Query         psy2501
Match_columns 130
No_of_seqs    133 out of 1279
Neff          9.2 
Searched_HMMs 46136
Date          Fri Aug 16 17:49:17 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2501.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2501hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1701|consensus               99.8 9.2E-21   2E-25  139.7  -3.9  115   10-125   286-407 (468)
  2 KOG2272|consensus               99.7 1.3E-18 2.7E-23  121.1   0.1  121   10-130   147-272 (332)
  3 KOG1701|consensus               99.7 9.7E-19 2.1E-23  129.1  -3.4   79   51-130   272-352 (468)
  4 KOG1044|consensus               99.6 4.1E-17 8.9E-22  124.3   1.9  119   10-129    75-209 (670)
  5 KOG2272|consensus               99.6 5.8E-16 1.2E-20  108.0   1.6  120   10-130    83-213 (332)
  6 KOG1703|consensus               99.6 2.5E-16 5.5E-21  121.3  -1.6  122    9-130   312-442 (479)
  7 PF00412 LIM:  LIM domain;  Int  99.6 5.4E-15 1.2E-19   82.9   4.2   56   56-111     1-58  (58)
  8 KOG4577|consensus               99.4 1.5E-14 3.3E-19  102.5  -2.9   73   52-125    32-105 (383)
  9 KOG1703|consensus               99.2 1.2E-11 2.6E-16   95.5   4.0  121   10-130   253-381 (479)
 10 smart00132 LIM Zinc-binding do  98.7 7.6E-09 1.6E-13   52.8   2.5   36   55-90      1-38  (39)
 11 KOG4577|consensus               98.7 8.8E-10 1.9E-14   78.6  -1.6  100   16-115    50-158 (383)
 12 KOG1044|consensus               98.5 1.1E-08 2.4E-13   79.0  -1.6   96   12-107   146-247 (670)
 13 KOG1700|consensus               98.0 2.4E-06 5.2E-11   59.2   0.7   61   53-113     7-68  (200)
 14 KOG1700|consensus               97.8 3.8E-06 8.2E-11   58.2   0.2   59   53-111   108-167 (200)
 15 KOG1702|consensus               97.7 3.6E-06 7.9E-11   57.8  -2.0   58   54-111     5-63  (264)
 16 KOG0490|consensus               96.2  0.0013 2.9E-08   46.1   0.2   63   59-122     2-69  (235)
 17 smart00132 LIM Zinc-binding do  93.2   0.089 1.9E-06   25.9   2.1   37   81-123     1-38  (39)
 18 PF00412 LIM:  LIM domain;  Int  92.8   0.075 1.6E-06   28.9   1.6   39   82-126     1-40  (58)
 19 PF14835 zf-RING_6:  zf-RING of  83.4     1.2 2.6E-05   25.2   2.1   43   80-122     8-50  (65)
 20 PF10235 Cript:  Microtubule-as  82.5    0.95 2.1E-05   27.4   1.6   42   75-124    40-81  (90)
 21 smart00504 Ubox Modified RING   76.4     4.2   9E-05   22.1   2.9   43   80-123     2-46  (63)
 22 PF09943 DUF2175:  Uncharacteri  74.7    0.97 2.1E-05   27.9  -0.0   31   54-84      3-35  (101)
 23 COG2191 Formylmethanofuran deh  74.3     1.3 2.8E-05   30.8   0.5   31   80-110   173-203 (206)
 24 PF10367 Vps39_2:  Vacuolar sor  73.8     2.1 4.5E-05   26.1   1.4   28   53-80     78-107 (109)
 25 PF14446 Prok-RING_1:  Prokaryo  72.2     2.3   5E-05   23.2   1.1   28   53-80      5-36  (54)
 26 KOG1813|consensus               71.2     2.3 4.9E-05   31.4   1.2   46   80-126   242-289 (313)
 27 cd02336 ZZ_RSC8 Zinc finger, Z  70.8     4.5 9.8E-05   21.1   2.0   29   81-109     2-32  (45)
 28 cd02249 ZZ Zinc finger, ZZ typ  70.7     4.5 9.7E-05   21.0   2.0   10  100-109    23-32  (46)
 29 PF08394 Arc_trans_TRASH:  Arch  70.6     2.4 5.3E-05   21.2   0.9   23   56-78      1-25  (37)
 30 smart00291 ZnF_ZZ Zinc-binding  70.2       5 0.00011   20.6   2.1   10  100-109    27-36  (44)
 31 PF00645 zf-PARP:  Poly(ADP-rib  69.3     1.5 3.3E-05   25.7  -0.0   33   50-82      4-48  (82)
 32 COG5152 Uncharacterized conser  68.8     1.9   4E-05   30.1   0.3   48   79-127   196-245 (259)
 33 PF14634 zf-RING_5:  zinc-RING   68.7     8.3 0.00018   19.6   2.8   23   98-120    20-44  (44)
 34 PF11781 RRN7:  RNA polymerase   68.6     3.2   7E-05   20.6   1.1   23   81-107    10-32  (36)
 35 PF01258 zf-dskA_traR:  Prokary  68.4     1.3 2.7E-05   21.8  -0.4   27   82-108     6-32  (36)
 36 KOG2462|consensus               68.3     2.9 6.3E-05   30.5   1.2   37   54-90    162-198 (279)
 37 PRK14873 primosome assembly pr  65.9       4 8.7E-05   33.6   1.7   38   81-121   394-431 (665)
 38 KOG0320|consensus               65.4       4 8.7E-05   27.9   1.4   48   78-125   130-180 (187)
 39 COG1645 Uncharacterized Zn-fin  63.5     3.3 7.2E-05   26.8   0.7   10   97-106    41-50  (131)
 40 PF13920 zf-C3HC4_3:  Zinc fing  63.0     8.3 0.00018   20.1   2.1   42   82-124     5-49  (50)
 41 KOG4739|consensus               62.6     5.8 0.00012   28.3   1.8   34   91-124    15-49  (233)
 42 PF12674 Zn_ribbon_2:  Putative  61.9     4.6  0.0001   23.9   1.1   28   82-109     3-35  (81)
 43 PF00569 ZZ:  Zinc finger, ZZ t  61.2       6 0.00013   20.5   1.3   11   99-109    27-37  (46)
 44 cd02341 ZZ_ZZZ3 Zinc finger, Z  61.0      10 0.00022   20.0   2.2   12   99-110    25-36  (48)
 45 PF12773 DZR:  Double zinc ribb  60.7      12 0.00026   19.5   2.5    9   82-90     15-23  (50)
 46 PF04570 DUF581:  Protein of un  60.1     7.7 0.00017   21.5   1.7   28   81-108    18-48  (58)
 47 PF06906 DUF1272:  Protein of u  57.8      18 0.00038   19.9   2.8   25  101-125    30-54  (57)
 48 cd02340 ZZ_NBR1_like Zinc fing  56.9      12 0.00025   19.2   2.0   10  100-109    23-32  (43)
 49 COG1644 RPB10 DNA-directed RNA  56.0     4.1 8.9E-05   22.8   0.1   13  112-124     4-16  (63)
 50 PF14471 DUF4428:  Domain of un  54.9      11 0.00023   20.2   1.7   29   81-110     1-30  (51)
 51 PF13248 zf-ribbon_3:  zinc-rib  54.6     8.9 0.00019   17.3   1.2    9   55-63      4-12  (26)
 52 cd00162 RING RING-finger (Real  54.5      13 0.00029   17.9   2.0   24   98-121    18-44  (45)
 53 COG4357 Zinc finger domain con  53.6     1.9   4E-05   26.4  -1.6   48   56-103    38-86  (105)
 54 PRK14890 putative Zn-ribbon RN  53.5      18  0.0004   20.0   2.5   49   53-119     7-55  (59)
 55 PF01194 RNA_pol_N:  RNA polyme  53.1     7.4 0.00016   21.7   0.9   13  112-124     4-16  (60)
 56 TIGR00595 priA primosomal prot  51.3      11 0.00023   30.0   1.9   38   81-121   224-262 (505)
 57 cd02342 ZZ_UBA_plant Zinc fing  49.6      18 0.00038   18.8   1.9   11   99-109    23-33  (43)
 58 PF02069 Metallothio_Pro:  Prok  49.4      11 0.00025   20.3   1.2   28   81-108     9-37  (52)
 59 PRK04016 DNA-directed RNA poly  49.0       7 0.00015   21.9   0.4   14  111-124     3-16  (62)
 60 COG2888 Predicted Zn-ribbon RN  48.4      21 0.00045   19.9   2.1   27   53-88      9-36  (61)
 61 PF13695 zf-3CxxC:  Zinc-bindin  48.0      19 0.00042   21.9   2.3   10   55-64      7-16  (98)
 62 PF01927 Mut7-C:  Mut7-C RNAse   47.8      31 0.00067   22.6   3.4   39   51-89     89-134 (147)
 63 COG1198 PriA Primosomal protei  47.7      57  0.0012   27.4   5.5   73   27-121   405-484 (730)
 64 PF06677 Auto_anti-p27:  Sjogre  47.5     7.1 0.00015   20.0   0.2    9   97-105    31-39  (41)
 65 cd02335 ZZ_ADA2 Zinc finger, Z  47.1      23 0.00049   18.6   2.2   11  100-110    24-34  (49)
 66 PF10083 DUF2321:  Uncharacteri  46.7     8.4 0.00018   25.7   0.5   27   99-126    27-53  (158)
 67 PRK11595 DNA utilization prote  44.8      25 0.00055   24.7   2.8   12   53-64      5-16  (227)
 68 PF10892 DUF2688:  Protein of u  44.8     5.2 0.00011   21.9  -0.5   36   81-121    12-47  (60)
 69 cd02338 ZZ_PCMF_like Zinc fing  44.5      19  0.0004   19.0   1.6   11  100-110    24-34  (49)
 70 PRK00420 hypothetical protein;  42.9      12 0.00027   23.6   0.8   11   54-64     24-34  (112)
 71 PF02591 DUF164:  Putative zinc  42.4     6.4 0.00014   21.3  -0.5   13   52-64     21-33  (56)
 72 PRK04023 DNA polymerase II lar  42.1      35 0.00077   29.7   3.5   52   51-124   624-675 (1121)
 73 cd02344 ZZ_HERC2 Zinc finger,   41.6      28 0.00061   18.1   1.9   11   99-109    23-33  (45)
 74 PF14255 Cys_rich_CPXG:  Cystei  40.9      14  0.0003   19.9   0.7   29   55-83      2-31  (52)
 75 PF13923 zf-C3HC4_2:  Zinc fing  40.6      19  0.0004   17.6   1.2   29   83-111     2-30  (39)
 76 PF13240 zinc_ribbon_2:  zinc-r  40.0      11 0.00023   16.6   0.2    9   82-90      2-10  (23)
 77 cd02345 ZZ_dah Zinc finger, ZZ  38.2      26 0.00056   18.4   1.5   11  100-110    24-34  (49)
 78 PRK14559 putative protein seri  37.9      28  0.0006   28.8   2.3   11   54-64      2-12  (645)
 79 PF13834 DUF4193:  Domain of un  37.8       9 0.00019   23.6  -0.3   29   78-106    69-98  (99)
 80 PF05502 Dynactin_p62:  Dynacti  37.7      14 0.00031   29.3   0.6   39   52-90     25-63  (483)
 81 cd02334 ZZ_dystrophin Zinc fin  36.9      34 0.00073   18.1   1.8   11  100-110    24-34  (49)
 82 KOG2932|consensus               35.5      23 0.00049   26.6   1.3   42   81-122    92-133 (389)
 83 PF06689 zf-C4_ClpX:  ClpX C4-t  35.1      33 0.00072   17.3   1.6   28   81-108     3-32  (41)
 84 PLN03208 E3 ubiquitin-protein   33.9      62  0.0013   22.5   3.2   13  113-125    69-81  (193)
 85 TIGR00373 conserved hypothetic  33.3      45 0.00097   22.2   2.4   31   52-90    108-139 (158)
 86 KOG3476|consensus               33.0     8.7 0.00019   23.1  -0.9   25   98-124    67-91  (100)
 87 KOG3039|consensus               31.0      65  0.0014   23.5   3.0   75   54-128   184-275 (303)
 88 cd02339 ZZ_Mind_bomb Zinc fing  30.3      54  0.0012   16.9   1.9    9  100-108    24-32  (45)
 89 KOG3002|consensus               29.8      50  0.0011   24.6   2.4   43   80-123    49-91  (299)
 90 PF07754 DUF1610:  Domain of un  29.8      29 0.00063   15.5   0.7   11  115-125     1-11  (24)
 91 PRK00398 rpoP DNA-directed RNA  29.7      33 0.00071   17.6   1.1   26   55-89      5-31  (46)
 92 PF10886 DUF2685:  Protein of u  29.4      32  0.0007   18.7   1.0   13  113-125     2-14  (54)
 93 PF04810 zf-Sec23_Sec24:  Sec23  29.1      49  0.0011   16.5   1.6   29   54-87      3-32  (40)
 94 PHA03082 DNA-dependent RNA pol  28.9      12 0.00027   20.6  -0.7   16   80-95      5-20  (63)
 95 PF06827 zf-FPG_IleRS:  Zinc fi  28.7      23  0.0005   16.3   0.3   12   54-65      2-13  (30)
 96 PF05864 Chordopox_RPO7:  Chord  28.6      13 0.00028   20.5  -0.6   16   80-95      5-20  (63)
 97 cd01407 SIR2-fam SIR2 family o  27.7      42 0.00091   23.4   1.6   16  112-127   133-148 (218)
 98 COG2174 RPL34A Ribosomal prote  27.7      26 0.00056   21.2   0.5   12  113-124    35-46  (93)
 99 PF09723 Zn-ribbon_8:  Zinc rib  27.5      19 0.00042   18.2  -0.1    9   55-63      7-15  (42)
100 KOG3579|consensus               26.4      41 0.00088   25.0   1.4   33   52-84    267-300 (352)
101 smart00834 CxxC_CXXC_SSSS Puta  26.1      22 0.00047   17.4  -0.1    9   55-63      7-15  (41)
102 PF00096 zf-C2H2:  Zinc finger,  26.1      30 0.00066   14.4   0.4   11   80-90      1-11  (23)
103 PF04502 DUF572:  Family of unk  24.8      23  0.0005   26.5  -0.1   10  113-122    78-87  (324)
104 PF11077 DUF2616:  Protein of u  24.8      38 0.00082   23.1   0.9   36   76-111   136-171 (173)
105 PRK06266 transcription initiat  24.8      82  0.0018   21.5   2.6   31   52-90    116-147 (178)
106 cd02343 ZZ_EF Zinc finger, ZZ   24.5      85  0.0018   16.6   2.0   11  100-110    23-33  (48)
107 COG1571 Predicted DNA-binding   24.5      54  0.0012   25.6   1.8   34   51-93    348-381 (421)
108 PF07649 C1_3:  C1-like domain;  24.4      45 0.00097   15.3   0.9   12   80-91      1-12  (30)
109 PF15135 UPF0515:  Uncharacteri  24.1      77  0.0017   23.1   2.3   12  114-125   176-187 (278)
110 PRK14714 DNA polymerase II lar  23.9      66  0.0014   28.9   2.3   50   53-124   667-721 (1337)
111 PF13894 zf-C2H2_4:  C2H2-type   23.9      39 0.00084   13.7   0.6   11   80-90      1-11  (24)
112 PF07503 zf-HYPF:  HypF finger;  23.8      39 0.00086   16.5   0.6   31   56-90      2-32  (35)
113 PF08209 Sgf11:  Sgf11 (transcr  22.9      21 0.00045   17.3  -0.5   16   80-95      5-20  (33)
114 PF06750 DiS_P_DiS:  Bacterial   22.8 1.5E+02  0.0033   17.8   3.2   12   53-64     33-44  (92)
115 PF13717 zinc_ribbon_4:  zinc-r  22.8      36 0.00079   16.6   0.4    8   56-63      5-12  (36)
116 PF11571 Med27:  Mediator compl  22.7      25 0.00054   21.0  -0.2   18  105-122    47-64  (90)
117 PF14569 zf-UDP:  Zinc-binding   22.7      68  0.0015   18.9   1.6   21  100-120    36-59  (80)
118 PF12898 Stc1:  Stc1 domain;  I  22.7 1.7E+02  0.0037   17.2   3.4   55   24-94     11-65  (84)
119 PF08271 TF_Zn_Ribbon:  TFIIB z  22.7      37 0.00079   17.1   0.4   10   80-89     20-29  (43)
120 TIGR02605 CxxC_CxxC_SSSS putat  22.6      29 0.00064   18.1   0.1   10   54-63      6-15  (52)
121 PF00320 GATA:  GATA zinc finge  22.4      77  0.0017   15.3   1.6   27   82-108     1-28  (36)
122 PF11331 DUF3133:  Protein of u  22.1      54  0.0012   17.2   1.0   11  113-123    32-42  (46)
123 smart00531 TFIIE Transcription  22.0      86  0.0019   20.5   2.2   36   52-90     98-134 (147)
124 PRK00085 recO DNA repair prote  22.0      45 0.00097   23.5   0.9   32   76-107   146-177 (247)
125 PRK12495 hypothetical protein;  21.6      40 0.00086   24.0   0.5   28   52-89     41-68  (226)
126 PRK13796 GTPase YqeH; Provisio  21.3      63  0.0014   24.5   1.6    9   55-63      2-10  (365)
127 smart00659 RPOLCX RNA polymera  21.1      36 0.00078   17.6   0.2    9   55-63      4-12  (44)
128 COG1997 RPL43A Ribosomal prote  20.9 1.2E+02  0.0026   18.3   2.4   35   53-95     35-69  (89)
129 TIGR00270 conserved hypothetic  20.9      90  0.0019   20.8   2.1    9   82-90      3-11  (154)
130 KOG2186|consensus               20.7      23 0.00049   25.7  -0.8   41   55-95      5-45  (276)
131 PF08746 zf-RING-like:  RING-li  20.6      20 0.00043   18.4  -0.9    8   56-63      1-8   (43)
132 PF10080 DUF2318:  Predicted me  20.5      46 0.00099   20.6   0.6   27   80-110    36-62  (102)
133 COG1579 Zn-ribbon protein, pos  20.3      49  0.0011   23.8   0.8   15   51-65    195-209 (239)
134 COG4847 Uncharacterized protei  20.1      70  0.0015   19.6   1.3   35   54-88      7-43  (103)
135 KOG1829|consensus               20.0      42 0.00092   27.4   0.5   32   78-109   339-375 (580)

