Back alignment and structure |
| >pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 | Back alignment and structure |
| >pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 | Back alignment and structure |
| >pdb|3OFM|A Chain A, Structure Of A Human Ck2alpha Prime, The Paralog Isoform Of The Catalytic Subunit Of Protein Kinase Ck2 From Homo Sapiens Length = 350 | Back alignment and structure |
| >pdb|3E3B|X Chain X, Crystal Structure Of Catalytic Subunit Of Human Protein Kinase Ck2alpha Prime With A Potent Indazole-Derivative Inhibitor Length = 339 | Back alignment and structure |
| >pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 | Back alignment and structure |
| >pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 | Back alignment and structure |
| >pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 | Back alignment and structure |
| >pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 | Back alignment and structure |
| >pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 | Back alignment and structure |
| >pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 | Back alignment and structure |
| >pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 | Back alignment and structure |
| >pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 | Back alignment and structure |
| >pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 | Back alignment and structure |
| >pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 | Back alignment and structure |
| >pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 | Back alignment and structure |
| >pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 | Back alignment and structure |
| >pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 | Back alignment and structure |
| >pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 | Back alignment and structure |
| >pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 | Back alignment and structure |
| >pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 | Back alignment and structure |
| >pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 | Back alignment and structure |
| >pdb|2QC6|A Chain A, Protein Kinase Ck2 In Complex With Dbc Length = 332 | Back alignment and structure |
| >pdb|4DGN|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Luteolin Length = 326 | Back alignment and structure |
| >pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 | Back alignment and structure |
| >pdb|3PVG|A Chain A, Crystal Structure Of Z. Mays Ck2 Alpha Subunit In Complex With The Inhibitor 4,5,6,7-Tetrabromo-1-Carboxymethylbenzimidazole (K68) Length = 331 | Back alignment and structure |
| >pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 | Back alignment and structure |
| >pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 | Back alignment and structure |
| >pdb|4DGM|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Apigenin Length = 326 | Back alignment and structure |
| >pdb|3KXG|A Chain A, Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subunit In Complex With The Inhibitor 3,4,5,6,7-Pentabromo-1h-Indazole (K64) Length = 327 | Back alignment and structure |
| >pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 | Back alignment and structure |
| >pdb|4ANM|A Chain A, Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 | Back alignment and structure |
| >pdb|2PVH|A Chain A, Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]triazine Derivatives As Potent Inhibitors Of Protein Kinase Ck2 Length = 352 | Back alignment and structure |
| >pdb|1DS5|A Chain A, Dimeric Crystal Structure Of The Alpha Subunit In Complex With Two Beta Peptides Mimicking The Architecture Of The Tetrameric Protein Kinase Ck2 Holoenzyme. Length = 332 | Back alignment and structure |
| >pdb|1DAW|A Chain A, Crystal Structure Of A Binary Complex Of Protein Kinase Ck2 (Alpha-Subunit) And Mg-Amppnp Length = 327 | Back alignment and structure |
| >pdb|1M2P|A Chain A, Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- AnthraquinoneCK2 KINASE COMPLEX Length = 325 | Back alignment and structure |
| >pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 | Back alignment and structure |
| >pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 | Back alignment and structure |
| >pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 | Back alignment and structure |
| >pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 | Back alignment and structure |
| >pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 | Back alignment and structure |
| >pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 | Back alignment and structure |
| >pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 | Back alignment and structure |
| >pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 | Back alignment and structure |
| >pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 | Back alignment and structure |
| >pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 | Back alignment and structure |
| >pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 | Back alignment and structure |
| >pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 | Back alignment and structure |
| >pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 | Back alignment and structure |
| >pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 | Back alignment and structure |
| >pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 | Back alignment and structure |
| >pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 | Back alignment and structure |
| >pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 | Back alignment and structure |
| >pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 | Back alignment and structure |
| >pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 | Back alignment and structure |
| >pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 | Back alignment and structure |
| >pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 | Back alignment and structure |
| >pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 | Back alignment and structure |
| >pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 | Back alignment and structure |
| >pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 | Back alignment and structure |
| >pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 | Back alignment and structure |
| >pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 | Back alignment and structure |
| >pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 | Back alignment and structure |
| >pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 | Back alignment and structure |
| >pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 | Back alignment and structure |
| >pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 | Back alignment and structure |
| >pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 | Back alignment and structure |
| >pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 | Back alignment and structure |
| >pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 | Back alignment and structure |
| >pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 | Back alignment and structure |
| >pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 | Back alignment and structure |
| >pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 | Back alignment and structure |
| >pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 | Back alignment and structure |
| >pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 | Back alignment and structure |
| >pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 | Back alignment and structure |
| >pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 | Back alignment and structure |
| >pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 | Back alignment and structure |
| >pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 | Back alignment and structure |
| >pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 | Back alignment and structure |
| >pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 | Back alignment and structure |
| >pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 | Back alignment and structure |
| >pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 | Back alignment and structure |
| >pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 | Back alignment and structure |
| >pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 | Back alignment and structure |
| >pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 | Back alignment and structure |
| >pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 | Back alignment and structure |
| >pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 | Back alignment and structure |
| >pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 | Back alignment and structure |
| >pdb|3P1A|A Chain A, Structure Of Human Membrane-Associated Tyrosine- And Threonine- Specific Cdc2-Inhibitory Kinase Myt1 (Pkmyt1) Length = 311 | Back alignment and structure |
| >pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 | Back alignment and structure |
| >pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 | Back alignment and structure |
| >pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 | Back alignment and structure |
| >pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 | Back alignment and structure |
| >pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 | Back alignment and structure |
| >pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 | Back alignment and structure |
| >pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 | Back alignment and structure |
| >pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 | Back alignment and structure |
| >pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 | Back alignment and structure |
| >pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 | Back alignment and structure |
| >pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 | Back alignment and structure |
| >pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 | Back alignment and structure |
| >pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 | Back alignment and structure |
| >pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 | Back alignment and structure |
| >pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 | Back alignment and structure |
| >pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 | Back alignment and structure |
| >pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 | Back alignment and structure |
| >pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 | Back alignment and structure |
| >pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 | Back alignment and structure |
| >pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 | Back alignment and structure |
| >pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 | Back alignment and structure |
| >pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 | Back alignment and structure |
| >pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 | Back alignment and structure |
| >pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 | Back alignment and structure |
| >pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 | Back alignment and structure |
| >pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 | Back alignment and structure |
| >pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 | Back alignment and structure |
| >pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 | Back alignment and structure |
| >pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 | Back alignment and structure |
| >pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 | Back alignment and structure |
| >pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 | Back alignment and structure |
| >pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 | Back alignment and structure |
