Diaphorina citri psyllid: psy2490


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60----
MSIFRRHLSLASSLFRKYDLDYSKVPKIDEKDIQERFVRGSGPGGQAVAKTNNCVVLTHIPTDS
ccccEEEcccccEEEECccccccccccccccccEEEEEECcccccccccccccEEEEEEccccc
***FRRHLSLASSLFRKYDLDYSKVPKIDEKDIQERFVRGSGPGGQAVAKTNNCVVLTHIP***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIFRRHLSLASSLFRKYDLDYSKVPKIDEKDIQERFVRGSGPGGQAVAKTNNCVVLTHIPTDS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptide chain release factor 1 Peptide chain release factor 1 directs the termination of translation in response to the peptide chain termination codons UAG and UAA.confidentQ5HB80
Probable peptide chain release factor C12orf65 homolog, mitochondrial May act as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion.confidentA5WUX7
Peptide chain release factor 1 Peptide chain release factor 1 directs the termination of translation in response to the peptide chain termination codons UAG and UAA.confidentQ5NMC7

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GQE, chain A
Confidence level:very confident
Coverage over the Query: 4-64
View the alignment between query and template
View the model in PyMOL