No 1  
>KOG1701|consensus
Probab=99.76  E-value=9.2e-21  Score=139.75  Aligned_cols=115  Identities=26%  Similarity=0.530  Sum_probs=93.2

Q ss_pred             CCCCcccCCCCCCCCCCCchhHHHHHHHHHH------HHhhhcCCCCCCCccccccccccccceeeecCcccccCCcccC
Q psy2501          10 VTDSSSVSYSKPNQPVHQKGKQLDCMLDSLT------AEMSRQGVTTTQKGCCSSCDKPIVGQVITALGKTWHPEHFICT   83 (130)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~   83 (130)
                      .....+.||++.+|..||.+..+...+..-.      +.+++..+. ....+|..|++.|+++++.++|+.||+.||+|.
T Consensus       286 g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq-~tlekC~~Cg~~I~d~iLrA~GkayHp~CF~Cv  364 (468)
T KOG1701|consen  286 GQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQ-DTLEKCNKCGEPIMDRILRALGKAYHPGCFTCV  364 (468)
T ss_pred             CcchHHHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHH-HHHHHHhhhhhHHHHHHHHhcccccCCCceEEE
Confidence            3456788999999999998777776542211      111222332 122589999999999999999999999999999


Q ss_pred             CCCcccCCCCee-ccCCcccCHHhhhhhcCCCCccCccccccC
Q psy2501          84 HCNQELGTRNFF-ERDSRPYCEPDYHNLFSPRCSYCNGPILDV  125 (130)
Q Consensus        84 ~C~~~l~~~~~~-~~~~~~~C~~~~~~~~~~~C~~C~~~I~~~  125 (130)
                      .|.+.|.+..|. ..++.+||..||.++|+++|+.|++||+++
T Consensus       365 ~C~r~ldgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~PI~P~  407 (468)
T KOG1701|consen  365 VCARCLDGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNPILPR  407 (468)
T ss_pred             EeccccCCccccccCCCceeeehhhhhhcCcchhhccCCccCC
Confidence            999999988887 778999999999999999999999999753


No 2  
>KOG2272|consensus
Probab=99.71  E-value=1.3e-18  Score=121.15  Aligned_cols=121  Identities=27%  Similarity=0.563  Sum_probs=99.2

Q ss_pred             CCCCcccCCCCCCCCCCCchhHH----HHHHHHHHHHh-hhcCCCCCCCccccccccccccceeeecCcccccCCcccCC
Q psy2501          10 VTDSSSVSYSKPNQPVHQKGKQL----DCMLDSLTAEM-SRQGVTTTQKGCCSSCDKPIVGQVITALGKTWHPEHFICTH   84 (130)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~-~~~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~   84 (130)
                      +.+..++-.+.++|+-+|.+..+    ++..-.+..++ .-..-...+.++|+.|.++|.++.+.++++.||.+.|+|+.
T Consensus       147 iD~~~l~fr~d~yH~yHFkCt~C~keL~sdaRevk~eLyClrChD~mgipiCgaC~rpIeervi~amgKhWHveHFvCa~  226 (332)
T KOG2272|consen  147 IDEQPLTFRGDPYHPYHFKCTTCGKELTSDAREVKGELYCLRCHDKMGIPICGACRRPIEERVIFAMGKHWHVEHFVCAK  226 (332)
T ss_pred             cccccccccCCCCCccceecccccccccchhhhhccceeccccccccCCcccccccCchHHHHHHHhccccchhheeehh
Confidence            45566777789999999955444    44333333332 22222345678999999999999999999999999999999


Q ss_pred             CCcccCCCCeeccCCcccCHHhhhhhcCCCCccCccccccCceeeC
Q psy2501          85 CNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDVSIRNT  130 (130)
Q Consensus        85 C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~C~~C~~~I~~~~~~~~  130 (130)
                      |.+++-+.+.|.+.|..||+.+|.++|+-.|+.|+..|.|.++.||
T Consensus       227 CekPFlGHrHYEkkGlaYCe~h~~qLfG~~CF~C~~~i~G~vv~al  272 (332)
T KOG2272|consen  227 CEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFICNRVIGGDVVSAL  272 (332)
T ss_pred             cCCcccchhhhhhcCchhHHHHHHHHhhhhheecCCccCccHHHHh
Confidence            9999988899999999999999999999999999999999998875


No 3  
>KOG1701|consensus
Probab=99.68  E-value=9.7e-19  Score=129.14  Aligned_cols=79  Identities=30%  Similarity=0.800  Sum_probs=72.7

Q ss_pred             CCCcccccccccccc--ceeeecCcccccCCcccCCCCcccCCCCeeccCCcccCHHhhhhhcCCCCccCccccccCcee
Q psy2501          51 TQKGCCSSCDKPIVG--QVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDVSIR  128 (130)
Q Consensus        51 ~~~~~C~~C~~~i~~--~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~C~~C~~~I~~~~~~  128 (130)
                      .++..|.+|+|.|.+  ..+++|++.||..||+|..|++.|.+..||..++++||+.||...+ ++|..|+++|+++||+
T Consensus       272 ~~~~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~tl-ekC~~Cg~~I~d~iLr  350 (468)
T KOG1701|consen  272 DYFGICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDTL-EKCNKCGEPIMDRILR  350 (468)
T ss_pred             hhhhhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHHHHH-HHHhhhhhHHHHHHHH
Confidence            344599999999974  4578999999999999999999999999999999999999998876 8999999999999999


Q ss_pred             eC
Q psy2501         129 NT  130 (130)
Q Consensus       129 ~~  130 (130)
                      ||
T Consensus       351 A~  352 (468)
T KOG1701|consen  351 AL  352 (468)
T ss_pred             hc
Confidence            96


No 4  
>KOG1044|consensus
Probab=99.64  E-value=4.1e-17  Score=124.33  Aligned_cols=119  Identities=24%  Similarity=0.516  Sum_probs=94.3

Q ss_pred             CCCCcccCCCCCCCCCCCchhHHHH---------------HHHHHHHHhhhcCCCCCCCcccccccccc-ccceeeecCc
Q psy2501          10 VTDSSSVSYSKPNQPVHQKGKQLDC---------------MLDSLTAEMSRQGVTTTQKGCCSSCDKPI-VGQVITALGK   73 (130)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~~~---------------~~~~~~~~~~~~~~~~~~~~~C~~C~~~i-~~~~~~~~~~   73 (130)
                      +....+.++++++|+.+|.+..+..               +-+.....+...+....+...|++|+..| .++.+.++++
T Consensus        75 ~~gevvsa~gktyh~~cf~cs~ck~pf~~g~~vt~~gk~~~c~~c~~~~~~~p~~~~~ps~cagc~~~lk~gq~llald~  154 (670)
T KOG1044|consen   75 VEGEVVSTLGKTYHPKCFSCSTCKSPFKSGDKVTFSGKECLCQTCSQPMPVSPAESYGPSTCAGCGEELKNGQALLALDK  154 (670)
T ss_pred             ccceeEecccceeccccceecccCCCCCCCCeeeecchhhhhhhhcCcccCCcccccCCccccchhhhhhccceeeeecc
Confidence            4456788999999999995443321               11112222222222334567899999999 5899999999


Q ss_pred             ccccCCcccCCCCcccCCCCeeccCCcccCHHhhhhhcCCCCccCccccccCceee
Q psy2501          74 TWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDVSIRN  129 (130)
Q Consensus        74 ~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~C~~C~~~I~~~~~~~  129 (130)
                      .||..||+|..|+..|. ++|+..+|.+||+.+|...|+.+|..|.+.|.|++|.|
T Consensus       155 qwhv~cfkc~~c~~vL~-gey~skdg~pyce~dy~~~fgvkc~~c~~fisgkvLqa  209 (670)
T KOG1044|consen  155 QWHVSCFKCKSCSAVLN-GEYMSKDGVPYCEKDYQAKFGVKCEECEKFISGKVLQA  209 (670)
T ss_pred             ceeeeeeehhhhccccc-ceeeccCCCcchhhhhhhhcCeehHHhhhhhhhhhhhc
Confidence            99999999999999996 47999999999999999999999999999999999987


No 5  
>KOG2272|consensus
Probab=99.57  E-value=5.8e-16  Score=107.97  Aligned_cols=120  Identities=23%  Similarity=0.352  Sum_probs=97.7