| >pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 | Back alignment and structure |
| >pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 | Back alignment and structure |
| >pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 | Back alignment and structure |
| >pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 | Back alignment and structure |
| >pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 | Back alignment and structure |
| >pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 | Back alignment and structure |
| >pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 | Back alignment and structure |
| >pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 | Back alignment and structure |
| >pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 | Back alignment and structure |
| >pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 | Back alignment and structure |
| >pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 | Back alignment and structure |
| >pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 | Back alignment and structure |
| >pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 | Back alignment and structure |
| >pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 | Back alignment and structure |
| >pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 | Back alignment and structure |
| >pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 | Back alignment and structure |
| >pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 | Back alignment and structure |
| >pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 | Back alignment and structure |
| >pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 | Back alignment and structure |
| >pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 | Back alignment and structure |
| >pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 | Back alignment and structure |
| >pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 | Back alignment and structure |
| >pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 | Back alignment and structure |
| >pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 | Back alignment and structure |
| >pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 | Back alignment and structure |
| >pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 | Back alignment and structure |
| >pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 | Back alignment and structure |
| >pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 | Back alignment and structure |
| >pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 | Back alignment and structure |
| >pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 | Back alignment and structure |
| >pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 | Back alignment and structure |
| >pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 | Back alignment and structure |
| >pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 | Back alignment and structure |
| >pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 | Back alignment and structure |
| >pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 | Back alignment and structure |
| >pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 | Back alignment and structure |
| >pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 | Back alignment and structure |
| >pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 | Back alignment and structure |
| >pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 | Back alignment and structure |
| >pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 | Back alignment and structure |
| >pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 | Back alignment and structure |
| >pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 | Back alignment and structure |
| >pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 | Back alignment and structure |
| >pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 | Back alignment and structure |
| >pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 | Back alignment and structure |
| >pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 | Back alignment and structure |
| >pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 | Back alignment and structure |
| >pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 | Back alignment and structure |
| >pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 | Back alignment and structure |
| >pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 | Back alignment and structure |
| >pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 | Back alignment and structure |
| >pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 | Back alignment and structure |
| >pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 | Back alignment and structure |
| >pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 | Back alignment and structure |
| >pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 | Back alignment and structure |
| >pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 | Back alignment and structure |
| >pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 | Back alignment and structure |
| >pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 | Back alignment and structure |
| >pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|3RGF|A Chain A, Crystal Structure Of Human Cdk8CYCC Length = 405 | Back alignment and structure |
| >pdb|3UIB|A Chain A, Map Kinase Lmampk10 From Leishmania Major In Complex With Sb203580 Length = 362 | Back alignment and structure |
| >pdb|3PG1|A Chain A, Map Kinase Lmampk10 From Leishmania Major (1.95 Angs Resolution) Length = 362 | Back alignment and structure |
| >pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 | Back alignment and structure |
| >pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 | Back alignment and structure |
| >pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 | Back alignment and structure |
| >pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 | Back alignment and structure |
| >pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 | Back alignment and structure |
| >pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 | Back alignment and structure |
| >pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 | Back alignment and structure |
| >pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 | Back alignment and structure |
| >pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 | Back alignment and structure |
| >pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 | Back alignment and structure |
| >pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 | Back alignment and structure |
| >pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 | Back alignment and structure |
| >pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 | Back alignment and structure |
| >pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 | Back alignment and structure |
| >pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 | Back alignment and structure |
| >pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 | Back alignment and structure |
| >pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 | Back alignment and structure |
| >pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 | Back alignment and structure |
| >pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 | Back alignment and structure |
| >pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 | Back alignment and structure |
| >pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 | Back alignment and structure |
| >pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 | Back alignment and structure |
| >pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 | Back alignment and structure |
| >pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 | Back alignment and structure |
| >pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 | Back alignment and structure |
| >pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 | Back alignment and structure |
| >pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 | Back alignment and structure |
| >pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 | Back alignment and structure |
| >pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 | Back alignment and structure |
| >pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 | Back alignment and structure |
| >pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 | Back alignment and structure |
| >pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 | Back alignment and structure |
| >pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 | Back alignment and structure |
| >pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 | Back alignment and structure |
| >pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 | Back alignment and structure |
| >pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 | Back alignment and structure |
| >pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 | Back alignment and structure |
| >pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 | Back alignment and structure |
| >pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 | Back alignment and structure |
| >pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 | Back alignment and structure |
| >pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 | Back alignment and structure |
| >pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 | Back alignment and structure |
| >pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 | Back alignment and structure |
| >pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 | Back alignment and structure |
| >pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 | Back alignment and structure |
| >pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 | Back alignment and structure |
| >pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 | Back alignment and structure |
| >pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 | Back alignment and structure |
| >pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 | Back alignment and structure |
| >pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 | Back alignment and structure |
| >pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 | Back alignment and structure |
| >pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum In Complex With Indirubin E804 Length = 383 | Back alignment and structure |
| >pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 | Back alignment and structure |
| >pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 | Back alignment and structure |
| >pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 | Back alignment and structure |
| >pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 | Back alignment and structure |
| >pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 | Back alignment and structure |
| >pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 | Back alignment and structure |
| >pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 | Back alignment and structure |
| >pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 | Back alignment and structure |
| >pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 | Back alignment and structure |
| >pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 | Back alignment and structure |
| >pdb|3PP0|A Chain A, Crystal Structure Of The Kinase Domain Of Human Her2 (Erbb2). Length = 338 | Back alignment and structure |
| >pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 | Back alignment and structure |
| >pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 | Back alignment and structure |
| >pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 | Back alignment and structure |
| >pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 | Back alignment and structure |