Q ss_pred             CCCCcccCCCCCCCCCCCchhHHHHHHHHHHHHh------hhc-----CCCCCCCccccccccccccceeeecCcccccC
Q psy2501          10 VTDSSSVSYSKPNQPVHQKGKQLDCMLDSLTAEM------SRQ-----GVTTTQKGCCSSCDKPIVGQVITALGKTWHPE   78 (130)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~-----~~~~~~~~~C~~C~~~i~~~~~~~~~~~~H~~   78 (130)
                      +..+.+.+++..|||.+|.++.++..+.+.....      .+.     .....+..+|..|+..|.++.+...+..||+.
T Consensus        83 iiGrVikamnnSwHp~CF~Cd~Cn~~Lad~gf~rnqgr~LC~~Cn~k~Ka~~~g~YvC~KCh~~iD~~~l~fr~d~yH~y  162 (332)
T KOG2272|consen   83 IIGRVIKAMNNSWHPACFRCDLCNKHLADQGFYRNQGRALCRECNQKEKAKGRGRYVCQKCHAHIDEQPLTFRGDPYHPY  162 (332)
T ss_pred             hhhHHHHhhccccCcccchhHHHHHHHhhhhhHhhcchHHhhhhhhhhcccccceeehhhhhhhcccccccccCCCCCcc
Confidence            4457788999999999999998887766544333      111     22345667899999999888899999999999


Q ss_pred             CcccCCCCcccCCCCeeccCCcccCHHhhhhhcCCCCccCccccccCceeeC
Q psy2501          79 HFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDVSIRNT  130 (130)
Q Consensus        79 Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~C~~C~~~I~~~~~~~~  130 (130)
                      .|+|..|++.|.. .-....+.+||..|+.+.--|+|++|.+||++++|.||
T Consensus       163 HFkCt~C~keL~s-daRevk~eLyClrChD~mgipiCgaC~rpIeervi~am  213 (332)
T KOG2272|consen  163 HFKCTTCGKELTS-DAREVKGELYCLRCHDKMGIPICGACRRPIEERVIFAM  213 (332)
T ss_pred             ceecccccccccc-hhhhhccceeccccccccCCcccccccCchHHHHHHHh
Confidence            9999999999964 33477789999999877666999999999999999875


No 6  
>KOG1703|consensus
Probab=99.55  E-value=2.5e-16  Score=121.31  Aligned_cols=122  Identities=29%  Similarity=0.657  Sum_probs=98.6

Q ss_pred             CCCC-CcccCCCCCCCCCCCchhHHHHHHHHHHHH------hhhcCCCCCCCccccccccccccceeeecCcccccCCcc
Q psy2501           9 SVTD-SSSVSYSKPNQPVHQKGKQLDCMLDSLTAE------MSRQGVTTTQKGCCSSCDKPIVGQVITALGKTWHPEHFI   81 (130)
Q Consensus         9 ~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~   81 (130)
                      +... ..++++++.||+.+|.+......+......      +....+.....+.|.+|+++|.++.|.++++.||++||.
T Consensus       312 ~i~~~~~i~~~~~~~h~~~~~c~~~~~~~~~~~~~~~~g~~~c~~~~~~~~~p~C~~C~~~i~~~~v~a~~~~wH~~cf~  391 (479)
T KOG1703|consen  312 KIRSVKVIVALGKEWHPEHFSCEVCAIVILDGGPRELDGKILCHECFHAPFRPNCKRCLLPILEEGVCALGRLWHPECFV  391 (479)
T ss_pred             CcccceeEeeccccccccceeeccccccccCCCccccCCCccHHHHHHHhhCccccccCCchHHhHhhhccCeechhcee
Confidence            4556 888999999999999666655443322221      122223345668999999999999999999999999999


Q ss_pred             cCCCCcccCCCCeeccCCcccCHHhhhhhcCCCCccCccccc--cCceeeC
Q psy2501          82 CTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPIL--DVSIRNT  130 (130)
Q Consensus        82 C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~C~~C~~~I~--~~~~~~~  130 (130)
                      |..|..++....|+..++.+||+.||.+++..+|..|.++|+  +..+.|+
T Consensus       392 C~~C~~~~~~~~~~~~~~~pyce~~~~~~~~~~~~~~~~p~~~~~~~ie~~  442 (479)
T KOG1703|consen  392 CADCGKPLKNSSFFESDGEPYCEDHYKKLFTTKCDYCKKPVEFGSRQIEAD  442 (479)
T ss_pred             eecccCCCCCCcccccCCccchhhhHhhhccccchhccchhHhhhhHhhcc
Confidence            999999999999999999999999999999999999999987  7666653


No 7  
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.55  E-value=5.4e-15  Score=82.89  Aligned_cols=56  Identities=46%  Similarity=1.178  Sum_probs=50.1

Q ss_pred             cccccccccc-ce-eeecCcccccCCcccCCCCcccCCCCeeccCCcccCHHhhhhhc
Q psy2501          56 CSSCDKPIVG-QV-ITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLF  111 (130)
Q Consensus        56 C~~C~~~i~~-~~-~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~  111 (130)
                      |..|+++|.+ .. +.+.++.||++||+|..|+.+|.+..++..++++||..||.++|
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLNDGDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTTSSEEEETTEEEEHHHHHHHT
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCCCeeEeECCEEECHHHHhhhC
Confidence            7899999974 33 36999999999999999999998888999999999999998875


No 8  
>KOG4577|consensus
Probab=99.38  E-value=1.5e-14  Score=102.55  Aligned_cols=73  Identities=27%  Similarity=0.773  Sum_probs=66.2

Q ss_pred             CCccccccccccccce-eeecCcccccCCcccCCCCcccCCCCeeccCCcccCHHhhhhhcCCCCccCccccccC
Q psy2501          52 QKGCCSSCDKPIVGQV-ITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDV  125 (130)
Q Consensus        52 ~~~~C~~C~~~i~~~~-~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~C~~C~~~I~~~  125 (130)
                      ..++|+.|.+.|.+.+ +.++++.||..|++|+.|..+|.+ ..+.+++.+||+.+|.++|+-+|++|++.|.+.
T Consensus        32 eip~CagC~q~IlDrFilKvl~R~wHs~CLkCs~C~~qL~d-rCFsR~~s~yCkedFfKrfGTKCsaC~~GIpPt  105 (383)
T KOG4577|consen   32 EIPICAGCDQHILDRFILKVLDRHWHSSCLKCSDCHDQLAD-RCFSREGSVYCKEDFFKRFGTKCSACQEGIPPT  105 (383)
T ss_pred             ccccccchHHHHHHHHHHHHHhhhhhhhhcchhhhhhHHHH-HHhhcCCceeehHHHHHHhCCcchhhcCCCChH
Confidence            5578999999998765 579999999999999999999975 578999999999999999999999999999753


No 9  
>KOG1703|consensus
Probab=99.20  E-value=1.2e-11  Score=95.55  Aligned_cols=121  Identities=26%  Similarity=0.437  Sum_probs=91.4

Q ss_pred             CCCCcccCCCCCCCCCCCchhHHHHHHHHHHHH--hh-----hcCCCCCCCcccccccccccc-ceeeecCcccccCCcc
Q psy2501          10 VTDSSSVSYSKPNQPVHQKGKQLDCMLDSLTAE--MS-----RQGVTTTQKGCCSSCDKPIVG-QVITALGKTWHPEHFI   81 (130)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~-----~~~~~~~~~~~C~~C~~~i~~-~~~~~~~~~~H~~Cf~   81 (130)
                      .....+.+....|++..+...+.-.+.......  +.     ...+.....+.|..|...|.+ +.+.++++.||+.+|.
T Consensus       253 ~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~c~~c~~~i~~~~~i~~~~~~~h~~~~~  332 (479)
T KOG1703|consen  253 ECQPLVSAPRPASEGLHMKVEKELPLLLVESEALKKLREEEKPAEYHNVTRPLCLSCNQKIRSVKVIVALGKEWHPEHFS  332 (479)
T ss_pred             ccCcceecccccccccccccccccchhhcccccccccccccccccccccccccccccccCcccceeEeecccccccccee
Confidence            333555666777777776444222222111111  11     111222344899999999998 8899999999999999


Q ss_pred             cCCCCcccCCCCeeccCCcccCHHhhhhhcCCCCccCccccccCceeeC
Q psy2501          82 CTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDVSIRNT  130 (130)
Q Consensus        82 C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~C~~C~~~I~~~~~~~~  130 (130)
                      |..|...+..+.+...+|.+||..||...+.+.|.+|+++|++++|.|+
T Consensus       333 c~~~~~~~~~~~~~~~~g~~~c~~~~~~~~~p~C~~C~~~i~~~~v~a~  381 (479)
T KOG1703|consen  333 CEVCAIVILDGGPRELDGKILCHECFHAPFRPNCKRCLLPILEEGVCAL  381 (479)
T ss_pred             eccccccccCCCccccCCCccHHHHHHHhhCccccccCCchHHhHhhhc
Confidence            9999999988888899999999999999999999999999999999875


No 10 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.74  E-value=7.6e-09  Score=52.80  Aligned_cols=36  Identities=56%  Similarity=1.238  Sum_probs=32.1

Q ss_pred             ccccccccccc--ceeeecCcccccCCcccCCCCcccC
Q psy2501          55 CCSSCDKPIVG--QVITALGKTWHPEHFICTHCNQELG   90 (130)
Q Consensus        55 ~C~~C~~~i~~--~~~~~~~~~~H~~Cf~C~~C~~~l~   90 (130)
                      +|..|++.|.+  ..+.+.++.||+.||+|..|+.+|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcCc
Confidence            48899999975  6678999999999999999999885


No 11 
>KOG4577|consensus
Probab=98.73  E-value=8.8e-10  Score=78.63  Aligned_cols=100  Identities=21%  Similarity=0.360  Sum_probs=72.2

Q ss_pred             cCCCCCCCCCCCchhHHHHHHHHHHHHh-----hhcCCCCCCCccccccccccc-ccee-eecCcccccCCcccCCCCcc
Q psy2501          16 VSYSKPNQPVHQKGKQLDCMLDSLTAEM-----SRQGVTTTQKGCCSSCDKPIV-GQVI-TALGKTWHPEHFICTHCNQE   88 (130)
Q Consensus        16 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~C~~C~~~i~-~~~~-~~~~~~~H~~Cf~C~~C~~~   88 (130)
                      ..+++.||..|..++.+...+..--...     ++...-..++.+|..|...|. .+++ .+.+..||..||.|..|++.
T Consensus        50 Kvl~R~wHs~CLkCs~C~~qL~drCFsR~~s~yCkedFfKrfGTKCsaC~~GIpPtqVVRkAqd~VYHl~CF~C~iC~R~  129 (383)
T KOG4577|consen   50 KVLDRHWHSSCLKCSDCHDQLADRCFSREGSVYCKEDFFKRFGTKCSACQEGIPPTQVVRKAQDFVYHLHCFACFICKRQ  129 (383)
T ss_pred             HHHhhhhhhhhcchhhhhhHHHHHHhhcCCceeehHHHHHHhCCcchhhcCCCChHHHHHHhhcceeehhhhhhHhhhcc
Confidence            4567899999997777765554433222     222222346679999999995 5554 47889999999999999999


Q ss_pred             cC-CCCee-ccCCcccCHHhhhhhcCCCC
Q psy2501          89 LG-TRNFF-ERDSRPYCEPDYHNLFSPRC  115 (130)
Q Consensus        89 l~-~~~~~-~~~~~~~C~~~~~~~~~~~C  115 (130)
                      |. +.+|| ..++++.|+.+|..--..-|
T Consensus       130 L~TGdEFYLmeD~rLvCK~DYE~Ak~k~~  158 (383)
T KOG4577|consen  130 LATGDEFYLMEDARLVCKDDYETAKQKHC  158 (383)
T ss_pred             cccCCeeEEeccceeehhhhHHHHHhccc
Confidence            96 44777 67889999999985443434


No 12 
>KOG1044|consensus
Probab=98.50  E-value=1.1e-08  Score=78.95  Aligned_cols=96  Identities=20%  Similarity=0.303  Sum_probs=77.6

Q ss_pred             CCcccCCCCCCCCCCCchhHHHHHHHHHHHH-----hhhcCCCCCCCccccccccccccceeeecCcccccCCcccCCCC
Q psy2501          12 DSSSVSYSKPNQPVHQKGKQLDCMLDSLTAE-----MSRQGVTTTQKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCN   86 (130)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~   86 (130)
                      .++..++.+.||-.||.+..+...+......     .+...+...++.+|..|.+-|.+.++.+.++.||+.|-+|+.|+
T Consensus       146 gq~llald~qwhv~cfkc~~c~~vL~gey~skdg~pyce~dy~~~fgvkc~~c~~fisgkvLqag~kh~HPtCARCsRCg  225 (670)
T KOG1044|consen  146 GQALLALDKQWHVSCFKCKSCSAVLNGEYMSKDGVPYCEKDYQAKFGVKCEECEKFISGKVLQAGDKHFHPTCARCSRCG  225 (670)
T ss_pred             cceeeeeccceeeeeeehhhhcccccceeeccCCCcchhhhhhhhcCeehHHhhhhhhhhhhhccCcccCcchhhhhhhc
Confidence            3677899999999999888777666543322     24555666778899999999999999999999999999999999


Q ss_pred             cccCCC-CeeccCCcccCHHhh
Q psy2501          87 QELGTR-NFFERDSRPYCEPDY  107 (130)
Q Consensus        87 ~~l~~~-~~~~~~~~~~C~~~~  107 (130)
                      ..++++ +.|..+..++-..|-
T Consensus       226 qmF~eGEEMYlQGs~iWHP~C~  247 (670)
T KOG1044|consen  226 QMFGEGEEMYLQGSEIWHPDCK  247 (670)
T ss_pred             cccccchheeeccccccCCccc
Confidence            999866 567777777776664


No 13 
>KOG1700|consensus
Probab=97.95  E-value=2.4e-06  Score=59.21  Aligned_cols=61  Identities=26%  Similarity=0.614  Sum_probs=52.6

Q ss_pred             Cccccccccccc-cceeeecCcccccCCcccCCCCcccCCCCeeccCCcccCHHhhhhhcCC
Q psy2501          53 KGCCSSCDKPIV-GQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSP  113 (130)
Q Consensus        53 ~~~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~  113 (130)
                      ...|..|++.++ .+.+...+..||..||+|..|...|....+...++.+||+.+|...+++
T Consensus         7 ~~kc~~c~k~vy~~e~~~~~g~~~hk~c~~c~~~~k~l~~~~~~~~e~~~yc~~~~~~~~~~   68 (200)
T KOG1700|consen    7 TDKCNACGKTVYFVEKVQKDGVDFHKECFKCEKCKKTLTLSGYSEHEGVPYCKNCHVAQFGP   68 (200)
T ss_pred             cchhhhccCcchHHHHHhccCcchhhhHHhccccccccccccccccccccccccchHhhhCc
Confidence            358999999996 5556688999999999999999999888888999999999977777765


No 14 
>KOG1700|consensus
Probab=97.84  E-value=3.8e-06  Score=58.24  Aligned_cols=59  Identities=31%  Similarity=0.712  Sum_probs=51.2

Q ss_pred             Cccccccccccc-cceeeecCcccccCCcccCCCCcccCCCCeeccCCcccCHHhhhhhc
Q psy2501          53 KGCCSSCDKPIV-GQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLF  111 (130)
Q Consensus        53 ~~~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~  111 (130)
                      ...|..|.+.++ .+.+...+..||..||+|+.|+..|+.+.+....+.+||+.++..++
T Consensus       108 ~~~c~~c~k~vy~~Ek~~~~~~~~hk~cfrc~~~~~~ls~~~~~~~~g~l~~~~~~~~~~  167 (200)
T KOG1700|consen  108 KEKCARCQKTVYPLEKVTGNGLEFHKSCFRCTHCGKKLSPKNYAALEGVLYCKHHFAQLF  167 (200)
T ss_pred             ccccccccceeeehHHHhhhhhhhhhhheeecccccccCCcchhhcCCccccchhhheee
Confidence            357999999996 46677889999999999999999999989999999999987776654


No 15 
>KOG1702|consensus
Probab=97.67  E-value=3.6e-06  Score=57.77  Aligned_cols=58  Identities=29%  Similarity=0.707  Sum_probs=50.3

Q ss_pred             ccccccccccc-cceeeecCcccccCCcccCCCCcccCCCCeeccCCcccCHHhhhhhc
Q psy2501          54 GCCSSCDKPIV-GQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLF  111 (130)
Q Consensus        54 ~~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~  111 (130)
                      ..|..|++.++ .+.+..+++.||..||+|..|+.+|.-..+-..+.++||..+|.+..
T Consensus         5 ~n~~~cgk~vYPvE~v~cldk~whk~cfkce~c~mtlnmKnyKgy~kkpycn~hYpkq~   63 (264)
T KOG1702|consen    5 CNREDCGKTVYPVEEVKCLDKVWHKQCFKCEVCGMTLNMKNYKGYDKKPYCNPHYPKQV   63 (264)
T ss_pred             chhhhhccccccHHHHhhHHHHHHHHhheeeeccCChhhhhccccccCCCcCcccccce
Confidence            45778999886 46688999999999999999999998777878999999999997654


No 16 
>KOG0490|consensus
Probab=96.20  E-value=0.0013  Score=46.10  Aligned_cols=63  Identities=33%  Similarity=0.829  Sum_probs=50.3

Q ss_pred             cccccccce-eeecCcccccCCcccCCCCcccC--CCCeeccCCcccCHHhhhh--hcCCCCccCcccc
Q psy2501          59 CDKPIVGQV-ITALGKTWHPEHFICTHCNQELG--TRNFFERDSRPYCEPDYHN--LFSPRCSYCNGPI  122 (130)
Q Consensus        59 C~~~i~~~~-~~~~~~~~H~~Cf~C~~C~~~l~--~~~~~~~~~~~~C~~~~~~--~~~~~C~~C~~~I  122 (130)
                      |+..|.+.+ +...+..||..|..|..|...+.  ...+.. +|..||..+|.+  .+..+|.+|...|
T Consensus         2 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~g~~~~~~d~~~~~~~~~rr~rt~~~~   69 (235)
T KOG0490|consen    2 CGRQILDRYLLRVLDRYWHASCLKCAECDNPLGVGDTCFSK-DGSIYCKRDYQREFKFSKRCARCKFTI   69 (235)
T ss_pred             CCccccchHHhhcccHHHHHHHHhhhhhcchhccCCCcccC-CCcccccccchhhhhccccccCCCCCc
Confidence            555665443 45568999999999999999997  444445 999999999998  7778999998876


No 17 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=93.17  E-value=0.089  Score=25.85  Aligned_cols=37  Identities=16%  Similarity=0.471  Sum_probs=25.4

Q ss_pred             ccCCCCcccCCC-CeeccCCcccCHHhhhhhcCCCCccCccccc
Q psy2501          81 ICTHCNQELGTR-NFFERDSRPYCEPDYHNLFSPRCSYCNGPIL  123 (130)
Q Consensus        81 ~C~~C~~~l~~~-~~~~~~~~~~C~~~~~~~~~~~C~~C~~~I~  123 (130)
                      +|..|+.++.+. ......++.|...||      +|..|+++|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf------~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECF------KCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCC------CCcccCCcCc
Confidence            477888888765 444556677776664      6777877764


No 18 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=92.84  E-value=0.075  Score=28.87  Aligned_cols=39  Identities=18%  Similarity=0.514  Sum_probs=30.6

Q ss_pred             cCCCCcccCCCCee-ccCCcccCHHhhhhhcCCCCccCccccccCc
Q psy2501          82 CTHCNQELGTRNFF-ERDSRPYCEPDYHNLFSPRCSYCNGPILDVS  126 (130)
Q Consensus        82 C~~C~~~l~~~~~~-~~~~~~~C~~~~~~~~~~~C~~C~~~I~~~~  126 (130)
                      |..|+.++.+.... ...++.|...||      +|..|+++|.+..
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf------~C~~C~~~l~~~~   40 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECF------KCSKCGKPLNDGD   40 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTS------BETTTTCBTTTSS
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEcccc------ccCCCCCccCCCe
Confidence            67889998766655 578888888885      7999999987653


No 19 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=83.41  E-value=1.2  Score=25.22  Aligned_cols=43  Identities=16%  Similarity=0.444  Sum_probs=18.6

Q ss_pred             cccCCCCcccCCCCeeccCCcccCHHhhhhhcCCCCccCcccc
Q psy2501          80 FICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPI  122 (130)
Q Consensus        80 f~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~C~~C~~~I  122 (130)
                      .+|+.|..-|...-....=+..||..|-...++..|-.|+.|-
T Consensus         8 LrCs~C~~~l~~pv~l~~CeH~fCs~Ci~~~~~~~CPvC~~Pa   50 (65)
T PF14835_consen    8 LRCSICFDILKEPVCLGGCEHIFCSSCIRDCIGSECPVCHTPA   50 (65)
T ss_dssp             TS-SSS-S--SS-B---SSS--B-TTTGGGGTTTB-SSS--B-
T ss_pred             cCCcHHHHHhcCCceeccCccHHHHHHhHHhcCCCCCCcCChH
Confidence            4566666665433223334567788777777777788887764


No 20 
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=82.52  E-value=0.95  Score=27.39  Aligned_cols=42  Identities=24%  Similarity=0.543  Sum_probs=28.2

Q ss_pred             cccCCcccCCCCcccCCCCeeccCCcccCHHhhhhhcCCCCccCcccccc
Q psy2501          75 WHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILD  124 (130)
Q Consensus        75 ~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~C~~C~~~I~~  124 (130)
                      |-..--.|..|...+..      .|.-||..|..+.  .+|+-|++.|++
T Consensus        40 y~~~~~~C~~CK~~v~q------~g~~YCq~CAYkk--GiCamCGKki~d   81 (90)
T PF10235_consen   40 YAPYSSKCKICKTKVHQ------PGAKYCQTCAYKK--GICAMCGKKILD   81 (90)
T ss_pred             ccccCcccccccccccc------CCCccChhhhccc--CcccccCCeecc
Confidence            43333466667665532      2467899996654  799999999854


No 21 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=76.45  E-value=4.2  Score=22.13  Aligned_cols=43  Identities=9%  Similarity=0.193  Sum_probs=30.1

Q ss_pred             cccCCCCcccCCCCeeccCCcccCHHhhhhhc--CCCCccCccccc
Q psy2501          80 FICTHCNQELGTRNFFERDSRPYCEPDYHNLF--SPRCSYCNGPIL  123 (130)
Q Consensus        80 f~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~--~~~C~~C~~~I~  123 (130)
                      |.|..|...+.+. .....|..||+.+..+.+  ...|-.|++++.
T Consensus         2 ~~Cpi~~~~~~~P-v~~~~G~v~~~~~i~~~~~~~~~cP~~~~~~~   46 (63)
T smart00504        2 FLCPISLEVMKDP-VILPSGQTYERRAIEKWLLSHGTDPVTGQPLT   46 (63)
T ss_pred             cCCcCCCCcCCCC-EECCCCCEEeHHHHHHHHHHCCCCCCCcCCCC
Confidence            5677777777653 445668899988876554  347888888774


No 22 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=74.68  E-value=0.97  Score=27.93  Aligned_cols=31  Identities=35%  Similarity=0.417  Sum_probs=22.9

Q ss_pred             ccccccccccc-cceeeec-CcccccCCcccCC
Q psy2501          54 GCCSSCDKPIV-GQVITAL-GKTWHPEHFICTH   84 (130)
Q Consensus        54 ~~C~~C~~~i~-~~~~~~~-~~~~H~~Cf~C~~   84 (130)
                      ..|..|++.|. |+.+.+. ...-|..||+-..
T Consensus         3 WkC~iCg~~I~~gqlFTF~~kG~VH~~C~~~~~   35 (101)
T PF09943_consen    3 WKCYICGKPIYEGQLFTFTKKGPVHYECFREKA   35 (101)
T ss_pred             eEEEecCCeeeecceEEEecCCcEeHHHHHHHH
Confidence            46999999995 7777653 3567999987543


No 23 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=74.28  E-value=1.3  Score=30.81  Aligned_cols=31  Identities=16%  Similarity=0.425  Sum_probs=24.6

Q ss_pred             cccCCCCcccCCCCeeccCCcccCHHhhhhh
Q psy2501          80 FICTHCNQELGTRNFFERDSRPYCEPDYHNL  110 (130)
Q Consensus        80 f~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~  110 (130)
                      -+|+.|+-......-...+|++.|..||.+.
T Consensus       173 v~C~kCGE~~~e~~~~~~ng~~vC~~C~~~~  203 (206)
T COG2191         173 VRCSKCGELFMEPRAVVLNGKPVCKPCAEKK  203 (206)
T ss_pred             eeccccCcccccchhhhcCCceecccccccc
Confidence            4788888877666666888999999998754


No 24 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=73.84  E-value=2.1  Score=26.05  Aligned_cols=28  Identities=29%  Similarity=0.526  Sum_probs=14.1

Q ss_pred             Cccccccccccccce-ee-ecCcccccCCc
Q psy2501          53 KGCCSSCDKPIVGQV-IT-ALGKTWHPEHF   80 (130)
Q Consensus        53 ~~~C~~C~~~i~~~~-~~-~~~~~~H~~Cf   80 (130)
                      ...|..|++.|.... +. ..+..+|..|+
T Consensus        78 ~~~C~vC~k~l~~~~f~~~p~~~v~H~~C~  107 (109)
T PF10367_consen   78 STKCSVCGKPLGNSVFVVFPCGHVVHYSCI  107 (109)
T ss_pred             CCCccCcCCcCCCceEEEeCCCeEEecccc
Confidence            345777777774322 22 22344565554


No 25 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=72.25  E-value=2.3  Score=23.19  Aligned_cols=28  Identities=18%  Similarity=0.533  Sum_probs=18.6

Q ss_pred             Cccccccccccc--cceee--ecCcccccCCc
Q psy2501          53 KGCCSSCDKPIV--GQVIT--ALGKTWHPEHF   80 (130)
Q Consensus        53 ~~~C~~C~~~i~--~~~~~--~~~~~~H~~Cf   80 (130)
                      +.+|..|++.|.  +.++.  .-+..||.+|.
T Consensus         5 ~~~C~~Cg~~~~~~dDiVvCp~CgapyHR~C~   36 (54)
T PF14446_consen    5 GCKCPVCGKKFKDGDDIVVCPECGAPYHRDCW   36 (54)
T ss_pred             CccChhhCCcccCCCCEEECCCCCCcccHHHH
Confidence            467999999983  44443  34566777775


No 26 
>KOG1813|consensus
Probab=71.24  E-value=2.3  Score=31.36  Aligned_cols=46  Identities=15%  Similarity=0.346  Sum_probs=33.9

Q ss_pred             cccCCCCcccCCCCeeccCCcccCHHhhhhhcC--CCCccCccccccCc
Q psy2501          80 FICTHCNQELGTRNFFERDSRPYCEPDYHNLFS--PRCSYCNGPILDVS  126 (130)
Q Consensus        80 f~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~--~~C~~C~~~I~~~~  126 (130)
                      |.|..|.+..-. .....-+.-+|..|..+.|.  ++|..|++.|.|.+
T Consensus       242 f~c~icr~~f~~-pVvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~g~~  289 (313)
T KOG1813|consen  242 FKCFICRKYFYR-PVVTKCGHYFCEVCALKPYQKGEKCYVCSQQTHGSF  289 (313)
T ss_pred             cccccccccccc-chhhcCCceeehhhhccccccCCcceeccccccccc
Confidence            677778777632 23344567789999988775  59999999988765