| >pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 | Back alignment and structure |
| >pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 | Back alignment and structure |
| >pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 | Back alignment and structure |
| >pdb|2XIX|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-1 From Crystallographic Fragment Screen Length = 301 | Back alignment and structure |
| >pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 | Back alignment and structure |
| >pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 | Back alignment and structure |
| >pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 | Back alignment and structure |
| >pdb|2XIY|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-2 From Crystallographic Fragment Screen Length = 301 | Back alignment and structure |
| >pdb|4A7C|A Chain A, Crystal Structure Of Pim1 Kinase With Etp46546 Length = 308 | Back alignment and structure |
| >pdb|2XJ0|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-4 From Crystallographic Fragment Screen Length = 301 | Back alignment and structure |
| >pdb|3A99|A Chain A, Structure Of Pim-1 Kinase Crystallized In The Presence Of P27kip1 Carboxy-Terminal Peptide Length = 320 | Back alignment and structure |
| >pdb|3F2A|A Chain A, Crystal Structure Of Human Pim-1 In Complex With Dappa Length = 300 | Back alignment and structure |
| >pdb|1YHS|A Chain A, Crystal Structure Of Pim-1 Bound To Staurosporine Length = 273 | Back alignment and structure |
| >pdb|4AS0|A Chain A, Cyclometalated Phthalimides As Protein Kinase Inhibitors Length = 273 | Back alignment and structure |
| >pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 | Back alignment and structure |
| >pdb|2OBJ|A Chain A, Crystal Structure Of Human Pim-1 Kinase In Complex With Inhibitor Length = 333 | Back alignment and structure |
| >pdb|1XQZ|A Chain A, Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolution Length = 300 | Back alignment and structure |
| >pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 | Back alignment and structure |
| >pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 | Back alignment and structure |
| >pdb|3C4E|A Chain A, Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7- Azaindole Length = 273 | Back alignment and structure |
| >pdb|3DCV|A Chain A, Crystal Structure Of Human Pim1 Kinase Complexed With 4-(4- Hydroxy-3-Methyl-Phenyl)-6-Phenylpyrimidin-2(1h)-One Length = 328 | Back alignment and structure |
| >pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 | Back alignment and structure |
| >pdb|1YWV|A Chain A, Crystal Structures Of Proto-Oncogene Kinase Pim1: A Target Of Aberrant Somatic Hypermutations In Diffuse Large Cell Lymphoma Length = 293 | Back alignment and structure |
| >pdb|3R00|A Chain A, The Discovery Of Novel Benzofuran-2-Carboxylic Acids As Potent Pim-1 Inhibitors Length = 299 | Back alignment and structure |
| >pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 | Back alignment and structure |
| >pdb|4DTK|A Chain A, Novel And Selective Pan-Pim Kinase Inhibitor Length = 276 | Back alignment and structure |
| >pdb|3JXW|A Chain A, Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4-Ones As Potent, Highly Selective And Orally Bioavailable Pim Kinases Inhibitors Length = 294 | Back alignment and structure |
| >pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 | Back alignment and structure |
| >pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 | Back alignment and structure |
| >pdb|1YXS|A Chain A, Crystal Structure Of Kinase Pim1 With P123m Mutation Length = 293 | Back alignment and structure |
| >pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 | Back alignment and structure |
| >pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 | Back alignment and structure |
| >pdb|3UIX|A Chain A, Crystal Structure Of Pim1 Kinase In Complex With Small Molecule Inhibitor Length = 298 | Back alignment and structure |
| >pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 | Back alignment and structure |
| >pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 | Back alignment and structure |
| >pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 | Back alignment and structure |
| >pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 | Back alignment and structure |
| >pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 | Back alignment and structure |
| >pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 | Back alignment and structure |
| >pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 | Back alignment and structure |
| >pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 | Back alignment and structure |
| >pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 | Back alignment and structure |
| >pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 | Back alignment and structure |
| >pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 | Back alignment and structure |
| >pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 | Back alignment and structure |
| >pdb|3JPV|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Pyrrolo[2,3- A]carbazole Ligand Length = 313 | Back alignment and structure |
| >pdb|4ALV|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 | Back alignment and structure |
| >pdb|2BIL|B Chain B, The Human Protein Kinase Pim1 In Complex With Its Consensus Peptide Pimtide Length = 313 | Back alignment and structure |
| >pdb|3CY3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And The Jnk Inhibitor V Length = 314 | Back alignment and structure |
| >pdb|3CXW|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Beta Carboline Ligand I Length = 314 | Back alignment and structure |
| >pdb|3FPQ|A Chain A, Crystal Structure Of The Kinase Domain Of Wnk1 Length = 290 | Back alignment and structure |
| >pdb|3MA3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Naphtho-Difuran Ligand Length = 313 | Back alignment and structure |
| >pdb|2J2I|B Chain B, Crystal Structure Of The Humab Pim1 In Complex With Ly333531 Length = 312 | Back alignment and structure |
| >pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 | Back alignment and structure |
| >pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 | Back alignment and structure |
| >pdb|2BIK|B Chain B, Human Pim1 Phosphorylated On Ser261 Length = 313 | Back alignment and structure |
| >pdb|1XWS|A Chain A, Crystal Structure Of The Human Pim1 Kinase Domain Length = 313 | Back alignment and structure |
| >pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 | Back alignment and structure |
| >pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|4ALU|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 | Back alignment and structure |
| >pdb|3Q4T|A Chain A, Crystal Structure Of Activin Receptor Type-Iia (Acvr2a) Kinase Domain In Complex With Dorsomorphin Length = 322 | Back alignment and structure |
| >pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 | Back alignment and structure |
| >pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 | Back alignment and structure |
| >pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 | Back alignment and structure |
| >pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 | Back alignment and structure |
| >pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 | Back alignment and structure |
| >pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 | Back alignment and structure |
| >pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 | Back alignment and structure |
| >pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 | Back alignment and structure |
| >pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 | Back alignment and structure |
| >pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 | Back alignment and structure |
| >pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 | Back alignment and structure |
| >pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 | Back alignment and structure |
| >pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 | Back alignment and structure |
| >pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 | Back alignment and structure |
| >pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 | Back alignment and structure |
| >pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 | Back alignment and structure |
| >pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 | Back alignment and structure |
| >pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 | Back alignment and structure |
| >pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 | Back alignment and structure |
| >pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 | Back alignment and structure |
| >pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 | Back alignment and structure |
| >pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 | Back alignment and structure |
| >pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 | Back alignment and structure |
| >pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 | Back alignment and structure |
| >pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 | Back alignment and structure |
| >pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 | Back alignment and structure |
| >pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 | Back alignment and structure |
| >pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 | Back alignment and structure |
| >pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 | Back alignment and structure |
| >pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 | Back alignment and structure |
| >pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 | Back alignment and structure |
| >pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 | Back alignment and structure |
| >pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 | Back alignment and structure |
| >pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 | Back alignment and structure |
| >pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 | Back alignment and structure |
| >pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 | Back alignment and structure |
| >pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 | Back alignment and structure |
| >pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 | Back alignment and structure |
| >pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 | Back alignment and structure |
| >pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 | Back alignment and structure |
| >pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 | Back alignment and structure |
| >pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 | Back alignment and structure |
| >pdb|3KGA|A Chain A, Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexed With A Potent 3-Aminopyrazole Atp Site Inhibitor Length = 299 | Back alignment and structure |
| >pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 | Back alignment and structure |
| >pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 | Back alignment and structure |
| >pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 | Back alignment and structure |
| >pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 | Back alignment and structure |
| >pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 | Back alignment and structure |
| >pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 | Back alignment and structure |
| >pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 | Back alignment and structure |
| >pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 | Back alignment and structure |
| >pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 | Back alignment and structure |
| >pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 | Back alignment and structure |
| >pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 | Back alignment and structure |