No 27 
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=70.78  E-value=4.5  Score=21.12  Aligned_cols=29  Identities=14%  Similarity=0.450  Sum_probs=18.1

Q ss_pred             ccCCCCcccCCCCeec--cCCcccCHHhhhh
Q psy2501          81 ICTHCNQELGTRNFFE--RDSRPYCEPDYHN  109 (130)
Q Consensus        81 ~C~~C~~~l~~~~~~~--~~~~~~C~~~~~~  109 (130)
                      .|..|+..+....|..  ..+..+|..||.+
T Consensus         2 ~C~~Cg~D~t~vryh~~~~~~~dLC~~CF~~   32 (45)
T cd02336           2 HCFTCGNDCTRVRYHNLKAKKYDLCPSCYQE   32 (45)
T ss_pred             cccCCCCccCceEEEecCCCccccChHHHhC
Confidence            4666777776444441  2246779999874


No 28 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=70.68  E-value=4.5  Score=20.98  Aligned_cols=10  Identities=20%  Similarity=0.428  Sum_probs=6.4

Q ss_pred             cccCHHhhhh
Q psy2501         100 RPYCEPDYHN  109 (130)
Q Consensus       100 ~~~C~~~~~~  109 (130)
                      ..+|..||..
T Consensus        23 ~dLC~~Cf~~   32 (46)
T cd02249          23 FDLCSSCYAK   32 (46)
T ss_pred             CcCHHHHHCc
Confidence            4557777764


No 29 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=70.59  E-value=2.4  Score=21.23  Aligned_cols=23  Identities=26%  Similarity=0.472  Sum_probs=14.7

Q ss_pred             ccccccccccc--eeeecCcccccC
Q psy2501          56 CSSCDKPIVGQ--VITALGKTWHPE   78 (130)
Q Consensus        56 C~~C~~~i~~~--~~~~~~~~~H~~   78 (130)
                      |..|+.+|.++  .+...++.|+.-
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~fC   25 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYYFC   25 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEEEE
Confidence            56688888643  345677777733


No 30 
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=70.18  E-value=5  Score=20.62  Aligned_cols=10  Identities=10%  Similarity=0.434  Sum_probs=7.0

Q ss_pred             cccCHHhhhh
Q psy2501         100 RPYCEPDYHN  109 (130)
Q Consensus       100 ~~~C~~~~~~  109 (130)
                      ..+|..||..
T Consensus        27 ~dlC~~Cf~~   36 (44)
T smart00291       27 YDLCQSCFAK   36 (44)
T ss_pred             ccchHHHHhC
Confidence            4568888864


No 31 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=69.28  E-value=1.5  Score=25.67  Aligned_cols=33  Identities=27%  Similarity=0.625  Sum_probs=20.1

Q ss_pred             CCCCccccccccccc-cce-----eeec-C-----cccccCCccc
Q psy2501          50 TTQKGCCSSCDKPIV-GQV-----ITAL-G-----KTWHPEHFIC   82 (130)
Q Consensus        50 ~~~~~~C~~C~~~i~-~~~-----~~~~-~-----~~~H~~Cf~C   82 (130)
                      .++...|..|+..|. +..     +... +     ..||..||.=
T Consensus         4 ks~Ra~Ck~C~~~I~kg~lRiG~~~~~~~~~~~~~~W~H~~C~~~   48 (82)
T PF00645_consen    4 KSGRAKCKGCKKKIAKGELRIGKIVPSPEGDGDIPKWYHWDCFFK   48 (82)
T ss_dssp             SSSTEBETTTSCBE-TTSEEEEEEEEETTSSCEEEEEEEHHHHHH
T ss_pred             CCCCccCcccCCcCCCCCEEEEEEecccccCCCCCceECcccccc
Confidence            345568999999994 322     1122 1     3578888763


No 32 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=68.82  E-value=1.9  Score=30.06  Aligned_cols=48  Identities=13%  Similarity=0.396  Sum_probs=35.0

Q ss_pred             CcccCCCCcccCCCCeeccCCcccCHHhhhhhcC--CCCccCccccccCce
Q psy2501          79 HFICTHCNQELGTRNFFERDSRPYCEPDYHNLFS--PRCSYCNGPILDVSI  127 (130)
Q Consensus        79 Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~--~~C~~C~~~I~~~~~  127 (130)
                      =|.|..|...... ..+..=|.-||..|+.+.+.  +.|..|++.--|.+-
T Consensus       196 PF~C~iCKkdy~s-pvvt~CGH~FC~~Cai~~y~kg~~C~~Cgk~t~G~f~  245 (259)
T COG5152         196 PFLCGICKKDYES-PVVTECGHSFCSLCAIRKYQKGDECGVCGKATYGRFW  245 (259)
T ss_pred             ceeehhchhhccc-hhhhhcchhHHHHHHHHHhccCCcceecchhhcccee
Confidence            3788888876532 23344577889999988875  699999998766653


No 33 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=68.67  E-value=8.3  Score=19.62  Aligned_cols=23  Identities=26%  Similarity=0.561  Sum_probs=16.5

Q ss_pred             CCcccCHHhhhhhc--CCCCccCcc
Q psy2501          98 DSRPYCEPDYHNLF--SPRCSYCNG  120 (130)
Q Consensus        98 ~~~~~C~~~~~~~~--~~~C~~C~~  120 (130)
                      =|..+|..|..+..  ...|-.|++
T Consensus        20 CgH~~C~~C~~~~~~~~~~CP~C~k   44 (44)
T PF14634_consen   20 CGHIFCEKCLKKLKGKSVKCPICRK   44 (44)
T ss_pred             cCCHHHHHHHHhhcCCCCCCcCCCC
Confidence            36788888887776  457777753


No 34 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=68.58  E-value=3.2  Score=20.57  Aligned_cols=23  Identities=26%  Similarity=0.589  Sum_probs=15.0

Q ss_pred             ccCCCCcccCCCCeeccCCcccCHHhh
Q psy2501          81 ICTHCNQELGTRNFFERDSRPYCEPDY  107 (130)
Q Consensus        81 ~C~~C~~~l~~~~~~~~~~~~~C~~~~  107 (130)
                      .|..|+..    .+...+|..||..|-
T Consensus        10 ~C~~C~~~----~~~~~dG~~yC~~cG   32 (36)
T PF11781_consen   10 PCPVCGSR----WFYSDDGFYYCDRCG   32 (36)
T ss_pred             cCCCCCCe----EeEccCCEEEhhhCc
Confidence            35666553    455778888887664


No 35 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=68.41  E-value=1.3  Score=21.83  Aligned_cols=27  Identities=11%  Similarity=0.379  Sum_probs=12.0

Q ss_pred             cCCCCcccCCCCeeccCCcccCHHhhh
Q psy2501          82 CTHCNQELGTRNFFERDSRPYCEPDYH  108 (130)
Q Consensus        82 C~~C~~~l~~~~~~~~~~~~~C~~~~~  108 (130)
                      |..|+.++...+.....+..+|..|+.
T Consensus         6 C~~CGe~I~~~Rl~~~p~~~~C~~C~~   32 (36)
T PF01258_consen    6 CEDCGEPIPEERLVAVPGATLCVECQE   32 (36)
T ss_dssp             -TTTSSBEEHHHHHHCTTECS-HHHHH
T ss_pred             ccccCChHHHHHHHhCCCcEECHHHhC
Confidence            444444444333334455556666654


No 36 
>KOG2462|consensus
Probab=68.28  E-value=2.9  Score=30.47  Aligned_cols=37  Identities=19%  Similarity=0.305  Sum_probs=20.0

Q ss_pred             ccccccccccccceeeecCcccccCCcccCCCCcccC
Q psy2501          54 GCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELG   90 (130)
Q Consensus        54 ~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~   90 (130)
                      ..|..|++.-..+-...+-..-|.--+.|..|++.++
T Consensus       162 ~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFS  198 (279)
T KOG2462|consen  162 FSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFS  198 (279)
T ss_pred             ccCCCCCceeeehHHHhhHhhccCCCccccccccccc
Confidence            4566666654322112233334665667777777764


No 37 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=65.86  E-value=4  Score=33.59  Aligned_cols=38  Identities=26%  Similarity=0.499  Sum_probs=25.1

Q ss_pred             ccCCCCcccCCCCeeccCCcccCHHhhhhhcCCCCccCccc
Q psy2501          81 ICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGP  121 (130)
Q Consensus        81 ~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~C~~C~~~  121 (130)
                      +|..|+.+|.   ++...+.+.|.-|-......+|-.|+..
T Consensus       394 ~C~~C~~~L~---~h~~~~~l~Ch~CG~~~~p~~Cp~Cgs~  431 (665)
T PRK14873        394 RCRHCTGPLG---LPSAGGTPRCRWCGRAAPDWRCPRCGSD  431 (665)
T ss_pred             ECCCCCCcee---EecCCCeeECCCCcCCCcCccCCCCcCC
Confidence            5566666663   3444567778888665555589999764


No 38 
>KOG0320|consensus
Probab=65.45  E-value=4  Score=27.91  Aligned_cols=48  Identities=13%  Similarity=0.421  Sum_probs=35.3

Q ss_pred             CCcccCCCCcccCCCC-eeccCCcccCHHhhhhhc--CCCCccCccccccC
Q psy2501          78 EHFICTHCNQELGTRN-FFERDSRPYCEPDYHNLF--SPRCSYCNGPILDV  125 (130)
Q Consensus        78 ~Cf~C~~C~~~l~~~~-~~~~~~~~~C~~~~~~~~--~~~C~~C~~~I~~~  125 (130)
                      .+++|..|-....... +.-.=|.+||..|-...+  +.+|-.|++.|+-+
T Consensus       130 ~~~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~C~kkIt~k  180 (187)
T KOG0320|consen  130 GTYKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPTCRKKITHK  180 (187)
T ss_pred             cccCCCceecchhhccccccccchhHHHHHHHHHHHhCCCCCCcccccchh
Confidence            5678888777765543 446668999999987544  46999999988743


No 39 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=63.46  E-value=3.3  Score=26.84  Aligned_cols=10  Identities=20%  Similarity=0.584  Sum_probs=5.5

Q ss_pred             cCCcccCHHh
Q psy2501          97 RDSRPYCEPD  106 (130)
Q Consensus        97 ~~~~~~C~~~  106 (130)
                      .+|.+||..|
T Consensus        41 KdG~v~CPvC   50 (131)
T COG1645          41 KDGEVFCPVC   50 (131)
T ss_pred             eCCeEECCCC
Confidence            5555555555


No 40 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=63.02  E-value=8.3  Score=20.12  Aligned_cols=42  Identities=21%  Similarity=0.503  Sum_probs=25.4

Q ss_pred             cCCCCcccCCCCeeccCCcc-cCHHhhhhhc--CCCCccCcccccc
Q psy2501          82 CTHCNQELGTRNFFERDSRP-YCEPDYHNLF--SPRCSYCNGPILD  124 (130)
Q Consensus        82 C~~C~~~l~~~~~~~~~~~~-~C~~~~~~~~--~~~C~~C~~~I~~  124 (130)
                      |..|...... ..+..=|.. +|..|..+.+  ..+|-.|.++|+.
T Consensus         5 C~iC~~~~~~-~~~~pCgH~~~C~~C~~~~~~~~~~CP~Cr~~i~~   49 (50)
T PF13920_consen    5 CPICFENPRD-VVLLPCGHLCFCEECAERLLKRKKKCPICRQPIES   49 (50)
T ss_dssp             -TTTSSSBSS-EEEETTCEEEEEHHHHHHHHHTTSBBTTTTBB-SE
T ss_pred             CccCCccCCc-eEEeCCCChHHHHHHhHHhcccCCCCCcCChhhcC
Confidence            4444444322 122344566 8999987764  4689999999863


No 41 
>KOG4739|consensus
Probab=62.60  E-value=5.8  Score=28.33  Aligned_cols=34  Identities=24%  Similarity=0.465  Sum_probs=25.5

Q ss_pred             CCCeeccC-CcccCHHhhhhhcCCCCccCcccccc
Q psy2501          91 TRNFFERD-SRPYCEPDYHNLFSPRCSYCNGPILD  124 (130)
Q Consensus        91 ~~~~~~~~-~~~~C~~~~~~~~~~~C~~C~~~I~~  124 (130)
                      ...||... ..++|..|.....++.|..|.+.|..
T Consensus        15 ~~~f~LTaC~HvfC~~C~k~~~~~~C~lCkk~ir~   49 (233)
T KOG4739|consen   15 QDPFFLTACRHVFCEPCLKASSPDVCPLCKKSIRI   49 (233)
T ss_pred             CCceeeeechhhhhhhhcccCCccccccccceeee
Confidence            44566443 67889999877777799999998754


No 42 
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=61.86  E-value=4.6  Score=23.90  Aligned_cols=28  Identities=32%  Similarity=0.675  Sum_probs=16.2

Q ss_pred             cCCCCcccCCCCee-----ccCCcccCHHhhhh
Q psy2501          82 CTHCNQELGTRNFF-----ERDSRPYCEPDYHN  109 (130)
Q Consensus        82 C~~C~~~l~~~~~~-----~~~~~~~C~~~~~~  109 (130)
                      |..|+.||.....+     ...+.-||.-||..
T Consensus         3 CQSCGMPl~~~~~~Gte~dGs~s~~YC~yCy~~   35 (81)
T PF12674_consen    3 CQSCGMPLSKDEDFGTEADGSKSEDYCSYCYQN   35 (81)
T ss_pred             CCcCcCccCCccccccccCCCCchhHHHHHhcC
Confidence            56677776533322     33346788888753