| >pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 | Back alignment and structure |
| >pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 | Back alignment and structure |
| >pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 | Back alignment and structure |
| >pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 | Back alignment and structure |
| >pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 | Back alignment and structure |
| >pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 | Back alignment and structure |
| >pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 | Back alignment and structure |
| >pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 | Back alignment and structure |
| >pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 | Back alignment and structure |
| >pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 | Back alignment and structure |
| >pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 | Back alignment and structure |
| >pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 | Back alignment and structure |
| >pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 | Back alignment and structure |
| >pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 | Back alignment and structure |
| >pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 | Back alignment and structure |
| >pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 | Back alignment and structure |
| >pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 | Back alignment and structure |
| >pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 | Back alignment and structure |
| >pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 | Back alignment and structure |
| >pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 | Back alignment and structure |
| >pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 | Back alignment and structure |
| >pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 | Back alignment and structure |
| >pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 | Back alignment and structure |
| >pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 | Back alignment and structure |
| >pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 | Back alignment and structure |
| >pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 | Back alignment and structure |
| >pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 | Back alignment and structure |
| >pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 | Back alignment and structure |
| >pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 | Back alignment and structure |
| >pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 | Back alignment and structure |
| >pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 | Back alignment and structure |
| >pdb|1Z57|A Chain A, Crystal Structure Of Human Clk1 In Complex With 10z-Hymenialdisine Length = 339 | Back alignment and structure |
| >pdb|3E3P|A Chain A, Glycogen Synthase Kinase From Leishmania Major Length = 360 | Back alignment and structure |
| >pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 | Back alignment and structure |
| >pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 | Back alignment and structure |
| >pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 | Back alignment and structure |
| >pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 | Back alignment and structure |
| >pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 | Back alignment and structure |
| >pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 | Back alignment and structure |
| >pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 | Back alignment and structure |
| >pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 | Back alignment and structure |
| >pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 | Back alignment and structure |
| >pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 | Back alignment and structure |
| >pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 | Back alignment and structure |
| >pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 | Back alignment and structure |
| >pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 | Back alignment and structure |
| >pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 | Back alignment and structure |
| >pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 | Back alignment and structure |
| >pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 | Back alignment and structure |
| >pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 | Back alignment and structure |
| >pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 | Back alignment and structure |
| >pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 | Back alignment and structure |
| >pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 | Back alignment and structure |
| >pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 | Back alignment and structure |
| >pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 | Back alignment and structure |
| >pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 | Back alignment and structure |
| >pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 | Back alignment and structure |
| >pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 | Back alignment and structure |
| >pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 | Back alignment and structure |
| >pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 | Back alignment and structure |
| >pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 | Back alignment and structure |
| >pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 | Back alignment and structure |
| >pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 | Back alignment and structure |
| >pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 | Back alignment and structure |
| >pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 | Back alignment and structure |
| >pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 | Back alignment and structure |
| >pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 | Back alignment and structure |
| >pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 | Back alignment and structure |
| >pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 | Back alignment and structure |
| >pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 | Back alignment and structure |
| >pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 | Back alignment and structure |
| >pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 | Back alignment and structure |
| >pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 | Back alignment and structure |
| >pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 | Back alignment and structure |
| >pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 | Back alignment and structure |
| >pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 | Back alignment and structure |
| >pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 | Back alignment and structure |
| >pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 | Back alignment and structure |
| >pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 | Back alignment and structure |
| >pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 | Back alignment and structure |
| >pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 | Back alignment and structure |
| >pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 | Back alignment and structure |
| >pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 | Back alignment and structure |
| >pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 | Back alignment and structure |
| >pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 | Back alignment and structure |
| >pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 | Back alignment and structure |
| >pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 | Back alignment and structure |
| >pdb|2IWI|A Chain A, Crystal Structure Of The Human Pim2 In Complex With A Ruthenium Organometallic Ligand Ru1 Length = 312 | Back alignment and structure |
| >pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 | Back alignment and structure |
| >pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 | Back alignment and structure |
| >pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 | Back alignment and structure |
| >pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 | Back alignment and structure |
| >pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 | Back alignment and structure |
| >pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 | Back alignment and structure |
| >pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 | Back alignment and structure |
| >pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 | Back alignment and structure |
| >pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 | Back alignment and structure |
| >pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 | Back alignment and structure |
| >pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 | Back alignment and structure |
| >pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 | Back alignment and structure |
| >pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 | Back alignment and structure |
| >pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 | Back alignment and structure |
| >pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 | Back alignment and structure |
| >pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 | Back alignment and structure |
| >pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 | Back alignment and structure |
| >pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 | Back alignment and structure |
| >pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 | Back alignment and structure |
| >pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 | Back alignment and structure |
| >pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 | Back alignment and structure |
| >pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 | Back alignment and structure |
| >pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 | Back alignment and structure |
| >pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 | Back alignment and structure |
| >pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 | Back alignment and structure |
| >pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 | Back alignment and structure |
| >pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 | Back alignment and structure |
| >pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 | Back alignment and structure |
| >pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 | Back alignment and structure |
| >pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 | Back alignment and structure |
| >pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 | Back alignment and structure |
| >pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 | Back alignment and structure |
| >pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 | Back alignment and structure |
| >pdb|3EMG|A Chain A, Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylaminopyrimidines As Potent Inhibitors Of Spleen Tyrosine Kinase (Syk) Length = 291 | Back alignment and structure |
| >pdb|3TUB|A Chain A, Crystal Structure Of Syk Kinase Domain With 1-(5-(6,7- Dimethoxyquinolin-4-Yloxy)pyridin-2-Yl)-3-((1r,2s)-2- Phenylcyclopropyl)urea Length = 293 | Back alignment and structure |
| >pdb|3SV0|A Chain A, Crystal Structure Of Casein Kinase-1 Like Protein In Plant Length = 483 | Back alignment and structure |
| >pdb|3VF8|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Syk Catalytic Domain With Pyrazolylbenzimidazole Inhibitor 416 Length = 299 | Back alignment and structure |
| >pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 | Back alignment and structure |
| >pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 | Back alignment and structure |
| >pdb|3GOP|A Chain A, Crystal Structure Of The Egf Receptor Juxtamembrane And Kinase Domains Length = 361 | Back alignment and structure |
| >pdb|1XBA|A Chain A, Crystal Structure Of Apo Syk Tyrosine Kinase Domain Length = 291 | Back alignment and structure |
| >pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 | Back alignment and structure |
| >pdb|3SRV|B Chain B, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 | Back alignment and structure |
| >pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 | Back alignment and structure |
| >pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 | Back alignment and structure |
| >pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 | Back alignment and structure |
| >pdb|4DFL|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Complexed With A Sulfonamidopyrazine Piperidine Inhibitor Length = 274 | Back alignment and structure |
| >pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 | Back alignment and structure |
| >pdb|4F4P|A Chain A, Syk In Complex With Ligand Lasw836 Length = 273 | Back alignment and structure |
| >pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 | Back alignment and structure |
| >pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 | Back alignment and structure |
| >pdb|2EB2|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (G719s) Length = 334 | Back alignment and structure |
| >pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 | Back alignment and structure |
| >pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 | Back alignment and structure |
| >pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 | Back alignment and structure |
| >pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 | Back alignment and structure |
| >pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 | Back alignment and structure |
| >pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 | Back alignment and structure |
| >pdb|3UG1|A Chain A, Crystal Structure Of The Mutated Egfr Kinase Domain (G719sT790M) IN The Apo Form Length = 334 | Back alignment and structure |
| >pdb|2ITN|A Chain A, Crystal Structure Of Egfr Kinase Domain G719s Mutation In Complex With Amp-Pnp Length = 327 | Back alignment and structure |
| >pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 | Back alignment and structure |
| >pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 | Back alignment and structure |
| >pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 | Back alignment and structure |
| >pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 | Back alignment and structure |
| >pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 | Back alignment and structure |
| >pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 | Back alignment and structure |
| >pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 | Back alignment and structure |
| >pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 | Back alignment and structure |
| >pdb|3LZB|A Chain A, Egfr Kinase Domain Complexed With An Imidazo[2,1-B]thiazole Inhibitor Length = 327 | Back alignment and structure |
| >pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 | Back alignment and structure |
| >pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 | Back alignment and structure |
| >pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 85 | |||
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 2e-38 | |
| 4apc_A | 350 | Serine/threonine-protein kinase NEK1; transferase; | 3e-38 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 2e-37 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 8e-37 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 1e-33 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 3e-33 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 5e-31 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 4e-30 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 3e-28 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 2e-27 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 3e-25 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 3e-25 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 9e-25 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 2e-24 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 3e-23 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 3e-23 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 4e-23 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 5e-23 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 6e-23 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 8e-23 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 9e-23 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 1e-22 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 1e-22 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 2e-22 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 2e-22 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 3e-22 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 3e-22 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 4e-22 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 6e-22 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 8e-22 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 1e-21 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 2e-21 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 3e-21 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 3e-21 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 4e-21 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 4e-21 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 4e-21 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 9e-21 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 2e-20 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 2e-20 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 3e-20 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 3e-20 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 3e-20 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 5e-20 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 5e-20 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 6e-20 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 6e-20 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 7e-20 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 1e-19 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 1e-19 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 1e-19 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 1e-19 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 1e-19 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 1e-19 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 1e-19 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 1e-19 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 1e-19 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 2e-19 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 2e-19 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 2e-19 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 2e-19 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 3e-19 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 3e-19 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 4e-19 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 5e-19 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 5e-19 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 6e-19 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 6e-19 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 7e-19 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 7e-19 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 7e-19 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 7e-19 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 8e-19 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 8e-19 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 8e-19 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 8e-19 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 1e-18 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 1e-18 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 1e-18 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 1e-18 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 1e-18 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 2e-18 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 2e-18 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 2e-18 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 2e-18 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 2e-18 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 2e-18 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 2e-18 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 2e-18 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 2e-18 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 2e-18 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 2e-18 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 3e-18 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 3e-18 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 3e-18 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 3e-18 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 4e-18 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 4e-18 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 4e-18 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 5e-18 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 5e-18 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 5e-18 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 7e-18 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 7e-18 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 9e-18 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 1e-17 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 1e-17 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 1e-17 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 1e-17 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 2e-17 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 2e-17 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 2e-17 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 2e-17 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 3e-17 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 3e-17 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 3e-17 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 3e-17 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 3e-17 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 3e-17 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 5e-17 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 5e-17 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 5e-17 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 6e-17 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 6e-17 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 7e-17 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 8e-17 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 9e-17 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 1e-16 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 1e-16 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 1e-16 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 2e-16 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 2e-16 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 2e-16 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 2e-16 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 2e-16 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 2e-16 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 4e-16 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 6e-16 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 7e-16 | |