No 43 
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=61.24  E-value=6  Score=20.54  Aligned_cols=11  Identities=18%  Similarity=0.452  Sum_probs=7.5

Q ss_pred             CcccCHHhhhh
Q psy2501          99 SRPYCEPDYHN  109 (130)
Q Consensus        99 ~~~~C~~~~~~  109 (130)
                      +.-+|..||.+
T Consensus        27 d~dLC~~C~~~   37 (46)
T PF00569_consen   27 DYDLCEDCFSK   37 (46)
T ss_dssp             S-EEEHHHHHH
T ss_pred             CCchhhHHHhC
Confidence            35678888875


No 44 
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=60.98  E-value=10  Score=20.02  Aligned_cols=12  Identities=8%  Similarity=-0.020  Sum_probs=8.3

Q ss_pred             CcccCHHhhhhh
Q psy2501          99 SRPYCEPDYHNL  110 (130)
Q Consensus        99 ~~~~C~~~~~~~  110 (130)
                      +.-+|..||.+.
T Consensus        25 d~DlC~~C~~~~   36 (48)
T cd02341          25 DFDLCQDCVVKG   36 (48)
T ss_pred             CCccCHHHHhCc
Confidence            355688888754


No 45 
>PF12773 DZR:  Double zinc ribbon
Probab=60.69  E-value=12  Score=19.45  Aligned_cols=9  Identities=44%  Similarity=1.161  Sum_probs=4.3

Q ss_pred             cCCCCcccC
Q psy2501          82 CTHCNQELG   90 (130)
Q Consensus        82 C~~C~~~l~   90 (130)
                      |..|+..|.
T Consensus        15 C~~CG~~l~   23 (50)
T PF12773_consen   15 CPHCGTPLP   23 (50)
T ss_pred             ChhhcCChh
Confidence            444555443


No 46 
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=60.10  E-value=7.7  Score=21.48  Aligned_cols=28  Identities=21%  Similarity=0.695  Sum_probs=18.7

Q ss_pred             ccCCCCcccC-CCC-eeccCCcccC-HHhhh
Q psy2501          81 ICTHCNQELG-TRN-FFERDSRPYC-EPDYH  108 (130)
Q Consensus        81 ~C~~C~~~l~-~~~-~~~~~~~~~C-~~~~~  108 (130)
                      .|..|++.|. +.. |..++.+.+| ..|-.
T Consensus        18 ~C~~C~k~L~~~~DiymYrGd~aFCS~ECR~   48 (58)
T PF04570_consen   18 FCYLCKKKLDPGKDIYMYRGDKAFCSEECRS   48 (58)
T ss_pred             HHHccCCCCCCCCCeeeeccccccccHHHHH
Confidence            4667778886 344 4478888888 46644


No 47 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=57.75  E-value=18  Score=19.90  Aligned_cols=25  Identities=16%  Similarity=0.592  Sum_probs=18.6

Q ss_pred             ccCHHhhhhhcCCCCccCccccccC
Q psy2501         101 PYCEPDYHNLFSPRCSYCNGPILDV  125 (130)
Q Consensus       101 ~~C~~~~~~~~~~~C~~C~~~I~~~  125 (130)
                      -||..|....+...|-.|+..+..+
T Consensus        30 TFC~~C~e~~l~~~CPNCgGelv~R   54 (57)
T PF06906_consen   30 TFCADCAETMLNGVCPNCGGELVRR   54 (57)
T ss_pred             cccHHHHHHHhcCcCcCCCCccccC
Confidence            4688888888788888887765443


No 48 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=56.89  E-value=12  Score=19.22  Aligned_cols=10  Identities=20%  Similarity=0.238  Sum_probs=5.9

Q ss_pred             cccCHHhhhh
Q psy2501         100 RPYCEPDYHN  109 (130)
Q Consensus       100 ~~~C~~~~~~  109 (130)
                      ..+|..||..
T Consensus        23 ~dLC~~C~~~   32 (43)
T cd02340          23 YDLCESCEAK   32 (43)
T ss_pred             ccchHHhhCc
Confidence            4457777654


No 49 
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=55.95  E-value=4.1  Score=22.80  Aligned_cols=13  Identities=31%  Similarity=0.491  Sum_probs=10.1

Q ss_pred             CCCCccCcccccc
Q psy2501         112 SPRCSYCNGPILD  124 (130)
Q Consensus       112 ~~~C~~C~~~I~~  124 (130)
                      ..+|++|+++|..
T Consensus         4 PiRCFsCGkvi~~   16 (63)
T COG1644           4 PVRCFSCGKVIGH   16 (63)
T ss_pred             ceEeecCCCCHHH
Confidence            3489999998853


No 50 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=54.89  E-value=11  Score=20.21  Aligned_cols=29  Identities=24%  Similarity=0.544  Sum_probs=18.9

Q ss_pred             ccCCCCcccCCCC-eeccCCcccCHHhhhhh
Q psy2501          81 ICTHCNQELGTRN-FFERDSRPYCEPDYHNL  110 (130)
Q Consensus        81 ~C~~C~~~l~~~~-~~~~~~~~~C~~~~~~~  110 (130)
                      .|..|+..++--. +-..+| ..|..|+.+.
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHh
Confidence            3677777775332 446666 5799998665


No 51 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=54.64  E-value=8.9  Score=17.29  Aligned_cols=9  Identities=33%  Similarity=0.988  Sum_probs=4.4

Q ss_pred             ccccccccc
Q psy2501          55 CCSSCDKPI   63 (130)
Q Consensus        55 ~C~~C~~~i   63 (130)
                      .|..|+..+
T Consensus         4 ~Cp~Cg~~~   12 (26)
T PF13248_consen    4 FCPNCGAEI   12 (26)
T ss_pred             CCcccCCcC
Confidence            355555543


No 52 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=54.55  E-value=13  Score=17.94  Aligned_cols=24  Identities=17%  Similarity=0.573  Sum_probs=13.2

Q ss_pred             CCcccCHHhhhhhc---CCCCccCccc
Q psy2501          98 DSRPYCEPDYHNLF---SPRCSYCNGP  121 (130)
Q Consensus        98 ~~~~~C~~~~~~~~---~~~C~~C~~~  121 (130)
                      =+..||..|..+.+   ..+|-.|...
T Consensus        18 C~H~~c~~C~~~~~~~~~~~Cp~C~~~   44 (45)
T cd00162          18 CGHVFCRSCIDKWLKSGKNTCPLCRTP   44 (45)
T ss_pred             CCChhcHHHHHHHHHhCcCCCCCCCCc
Confidence            34556666654333   2357777654


No 53 
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=53.60  E-value=1.9  Score=26.41  Aligned_cols=48  Identities=23%  Similarity=0.490  Sum_probs=28.0

Q ss_pred             ccccccccccce-eeecCcccccCCcccCCCCcccCCCCeeccCCcccC
Q psy2501          56 CSSCDKPIVGQV-ITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYC  103 (130)
Q Consensus        56 C~~C~~~i~~~~-~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C  103 (130)
                      |..|+..+.... ..+.-..+++.+-.|..|...|.-.+|...+.=+||
T Consensus        38 Cy~CHdel~~Hpf~p~~~~~~~~~~iiCGvC~~~LT~~EY~~~~~Cp~C   86 (105)
T COG4357          38 CYHCHDELEDHPFEPWGLQEFNPKAIICGVCRKLLTRAEYGMCGSCPYC   86 (105)
T ss_pred             HHHHHhHHhcCCCccCChhhcCCccEEhhhhhhhhhHHHHhhcCCCCCc
Confidence            556666664322 334445677777788888887765555544443333


No 54 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=53.48  E-value=18  Score=20.04  Aligned_cols=49  Identities=22%  Similarity=0.505  Sum_probs=27.5

Q ss_pred             CccccccccccccceeeecCcccccCCcccCCCCcccCCCCeeccCCcccCHHhhhhhcCCCCccCc
Q psy2501          53 KGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCN  119 (130)
Q Consensus        53 ~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~C~~C~  119 (130)
                      .++|..|+..|.+.-        +---|.|..|+..+-.          -|..|-.....-+|-.|+
T Consensus         7 ~~~CtSCg~~i~~~~--------~~~~F~CPnCG~~~I~----------RC~~CRk~~~~Y~CP~CG   55 (59)
T PRK14890          7 PPKCTSCGIEIAPRE--------KAVKFLCPNCGEVIIY----------RCEKCRKQSNPYTCPKCG   55 (59)
T ss_pred             CccccCCCCcccCCC--------ccCEeeCCCCCCeeEe----------echhHHhcCCceECCCCC
Confidence            457999999885321        1112777777775311          166664433334666665


No 55 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=53.12  E-value=7.4  Score=21.70  Aligned_cols=13  Identities=31%  Similarity=0.537  Sum_probs=9.2

Q ss_pred             CCCCccCcccccc
Q psy2501         112 SPRCSYCNGPILD  124 (130)
Q Consensus       112 ~~~C~~C~~~I~~  124 (130)
                      ..+|++|++.|..
T Consensus         4 PVRCFTCGkvi~~   16 (60)
T PF01194_consen    4 PVRCFTCGKVIGN   16 (60)
T ss_dssp             SSS-STTTSBTCG
T ss_pred             ceecCCCCCChhH
Confidence            4589999998853


No 56 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=51.33  E-value=11  Score=30.02  Aligned_cols=38  Identities=16%  Similarity=0.519  Sum_probs=22.8

Q ss_pred             ccCCCCcccCCCCeeccCCcccCHHhhhhh-cCCCCccCccc
Q psy2501          81 ICTHCNQELGTRNFFERDSRPYCEPDYHNL-FSPRCSYCNGP  121 (130)
Q Consensus        81 ~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~-~~~~C~~C~~~  121 (130)
                      +|..|+.+|   .|+..++.+.|.-|-... +...|-.|+..
T Consensus       224 ~C~~C~~~l---~~h~~~~~l~Ch~Cg~~~~~~~~Cp~C~s~  262 (505)
T TIGR00595       224 CCPNCDVSL---TYHKKEGKLRCHYCGYQEPIPKTCPQCGSE  262 (505)
T ss_pred             CCCCCCCce---EEecCCCeEEcCCCcCcCCCCCCCCCCCCC
Confidence            445555554   344556677788775433 33488888763


No 57 
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger present in plant ubiquitin-associated (UBA) proteins. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=49.60  E-value=18  Score=18.76  Aligned_cols=11  Identities=9%  Similarity=0.268  Sum_probs=6.7

Q ss_pred             CcccCHHhhhh
Q psy2501          99 SRPYCEPDYHN  109 (130)
Q Consensus        99 ~~~~C~~~~~~  109 (130)
                      +.-+|..||.+
T Consensus        23 dyDLC~~C~~~   33 (43)
T cd02342          23 DYDLCTICFSR   33 (43)
T ss_pred             CCccHHHHhhh
Confidence            34567777654


No 58 
>PF02069 Metallothio_Pro:  Prokaryotic metallothionein;  InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ]. An empirical classification into three classes was proposed by Kojima [], with class III MTs including atypical polypeptides composed of gamma-glutamylcysteinyl units. Class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. The MT superfamily is subdivided into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects [], e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range.  Family 14 consists of prokaryota MTs. Its members are recognised by the sequence pattern K-C-A-C-x(2)-C-L-C.The taxonomic range of the members extends to cyanobacteria. Known characteristics are: 53 to 56 AAs; 9 conserved Cys; one conserved tyrosine residue; one conserved histidine residue; contain other unusual residues. ; GO: 0046872 metal ion binding; PDB: 1JJD_A.
Probab=49.36  E-value=11  Score=20.32  Aligned_cols=28  Identities=21%  Similarity=0.583  Sum_probs=15.2

Q ss_pred             ccCCCCcccCCCCeeccCCcccC-HHhhh
Q psy2501          81 ICTHCNQELGTRNFFERDSRPYC-EPDYH  108 (130)
Q Consensus        81 ~C~~C~~~l~~~~~~~~~~~~~C-~~~~~  108 (130)
                      .|..|.-.++...-...+|+.|| +.|..
T Consensus         9 aC~~C~C~V~~~~Ai~~dGk~YCS~aCA~   37 (52)
T PF02069_consen    9 ACPSCSCVVSEEEAIQKDGKYYCSEACAN   37 (52)
T ss_dssp             SSTT----B-TTTSEESSS-EESSHHHHH
T ss_pred             cCCCCEeEECchHhHHhCCEeeecHHHhc
Confidence            45667777765566788999998 56643


No 59 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=49.01  E-value=7  Score=21.94  Aligned_cols=14  Identities=29%  Similarity=0.610  Sum_probs=10.7

Q ss_pred             cCCCCccCcccccc
Q psy2501         111 FSPRCSYCNGPILD  124 (130)
Q Consensus       111 ~~~~C~~C~~~I~~  124 (130)
                      +..+|++|++.|..
T Consensus         3 iPvRCFTCGkvi~~   16 (62)
T PRK04016          3 IPVRCFTCGKVIAE   16 (62)
T ss_pred             CCeEecCCCCChHH
Confidence            34589999998854


No 60 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=48.37  E-value=21  Score=19.90  Aligned_cols=27  Identities=30%  Similarity=0.838  Sum_probs=16.8

Q ss_pred             Cccccccccccc-cceeeecCcccccCCcccCCCCcc
Q psy2501          53 KGCCSSCDKPIV-GQVITALGKTWHPEHFICTHCNQE   88 (130)
Q Consensus        53 ~~~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~   88 (130)
                      .+.|..|+..|. ++...         -|.|..|+..
T Consensus         9 ~~~CtSCg~~i~p~e~~v---------~F~CPnCGe~   36 (61)
T COG2888           9 PPVCTSCGREIAPGETAV---------KFPCPNCGEV   36 (61)
T ss_pred             CceeccCCCEeccCCcee---------EeeCCCCCce
Confidence            468999999883 33211         1667777743