| 1uu3_A | 310 | HPDK1, 3-phosphoinositide dependent protein kinase | 7e-16 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 9e-16 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 1e-15 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 1e-15 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 1e-15 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 2e-15 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 3e-15 | |
| 3pvu_A | 695 | Beta-adrenergic receptor kinase 1; transferase, se | 4e-15 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 5e-15 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 5e-15 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 5e-15 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 6e-15 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 9e-15 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 5e-14 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 1e-13 | |
| 3g51_A | 325 | Ribosomal protein S6 kinase alpha-3; N-terminal ki | 2e-13 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 2e-13 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 3e-13 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 3e-13 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 3e-13 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 3e-13 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 4e-13 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 5e-13 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 6e-13 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 6e-13 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 7e-13 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 4e-12 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 1e-11 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 4e-11 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 8e-11 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 4e-10 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 6e-10 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 1e-09 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 2e-09 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 2e-09 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 2e-09 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 5e-09 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 5e-09 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 6e-09 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 6e-09 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 6e-09 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 7e-09 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 7e-09 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 8e-09 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 1e-08 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 1e-08 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 1e-08 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 2e-08 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 2e-08 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 3e-08 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 3e-08 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 3e-08 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 3e-08 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 3e-08 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 3e-08 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 3e-08 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 3e-08 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 3e-08 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 3e-08 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 4e-08 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 4e-08 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 4e-08 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 6e-08 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 6e-08 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 8e-08 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 1e-07 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 2e-07 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 2e-07 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 2e-07 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 3e-07 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 3e-07 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 3e-07 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 3e-07 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 3e-07 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 3e-07 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 4e-07 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 4e-07 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 4e-07 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 4e-07 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 8e-07 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 8e-07 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 8e-07 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 2e-06 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 2e-06 | |
| 3zzw_A | 289 | Tyrosine-protein kinase transmembrane receptor RO; | 3e-06 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 5e-06 | |
| 3v5q_A | 297 | NT-3 growth factor receptor; kinase domain, kinase | 5e-06 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 5e-06 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 1e-05 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 2e-05 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 4e-05 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 5e-05 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 2e-04 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 3e-04 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 3e-04 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 5e-04 |
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 | Back alignment and structure |
|---|
Score = 128 bits (324), Expect = 2e-38
Identities = 38/78 (48%), Positives = 52/78 (66%)
Query: 8 ETEQYLDERFIWKVLYQLSKALQVCHSSCILHRDIKPANVFLDENNNVKLGDFGLARILN 67
+ ++ + ER +WK QL AL+ HS ++HRDIKPANVF+ VKLGD GL R +
Sbjct: 128 KQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFS 187
Query: 68 MNESHSYTLVGTPYYMSP 85
+ +++LVGTPYYMSP
Sbjct: 188 SKTTAAHSLVGTPYYMSP 205
|
| >4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 | Back alignment and structure |
|---|
| >1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 | Back alignment and structure |
|---|
| >3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 | Back alignment and structure |
|---|
| >3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 | Back alignment and structure |
|---|
| >3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 | Back alignment and structure |
|---|
| >3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 85 | |||
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.87 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.86 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 99.86 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 99.86 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 99.85 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 99.84 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 99.82 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 99.81 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 99.81 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 99.8 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 99.8 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 99.79 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 99.78 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 99.77 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 99.76 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 99.76 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 99.76 | |
| 3hmm_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.76 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 99.73 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.71 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 99.71 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 99.71 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.7 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 99.69 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 99.68 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 99.68 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 99.68 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 99.67 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 99.67 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 99.67 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 99.67 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 99.67 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 99.66 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 99.66 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 99.66 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 99.66 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 99.66 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 99.66 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.65 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 99.65 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 99.65 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 99.64 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 99.64 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 99.64 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 99.64 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 99.64 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 99.63 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 99.63 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 99.63 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 99.63 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 99.63 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 99.62 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 99.62 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 99.62 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 99.62 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 99.62 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 99.62 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 99.61 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 99.61 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 99.61 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 99.61 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 99.61 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 99.61 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 99.6 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 99.6 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 99.6 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 99.6 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 99.6 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 99.6 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 99.6 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 99.59 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 99.59 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 99.59 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 99.59 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 99.59 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 99.59 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 99.59 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 99.59 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 99.58 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 99.58 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 99.58 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 99.58 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 99.58 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 99.58 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 99.58 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 99.58 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 99.58 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 99.57 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 99.57 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 99.57 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 99.57 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 99.57 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 99.57 | |
| 4hgt_A | 296 | Casein kinase I isoform delta; CK1D, inhibitor, tr | 99.57 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 99.57 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 99.57 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 99.57 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 99.57 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 99.56 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 99.56 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 99.56 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 99.56 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 99.56 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 99.55 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 99.55 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 99.55 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 99.55 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 99.55 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 99.55 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 99.55 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 99.55 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 99.55 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 99.55 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.55 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 99.55 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 99.55 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 99.55 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 99.55 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 99.54 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 99.54 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 99.54 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 99.54 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 99.54 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 99.54 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 99.54 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 99.54 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 99.54 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 99.54 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 99.54 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.54 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 99.54 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 99.54 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 99.53 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 99.53 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 99.53 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 99.53 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 99.53 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 99.53 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 99.53 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 99.53 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.52 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.52 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 99.52 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 99.52 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 99.52 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 99.52 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 99.52 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 99.52 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 99.52 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 99.52 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 99.52 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.52 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 99.52 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 99.52 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 99.52 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 99.51 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 99.51 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.51 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 99.51 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 99.51 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 99.51 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 99.51 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 99.51 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.51 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 99.5 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 99.5 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 99.5 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.5 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.5 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.5 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 99.5 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 99.5 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 99.5 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 99.5 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 99.5 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 99.49 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 99.49 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 99.49 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 99.49 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 99.49 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 99.49 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 99.49 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 99.49 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 99.49 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 99.49 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.49 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 99.49 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 99.49 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 99.49 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 99.48 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 99.48 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.48 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 99.48 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 99.48 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 99.48 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 99.48 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 99.48 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 99.48 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 99.48 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 99.47 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 99.46 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 99.46 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 99.46 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 99.46 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 99.46 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 99.46 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 99.46 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 99.46 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 99.46 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 99.46 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 99.45 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 99.45 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 99.45 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 99.45 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 99.45 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 99.45 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 99.45 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.45 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 99.44 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 99.44 | |
| 4hcu_A | 269 | Tyrosine-protein kinase ITK/TSK; transferase-trans | 99.44 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 99.44 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 99.44 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 99.44 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.44 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 99.44 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 99.43 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 99.43 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 99.43 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 99.43 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 99.42 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 99.42 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 99.41 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 99.41 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.41 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 99.41 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 99.41 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 99.4 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 99.4 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 99.39 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 99.39 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 99.39 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.38 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 99.38 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 99.38 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 99.37 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 99.35 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 99.34 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 99.33 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 99.32 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 99.28 | |
| 1zar_A | 282 | RIO2 kinase; serine kinase, winged-helix, RIO doma | 99.13 | |
| 1zth_A | 258 | RIO1 serine protein kinase; ribosome biogenesis, r | 99.05 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 98.82 | |
| 4gyi_A | 397 | RIO2 kinase; protein kinase, ADP complex, phosphoa | 98.45 | |
| 3dxp_A | 359 | Putative acyl-COA dehydrogenase; protein kinase-li | 96.64 | |
| 1nd4_A | 264 | Aminoglycoside 3'-phosphotransferase; protein kina | 96.26 | |
| 3tm0_A | 263 | Aminoglycoside 3'-phosphotransferase; protein kina | 96.26 | |
| 2q83_A | 346 | YTAA protein; 2635576, structural genomics, joint | 94.09 | |
| 3sg8_A | 304 | APH(2'')-ID; antibiotic resistance enzyme, transfe | 93.65 | |
| 3r70_A | 320 | Aminoglycoside phosphotransferase; structural geno | 92.23 | |
| 2pyw_A | 420 | Uncharacterized protein; 5-methylthioribose kinase | 90.57 | |
| 4gkh_A | 272 | Aminoglycoside 3'-phosphotransferase APHA1-IAB; py | 85.4 | |
| 2ppq_A | 322 | HSK, HK, homoserine kinase; structural genomics, M | 84.58 | |
| 3tdw_A | 306 | Gentamicin resistance protein; kinase, phosphoryl | 83.97 | |
| 3csv_A | 333 | Aminoglycoside phosphotransferase; YP_614837.1, ph | 82.4 | |
| 3ovc_A | 362 | Hygromycin-B 4-O-kinase; aminoglycoside phosphotra | 80.86 |
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
Probab=99.87 E-value=6e-22 Score=111.70 Aligned_cols=75 Identities=36% Similarity=0.631 Sum_probs=68.2
Q ss_pred ccCCHHHHHHHHHHHHHHHHHHHhCCcEeccCCCCcEEeCCCCCEEEeeecceEEecCCCCCcccccccCcccCC
Q psy2485 11 QYLDERFIWKVLYQLSKALQVCHSSCILHRDIKPANVFLDENNNVKLGDFGLARILNMNESHSYTLVGTPYYMSP 85 (85)
Q Consensus 11 ~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~l~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~y~ap 85 (85)
..++++.+..++.|++.|+.|+|+++++|||+|++|+++..++.++++|||++..+........+.+||+.||||
T Consensus 165 ~~l~e~~~~~~~~qi~~aL~ylH~~~IiHRDlKp~NILl~~~g~vKl~DFGla~~~~~~~~~~~~~~GTp~YmAP 239 (346)