No 61 
>PF13695 zf-3CxxC:  Zinc-binding domain
Probab=48.02  E-value=19  Score=21.88  Aligned_cols=10  Identities=30%  Similarity=0.757  Sum_probs=6.2

Q ss_pred             cccccccccc
Q psy2501          55 CCSSCDKPIV   64 (130)
Q Consensus        55 ~C~~C~~~i~   64 (130)
                      .|..|+....
T Consensus         7 ~C~~C~~~W~   16 (98)
T PF13695_consen    7 QCSKCSRGWT   16 (98)
T ss_pred             ECCCCCCCCc
Confidence            5667766654


No 62 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=47.81  E-value=31  Score=22.57  Aligned_cols=39  Identities=18%  Similarity=0.418  Sum_probs=23.3

Q ss_pred             CCCccccccccccc--c-c-e---eeecCcccccCCcccCCCCccc
Q psy2501          51 TQKGCCSSCDKPIV--G-Q-V---ITALGKTWHPEHFICTHCNQEL   89 (130)
Q Consensus        51 ~~~~~C~~C~~~i~--~-~-~---~~~~~~~~H~~Cf~C~~C~~~l   89 (130)
                      ....+|..|+..+.  . + .   +...-...+...+.|..|++-.
T Consensus        89 ~~~sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiy  134 (147)
T PF01927_consen   89 PIFSRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIY  134 (147)
T ss_pred             CCCCccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEe
Confidence            34578999999873  1 1 1   1112222355677889888854


No 63 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=47.69  E-value=57  Score=27.44  Aligned_cols=73  Identities=16%  Similarity=0.341  Sum_probs=42.8

Q ss_pred             CchhHHHHHHHHHHHHh------hhcCCCCCCCccccccccccccceeeecCcccccCCcccCCCCcccCCCCeeccCCc
Q psy2501          27 QKGKQLDCMLDSLTAEM------SRQGVTTTQKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSR  100 (130)
Q Consensus        27 ~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~  100 (130)
                      |+..-++.+...+....      .+.+|.  ..-.|..|+..                 +.|..|+..|   .++-..+.
T Consensus       405 lS~~Ll~~i~~~l~~geQ~llflnRRGys--~~l~C~~Cg~v-----------------~~Cp~Cd~~l---t~H~~~~~  462 (730)
T COG1198         405 LSPALLEAIRKTLERGEQVLLFLNRRGYA--PLLLCRDCGYI-----------------AECPNCDSPL---TLHKATGQ  462 (730)
T ss_pred             CCHHHHHHHHHHHhcCCeEEEEEccCCcc--ceeecccCCCc-----------------ccCCCCCcce---EEecCCCe
Confidence            45555555555444332      333332  22357777653                 4666777766   35555678


Q ss_pred             ccCHHhhhh-hcCCCCccCccc
Q psy2501         101 PYCEPDYHN-LFSPRCSYCNGP  121 (130)
Q Consensus       101 ~~C~~~~~~-~~~~~C~~C~~~  121 (130)
                      +.|.-|-.. .....|-.|+..
T Consensus       463 L~CH~Cg~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         463 LRCHYCGYQEPIPQSCPECGSE  484 (730)
T ss_pred             eEeCCCCCCCCCCCCCCCCCCC
Confidence            888877655 344589999876


No 64 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=47.46  E-value=7.1  Score=19.98  Aligned_cols=9  Identities=33%  Similarity=0.951  Sum_probs=4.5

Q ss_pred             cCCcccCHH
Q psy2501          97 RDSRPYCEP  105 (130)
Q Consensus        97 ~~~~~~C~~  105 (130)
                      ++++.||..
T Consensus        31 k~g~~~Cv~   39 (41)
T PF06677_consen   31 KDGKIYCVS   39 (41)
T ss_pred             cCCCEECCC
Confidence            445555543


No 65 
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=47.14  E-value=23  Score=18.58  Aligned_cols=11  Identities=9%  Similarity=0.042  Sum_probs=6.6

Q ss_pred             cccCHHhhhhh
Q psy2501         100 RPYCEPDYHNL  110 (130)
Q Consensus       100 ~~~C~~~~~~~  110 (130)
                      ..+|..||...
T Consensus        24 ~dLC~~Cf~~g   34 (49)
T cd02335          24 FDLCLECFSAG   34 (49)
T ss_pred             cchhHHhhhCc
Confidence            44577777643


No 66 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=46.66  E-value=8.4  Score=25.73  Aligned_cols=27  Identities=19%  Similarity=0.429  Sum_probs=19.8

Q ss_pred             CcccCHHhhhhhcCCCCccCccccccCc
Q psy2501          99 SRPYCEPDYHNLFSPRCSYCNGPILDVS  126 (130)
Q Consensus        99 ~~~~C~~~~~~~~~~~C~~C~~~I~~~~  126 (130)
                      ..-||..|-.+.. -.|-.|+-+|.|.+
T Consensus        27 ~~~fC~kCG~~tI-~~Cp~C~~~IrG~y   53 (158)
T PF10083_consen   27 REKFCSKCGAKTI-TSCPNCSTPIRGDY   53 (158)
T ss_pred             HHHHHHHhhHHHH-HHCcCCCCCCCCce
Confidence            4567888876655 67888888888764


No 67 
>PRK11595 DNA utilization protein GntX; Provisional
Probab=44.83  E-value=25  Score=24.70  Aligned_cols=12  Identities=33%  Similarity=0.858  Sum_probs=8.5

Q ss_pred             Cccccccccccc
Q psy2501          53 KGCCSSCDKPIV   64 (130)
Q Consensus        53 ~~~C~~C~~~i~   64 (130)
                      .++|..|+..+.
T Consensus         5 P~~C~~C~~~~~   16 (227)
T PRK11595          5 PGLCWLCRMPLA   16 (227)
T ss_pred             CCcCccCCCccC
Confidence            356888887763


No 68 
>PF10892 DUF2688:  Protein of unknown function (DUF2688);  InterPro: IPR024392 Members of this protein family are annotated as KleB, and may play a role in the regulation of transcription in plasmids.
Probab=44.81  E-value=5.2  Score=21.92  Aligned_cols=36  Identities=19%  Similarity=0.376  Sum_probs=20.0

Q ss_pred             ccCCCCcccCCCCeeccCCcccCHHhhhhhcCCCCccCccc
Q psy2501          81 ICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGP  121 (130)
Q Consensus        81 ~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~C~~C~~~  121 (130)
                      .|..|++++.....     .+|=-+.-..+|+.+|..|--|
T Consensus        12 ~CrRCGk~i~tl~~-----SL~Gad~lr~klG~IC~~Citp   47 (60)
T PF10892_consen   12 PCRRCGKSIRTLSR-----SLIGADDLRVKLGGICGDCITP   47 (60)
T ss_pred             hhhhhCccHHHHHH-----HhhChHHHHHHHcchhhccCCH
Confidence            45566666543221     1222334457788899988655


No 69 
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger present in potassium channel modulatory factor (PCMF) 1  and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Human potassium channel modulatory factor 1 or FIGC has been shown to possess intrinsic E3 ubiquitin ligase activity and to promote ubiquitination.
Probab=44.48  E-value=19  Score=18.99  Aligned_cols=11  Identities=18%  Similarity=0.298  Sum_probs=6.7

Q ss_pred             cccCHHhhhhh
Q psy2501         100 RPYCEPDYHNL  110 (130)
Q Consensus       100 ~~~C~~~~~~~  110 (130)
                      ..+|..||...
T Consensus        24 ~dlC~~Cf~~~   34 (49)
T cd02338          24 YDLCADCYDSG   34 (49)
T ss_pred             CccchhHHhCC
Confidence            44577777644


No 70 
>PRK00420 hypothetical protein; Validated
Probab=42.93  E-value=12  Score=23.57  Aligned_cols=11  Identities=27%  Similarity=0.863  Sum_probs=7.0

Q ss_pred             ccccccccccc
Q psy2501          54 GCCSSCDKPIV   64 (130)
Q Consensus        54 ~~C~~C~~~i~   64 (130)
                      ..|..|+.+++
T Consensus        24 ~~CP~Cg~pLf   34 (112)
T PRK00420         24 KHCPVCGLPLF   34 (112)
T ss_pred             CCCCCCCCcce
Confidence            45777776663


No 71 
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=42.42  E-value=6.4  Score=21.29  Aligned_cols=13  Identities=31%  Similarity=0.815  Sum_probs=8.3

Q ss_pred             CCccccccccccc
Q psy2501          52 QKGCCSSCDKPIV   64 (130)
Q Consensus        52 ~~~~C~~C~~~i~   64 (130)
                      ....|.+|+..|.
T Consensus        21 ~~~~C~gC~~~l~   33 (56)
T PF02591_consen   21 EGGTCSGCHMELP   33 (56)
T ss_pred             eCCccCCCCEEcC
Confidence            3456777777764


No 72 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=42.11  E-value=35  Score=29.74  Aligned_cols=52  Identities=17%  Similarity=0.309  Sum_probs=34.8

Q ss_pred             CCCccccccccccccceeeecCcccccCCcccCCCCcccCCCCeeccCCcccCHHhhhhhcCCCCccCcccccc
Q psy2501          51 TQKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILD  124 (130)
Q Consensus        51 ~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~C~~C~~~I~~  124 (130)
                      .+...|..|+...              .-|+|..|+..        .....+|..|-...-...|-.|+..+.+
T Consensus       624 Vg~RfCpsCG~~t--------------~~frCP~CG~~--------Te~i~fCP~CG~~~~~y~CPKCG~El~~  675 (1121)
T PRK04023        624 IGRRKCPSCGKET--------------FYRRCPFCGTH--------TEPVYRCPRCGIEVEEDECEKCGREPTP  675 (1121)
T ss_pred             ccCccCCCCCCcC--------------CcccCCCCCCC--------CCcceeCccccCcCCCCcCCCCCCCCCc
Confidence            4567899998863              11788888876        1223468888655545679999887654


No 73 
>cd02344 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present in HERC2 and related proteins. HERC2 is a potential E3 ubiquitin protein ligase and/or guanine nucleotide exchange factor. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=41.62  E-value=28  Score=18.12  Aligned_cols=11  Identities=18%  Similarity=0.573  Sum_probs=7.4

Q ss_pred             CcccCHHhhhh
Q psy2501          99 SRPYCEPDYHN  109 (130)
Q Consensus        99 ~~~~C~~~~~~  109 (130)
                      +.-+|..||..
T Consensus        23 dyDLC~~Cf~~   33 (45)
T cd02344          23 DFDFCENCFKT   33 (45)
T ss_pred             CccchHHhhCC
Confidence            35568888765


No 74 
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=40.88  E-value=14  Score=19.94  Aligned_cols=29  Identities=21%  Similarity=0.458  Sum_probs=18.5

Q ss_pred             cccccccccccce-eeecCcccccCCcccC
Q psy2501          55 CCSSCDKPIVGQV-ITALGKTWHPEHFICT   83 (130)
Q Consensus        55 ~C~~C~~~i~~~~-~~~~~~~~H~~Cf~C~   83 (130)
                      .|..|+..+.-.. .+..++.|-.+|-.|.
T Consensus         2 ~CPyCge~~~~~iD~s~~~Q~yiEDC~vCC   31 (52)
T PF14255_consen    2 QCPYCGEPIEILIDPSAGDQEYIEDCQVCC   31 (52)
T ss_pred             CCCCCCCeeEEEEecCCCCeeEEeehhhcC
Confidence            4788888874222 3445677877776664


No 75 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=40.60  E-value=19  Score=17.64  Aligned_cols=29  Identities=14%  Similarity=0.287  Sum_probs=15.2

Q ss_pred             CCCCcccCCCCeeccCCcccCHHhhhhhc
Q psy2501          83 THCNQELGTRNFFERDSRPYCEPDYHNLF  111 (130)
Q Consensus        83 ~~C~~~l~~~~~~~~~~~~~C~~~~~~~~  111 (130)
                      ..|...+.+......=|..||..|..+.+
T Consensus         2 ~iC~~~~~~~~~~~~CGH~fC~~C~~~~~   30 (39)
T PF13923_consen    2 PICLDELRDPVVVTPCGHSFCKECIEKYL   30 (39)
T ss_dssp             TTTTSB-SSEEEECTTSEEEEHHHHHHHH
T ss_pred             CCCCCcccCcCEECCCCCchhHHHHHHHH
Confidence            34444444322334556778888876544


No 76 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=40.01  E-value=11  Score=16.61  Aligned_cols=9  Identities=33%  Similarity=1.114  Sum_probs=5.0

Q ss_pred             cCCCCcccC
Q psy2501          82 CTHCNQELG   90 (130)
Q Consensus        82 C~~C~~~l~   90 (130)
                      |..|+..+.
T Consensus         2 Cp~CG~~~~   10 (23)
T PF13240_consen    2 CPNCGAEIE   10 (23)
T ss_pred             CcccCCCCC
Confidence            455666554


No 77 
>cd02345 ZZ_dah Zinc finger, ZZ type. Zinc finger present in Drosophila dah and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Dah (discontinuous actin hexagon) is a membrane associated protein essential for cortical furrow formation in Drosophila.
Probab=38.21  E-value=26  Score=18.44  Aligned_cols=11  Identities=18%  Similarity=0.196  Sum_probs=6.6