T 4fih_A 165 TRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAP 239 (346)
T ss_dssp SCCCHHHHHHHHHHHHHHHHHHHHTTEECCCCSGGGEEECTTCCEEECCCTTCEECCSSSCCBCCCCSCGGGCCH
T ss_pred CCCCHHHHHHHHHHHHHHHHHHHHCCcccccCCHHHEEECCCCCEEEecCcCceecCCCCCcccccccCcCcCCH
Confidence 468999999999999999999999999999999999999999999999999999876555455567899999998
|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* | Back alignment and structure |
|---|
| >1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A | Back alignment and structure |
|---|
| >3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 | Back alignment and structure |
|---|
| >3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* | Back alignment and structure |
|---|
| >2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A | Back alignment and structure |
|---|
| >2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* | Back alignment and structure |
|---|
| >2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 | Back alignment and structure |
|---|
| >3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* | Back alignment and structure |
|---|
| >3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 85 | ||||
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 9e-25 | |
| d2java1 | 269 | d.144.1.7 (A:3-271) Serine/threonine-protein kinas | 3e-24 | |
| d2j4za1 | 263 | d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur | 1e-23 | |
| d1nvra_ | 271 | d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { | 2e-22 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 2e-22 | |
| d1u5ra_ | 309 | d.144.1.7 (A:) Serine/threonine protein kinase TAO | 2e-22 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 5e-22 | |
| d1yhwa1 | 293 | d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ | 3e-21 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 3e-21 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 5e-20 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 7e-20 | |
| d1phka_ | 277 | d.144.1.7 (A:) gamma-subunit of glycogen phosphory | 2e-19 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 5e-19 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 7e-19 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 2e-18 | |
| d1pmea_ | 345 | d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien | 2e-18 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 2e-18 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 5e-18 | |
| d1koaa2 | 350 | d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C | 5e-18 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 6e-18 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 8e-18 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 1e-17 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 1e-17 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 2e-17 | |
| d1ua2a_ | 299 | d.144.1.7 (A:) Cell division protein kinase 7, CDK | 2e-17 | |
| d1ywna1 | 299 | d.144.1.7 (A:818-1166) Vascular endothelial growth | 3e-17 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 3e-17 | |
| d1xbba_ | 277 | d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human | 3e-17 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 3e-17 | |
| d3blha1 | 318 | d.144.1.7 (A:8-325) Cell division protein kinase 9 | 4e-17 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 4e-17 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 7e-17 | |
| d2ozaa1 | 335 | d.144.1.7 (A:51-385) MAP kinase activated protein | 8e-17 | |
| d1xwsa_ | 273 | d.144.1.7 (A:) Proto-oncogene serine/threonine-pro | 9e-17 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 1e-16 | |
| d1ob3a_ | 286 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod | 1e-16 | |
| d1koba_ | 352 | d.144.1.7 (A:) Twitchin, kinase domain {California | 1e-16 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 1e-16 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 2e-16 | |
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 2e-16 | |
| d1blxa_ | 305 | d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H | 2e-16 | |
| d1gz8a_ | 298 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H | 3e-16 | |
| d1unla_ | 292 | d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H | 3e-16 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 3e-16 | |
| d3bqca1 | 328 | d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu | 5e-16 | |
| d1vjya_ | 303 | d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human | 7e-16 | |
| d1tkia_ | 321 | d.144.1.7 (A:) Titin, kinase domain {Human (Homo s | 8e-16 | |
| d1q5ka_ | 350 | d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs | 1e-15 | |
| d1a06a_ | 307 | d.144.1.7 (A:) Calmodulin-dependent protein kinase | 3e-15 | |
| d1csna_ | 293 | d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast | 4e-15 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 4e-15 | |
| d2b1pa1 | 355 | d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 | 3e-14 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 1e-13 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 1e-13 | |
| d1ckia_ | 299 | d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n | 1e-13 | |
| d1o6ya_ | 277 | d.144.1.7 (A:) Mycobacterial protein kinase PknB, | 2e-13 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 2e-13 | |
| d1cm8a_ | 346 | d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s | 7e-13 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 1e-12 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 6e-12 | |
| d1zara2 | 191 | d.144.1.9 (A:91-281) Rio2 serine protein kinase C- | 3e-11 | |
| d2gfsa1 | 348 | d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa | 5e-11 | |
| d1q8ya_ | 362 | d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces | 9e-08 |
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: STE20-like serine/threonine-protein kinase, SLK species: Human (Homo sapiens) [TaxId: 9606]
Score = 91.6 bits (227), Expect = 9e-25
Identities = 27/78 (34%), Positives = 41/78 (52%)
Query: 8 ETEQYLDERFIWKVLYQLSKALQVCHSSCILHRDIKPANVFLDENNNVKLGDFGLARILN 67
E E+ L E I V Q AL H + I+HRD+K N+ + ++KL DFG++
Sbjct: 102 ELERPLTESQIQVVCKQTLDALNYLHDNKIIHRDLKAGNILFTLDGDIKLADFGVSAKNT 161
Query: 68 MNESHSYTLVGTPYYMSP 85
+ +GTPY+M+P
Sbjct: 162 RTIQRRDSFIGTPYWMAP 179
|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 85 | |||
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 99.82 | |
| d1nvra_ | 271 | Cell cycle checkpoint kinase chk1 {Human (Homo sap | 99.81 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 99.79 | |
| d2j4za1 | 263 | Aurora-related kinase 1 (aurora-2) {Human (Homo sa | 99.77 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 99.77 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 99.76 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 99.76 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 99.76 | |
| d1uwha_ | 276 | B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.76 | |
| d2java1 | 269 | Serine/threonine-protein kinase Nek2 {Human (Homo | 99.76 | |
| d1ua2a_ | 299 | Cell division protein kinase 7, CDK7 {Human (Homo | 99.76 | |
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 99.76 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 99.75 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 99.75 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 99.74 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 99.74 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 99.74 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 99.73 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 99.73 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 99.73 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 99.73 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 99.73 | |
| d1mqba_ | 283 | epha2 receptor tyrosine kinase {Human (Homo sapien | 99.73 | |
| d1t4ha_ | 270 | Protein kinase wnk1 {Human (Homo sapiens) [TaxId: | 99.73 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 99.72 | |
| d1xbba_ | 277 | Tyrosine-protein kinase SYK {Human (Homo sapiens) | 99.72 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 99.72 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 99.71 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 99.71 | |
| d1sm2a_ | 263 | Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie | 99.71 | |
| d1phka_ | 277 | gamma-subunit of glycogen phosphorylase kinase (Ph | 99.71 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.7 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 99.7 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 99.69 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 99.69 | |
| d1csna_ | 293 | Casein kinase-1, CK1 {Fission yeast (Schizosacchar | 99.69 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 99.69 | |
| d1ob3a_ | 286 | Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) | 99.68 | |
| d1ckia_ | 299 | Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax | 99.68 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 99.68 | |
| d1mp8a_ | 273 | Focal adhesion kinase 1 (fak) {Human (Homo sapiens | 99.68 | |
| d1o6ya_ | 277 | Mycobacterial protein kinase PknB, catalytic domai | 99.68 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 99.67 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 99.67 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 99.66 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 99.65 | |
| d1k2pa_ | 258 | Bruton's tyrosine kinase (Btk) {Human (Homo sapien | 99.65 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 99.64 | |
| d1unla_ | 292 | Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T | 99.63 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 99.63 | |
| d1u46a_ | 273 | Activated CDC42 kinase 1, ACK1 {Human (Homo sapien | 99.62 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 99.61 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.6 | |
| d1vjya_ | 303 | Type I TGF-beta receptor R4 {Human (Homo sapiens) | 99.59 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 99.58 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 99.58 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 99.57 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 99.56 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 99.55 | |
| d1byga_ | 262 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.55 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 99.39 | |
| d1zara2 | 191 | Rio2 serine protein kinase C-terminal domain {Arch | 99.22 | |
| d2ppqa1 | 316 | Homoserine kinase ThrB {Agrobacterium tumefaciens | 91.87 | |
| d1j7la_ | 263 | Type IIIa 3',5"-aminoglycoside phosphotransferase | 85.32 | |
| d1nd4a_ | 255 | Aminoglycoside 3'-phosphotransferase IIa (Kanamyci | 84.19 |
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: pak1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.82 E-value=2.5e-20 Score=101.99 Aligned_cols=75 Identities=40% Similarity=0.647 Sum_probs=67.2
Q ss_pred ccCCHHHHHHHHHHHHHHHHHHHhCCcEeccCCCCcEEeCCCCCEEEeeecceEEecCCCCCcccccccCcccCC
Q psy2485 11 QYLDERFIWKVLYQLSKALQVCHSSCILHRDIKPANVFLDENNNVKLGDFGLARILNMNESHSYTLVGTPYYMSP 85 (85)
Q Consensus 11 ~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~l~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~y~ap 85 (85)
..+++..+..++.|++.|+.|+|+++++|||+|++|+++..++.++++|||++.............+||+.|+||
T Consensus 111 ~~l~~~~~~~i~~qi~~aL~yLH~~~iiHrDiKp~NILl~~~~~vkl~DFG~a~~~~~~~~~~~~~~gt~~Y~aP 185 (293)
T d1yhwa1 111 TCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAP 185 (293)
T ss_dssp SCCCHHHHHHHHHHHHHHHHHHHHTTEECCCCSGGGEEECTTCCEEECCCTTCEECCSTTCCBCCCCSCGGGCCH
T ss_pred cCCCHHHHHHHHHHHHHHHHHHHHCCCcccCCcHHHeEECCCCcEeeccchhheeeccccccccccccCCCccCh
Confidence 468999999999999999999999999999999999999999999999999998876554444556799999998
|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} | Back information, alignment and structure |
|---|