Q ss_pred             cccCHHhhhhh
Q psy2501         100 RPYCEPDYHNL  110 (130)
Q Consensus       100 ~~~C~~~~~~~  110 (130)
                      ..+|..||...
T Consensus        24 ydLC~~Cf~~~   34 (49)
T cd02345          24 YSLCLGCYTKG   34 (49)
T ss_pred             cCchHHHHhCC
Confidence            34577777643


No 78 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=37.89  E-value=28  Score=28.76  Aligned_cols=11  Identities=18%  Similarity=0.323  Sum_probs=8.1

Q ss_pred             ccccccccccc
Q psy2501          54 GCCSSCDKPIV   64 (130)
Q Consensus        54 ~~C~~C~~~i~   64 (130)
                      .+|..|+..+.
T Consensus         2 ~~Cp~Cg~~n~   12 (645)
T PRK14559          2 LICPQCQFENP   12 (645)
T ss_pred             CcCCCCCCcCC
Confidence            36888888763


No 79 
>PF13834 DUF4193:  Domain of unknown function (DUF4193)
Probab=37.79  E-value=9  Score=23.59  Aligned_cols=29  Identities=24%  Similarity=0.595  Sum_probs=17.5

Q ss_pred             CCcccCCCCcccCCCCee-ccCCcccCHHh
Q psy2501          78 EHFICTHCNQELGTRNFF-ERDSRPYCEPD  106 (130)
Q Consensus        78 ~Cf~C~~C~~~l~~~~~~-~~~~~~~C~~~  106 (130)
                      +=|.|+.|-.---..+.+ ..+|+++|..|
T Consensus        69 DEFTCssCFLV~HRSqLa~~~~g~~iC~DC   98 (99)
T PF13834_consen   69 DEFTCSSCFLVHHRSQLAREKDGQPICRDC   98 (99)
T ss_pred             CceeeeeeeeEechhhhccccCCCEecccc
Confidence            347787776432222222 66788999877


No 80 
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=37.73  E-value=14  Score=29.29  Aligned_cols=39  Identities=15%  Similarity=0.278  Sum_probs=27.6

Q ss_pred             CCccccccccccccceeeecCcccccCCcccCCCCcccC
Q psy2501          52 QKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELG   90 (130)
Q Consensus        52 ~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~   90 (130)
                      ....|..|-..+...-+...+......||.|..|...|.
T Consensus        25 ~~~yCp~CL~~~p~~e~~~~~nrC~r~Cf~CP~C~~~L~   63 (483)
T PF05502_consen   25 DSYYCPNCLFEVPSSEARSEKNRCSRNCFDCPICFSPLS   63 (483)
T ss_pred             ceeECccccccCChhhheeccceeccccccCCCCCCcce
Confidence            345688887766432234555666789999999999985


No 81 
>cd02334 ZZ_dystrophin Zinc finger, ZZ type. Zinc finger present in dystrophin and dystrobrevin. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Dystrophin attaches actin filaments to an integral membrane glycoprotein complex in muscle cells. The ZZ domain in dystrophin has been shown to be essential for binding to the membrane protein beta-dystroglycan.
Probab=36.87  E-value=34  Score=18.12  Aligned_cols=11  Identities=9%  Similarity=0.286  Sum_probs=6.9

Q ss_pred             cccCHHhhhhh
Q psy2501         100 RPYCEPDYHNL  110 (130)
Q Consensus       100 ~~~C~~~~~~~  110 (130)
                      .-+|..||...
T Consensus        24 ~DLC~~Cf~~g   34 (49)
T cd02334          24 YDLCQSCFFSG   34 (49)
T ss_pred             cCchHHHHhCC
Confidence            44577777643


No 82 
>KOG2932|consensus
Probab=35.45  E-value=23  Score=26.59  Aligned_cols=42  Identities=12%  Similarity=0.347  Sum_probs=20.4

Q ss_pred             ccCCCCcccCCCCeeccCCcccCHHhhhhhcCCCCccCcccc
Q psy2501          81 ICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPI  122 (130)
Q Consensus        81 ~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~C~~C~~~I  122 (130)
                      -|..|+.++.--...+.=+.+||.+|.-.--.+.|-.|+.+|
T Consensus        92 fCd~Cd~PI~IYGRmIPCkHvFCl~CAr~~~dK~Cp~C~d~V  133 (389)
T KOG2932|consen   92 FCDRCDFPIAIYGRMIPCKHVFCLECARSDSDKICPLCDDRV  133 (389)
T ss_pred             eecccCCcceeeecccccchhhhhhhhhcCccccCcCcccHH
Confidence            355565555311122333456666664322234677776654


No 83 
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=35.11  E-value=33  Score=17.29  Aligned_cols=28  Identities=11%  Similarity=0.292  Sum_probs=13.0

Q ss_pred             ccCCCCcccCCCCee--ccCCcccCHHhhh
Q psy2501          81 ICTHCNQELGTRNFF--ERDSRPYCEPDYH  108 (130)
Q Consensus        81 ~C~~C~~~l~~~~~~--~~~~~~~C~~~~~  108 (130)
                      +|+.|+++-......  ..++...|..|-.
T Consensus         3 ~CSFCgr~~~~v~~li~g~~~~~IC~~Cv~   32 (41)
T PF06689_consen    3 RCSFCGRPESEVGRLISGPNGAYICDECVE   32 (41)
T ss_dssp             B-TTT--BTTTSSSEEEES-SEEEEHHHHH
T ss_pred             CccCCCCCHHHHhceecCCCCcEECHHHHH
Confidence            577777776544322  3334555777654


No 84 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=33.91  E-value=62  Score=22.50  Aligned_cols=13  Identities=23%  Similarity=0.945  Sum_probs=9.5

Q ss_pred             CCCccCccccccC
Q psy2501         113 PRCSYCNGPILDV  125 (130)
Q Consensus       113 ~~C~~C~~~I~~~  125 (130)
                      .+|-.|..+|...
T Consensus        69 ~~CPvCR~~Is~~   81 (193)
T PLN03208         69 PKCPVCKSDVSEA   81 (193)
T ss_pred             CcCCCCCCcCChh
Confidence            4788888887543


No 85 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=33.32  E-value=45  Score=22.21  Aligned_cols=31  Identities=16%  Similarity=0.344  Sum_probs=22.3

Q ss_pred             CCccccccccccc-cceeeecCcccccCCcccCCCCcccC
Q psy2501          52 QKGCCSSCDKPIV-GQVITALGKTWHPEHFICTHCNQELG   90 (130)
Q Consensus        52 ~~~~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~l~   90 (130)
                      ....|..|+..+. .+.+.        .-|.|..|+..|.
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~~--------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAME--------LNFTCPRCGAMLD  139 (158)
T ss_pred             CeEECCCCCcEeeHHHHHH--------cCCcCCCCCCEee
Confidence            3457999998774 44332        2599999999884


No 86 
>KOG3476|consensus
Probab=33.01  E-value=8.7  Score=23.06  Aligned_cols=25  Identities=24%  Similarity=0.526  Sum_probs=19.4

Q ss_pred             CCcccCHHhhhhhcCCCCccCcccccc
Q psy2501          98 DSRPYCEPDYHNLFSPRCSYCNGPILD  124 (130)
Q Consensus        98 ~~~~~C~~~~~~~~~~~C~~C~~~I~~  124 (130)
                      .|.-||..|..+.  .+|+-|++.|..
T Consensus        67 ~GshYC~tCAY~K--giCAMCGKki~n   91 (100)
T KOG3476|consen   67 PGSHYCQTCAYKK--GICAMCGKKILN   91 (100)
T ss_pred             CcchhHhHhhhhh--hHHHHhhhHhhc
Confidence            4556899997654  799999998864


No 87 
>KOG3039|consensus
Probab=30.96  E-value=65  Score=23.46  Aligned_cols=75  Identities=16%  Similarity=0.214  Sum_probs=52.4

Q ss_pred             ccccccccccc--c---ceeeecCc-------ccccCCcccCCCCcccCCC-Cee--ccCCcccCHHhhhhhcCC--CCc
Q psy2501          54 GCCSSCDKPIV--G---QVITALGK-------TWHPEHFICTHCNQELGTR-NFF--ERDSRPYCEPDYHNLFSP--RCS  116 (130)
Q Consensus        54 ~~C~~C~~~i~--~---~~~~~~~~-------~~H~~Cf~C~~C~~~l~~~-~~~--~~~~~~~C~~~~~~~~~~--~C~  116 (130)
                      ..|..-+++|.  +   -.+..++.       .-|..-|.|..+...|... ..+  ...|.++|..|..+++..  .|.
T Consensus       184 v~CP~s~kplklkdL~~VkFT~l~s~~~et~l~a~s~ryiCpvtrd~LtNt~~ca~Lr~sg~Vv~~ecvEklir~D~v~p  263 (303)
T KOG3039|consen  184 VVCPVSGKPLKLKDLFAVKFTPLNSEETETKLIAASKRYICPVTRDTLTNTTPCAVLRPSGHVVTKECVEKLIRKDMVDP  263 (303)
T ss_pred             eeccCCCCccchhhcceeeeeecCCchhhhhhhhhccceecccchhhhcCccceEEeccCCcEeeHHHHHHhcccccccc
Confidence            57888888873  1   11222221       3466778999999999755 333  567899999999888764  899


Q ss_pred             cCccccccCcee
Q psy2501         117 YCNGPILDVSIR  128 (130)
Q Consensus       117 ~C~~~I~~~~~~  128 (130)
                      .|+++..++=|.
T Consensus       264 v~d~plkdrdiI  275 (303)
T KOG3039|consen  264 VTDKPLKDRDII  275 (303)
T ss_pred             CCCCcCcccceE
Confidence            999998765544


No 88 
>cd02339 ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger present in Drosophila Mind bomb (D-mib) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Mind bomb is an E3 ubiqitin ligase that has been shown to regulate signaling by the Notch ligand Delta in Drosophila melanogaster.
Probab=30.31  E-value=54  Score=16.95  Aligned_cols=9  Identities=33%  Similarity=0.726  Sum_probs=5.4

Q ss_pred             cccCHHhhh
Q psy2501         100 RPYCEPDYH  108 (130)
Q Consensus       100 ~~~C~~~~~  108 (130)
                      .-+|..||.
T Consensus        24 yDLC~~C~~   32 (45)
T cd02339          24 YDLCTTCYH   32 (45)
T ss_pred             ccchHHHhC
Confidence            345777765


No 89 
>KOG3002|consensus
Probab=29.84  E-value=50  Score=24.58  Aligned_cols=43  Identities=23%  Similarity=0.427  Sum_probs=28.3

Q ss_pred             cccCCCCcccCCCCeeccCCcccCHHhhhhhcCCCCccCccccc
Q psy2501          80 FICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPIL  123 (130)
Q Consensus        80 f~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~C~~C~~~I~  123 (130)
                      +.|..|...|.-..+--.+|.+.|..|..++ ..+|-.|.++|.
T Consensus        49 leCPvC~~~l~~Pi~QC~nGHlaCssC~~~~-~~~CP~Cr~~~g   91 (299)
T KOG3002|consen   49 LDCPVCFNPLSPPIFQCDNGHLACSSCRTKV-SNKCPTCRLPIG   91 (299)
T ss_pred             ccCchhhccCcccceecCCCcEehhhhhhhh-cccCCccccccc
Confidence            4555666666544444667788888885433 468888888865


No 90 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=29.82  E-value=29  Score=15.54  Aligned_cols=11  Identities=36%  Similarity=0.899  Sum_probs=7.5

Q ss_pred             CccCccccccC
Q psy2501         115 CSYCNGPILDV  125 (130)
Q Consensus       115 C~~C~~~I~~~  125 (130)
                      |.+|+..|.++
T Consensus         1 C~sC~~~i~~r   11 (24)
T PF07754_consen    1 CTSCGRPIAPR   11 (24)
T ss_pred             CccCCCcccCc
Confidence            66777777654


No 91 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=29.67  E-value=33  Score=17.57  Aligned_cols=26  Identities=19%  Similarity=0.544  Sum_probs=15.2

Q ss_pred             cccccccccc-cceeeecCcccccCCcccCCCCccc
Q psy2501          55 CCSSCDKPIV-GQVITALGKTWHPEHFICTHCNQEL   89 (130)
Q Consensus        55 ~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~l   89 (130)
                      +|..|+..+. +....         -++|..|+..+
T Consensus         5 ~C~~CG~~~~~~~~~~---------~~~Cp~CG~~~   31 (46)
T PRK00398          5 KCARCGREVELDEYGT---------GVRCPYCGYRI   31 (46)
T ss_pred             ECCCCCCEEEECCCCC---------ceECCCCCCeE
Confidence            5788887663 22110         36777777655


No 92 
>PF10886 DUF2685:  Protein of unknown function (DUF2685);  InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins. Their function in unknown.
Probab=29.42  E-value=32  Score=18.72  Aligned_cols=13  Identities=38%  Similarity=0.774  Sum_probs=10.1

Q ss_pred             CCCccCccccccC
Q psy2501         113 PRCSYCNGPILDV  125 (130)
Q Consensus       113 ~~C~~C~~~I~~~  125 (130)
                      .+|..|.+||..-
T Consensus         2 ~~CvVCKqpi~~a   14 (54)
T PF10886_consen    2 EICVVCKQPIDDA   14 (54)
T ss_pred             CeeeeeCCccCcc
Confidence            4788999998753


No 93 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=29.06  E-value=49  Score=16.49  Aligned_cols=29  Identities=28%  Similarity=0.555  Sum_probs=12.3

Q ss_pred             ccccccccccccc-eeeecCcccccCCcccCCCCc
Q psy2501          54 GCCSSCDKPIVGQ-VITALGKTWHPEHFICTHCNQ   87 (130)
Q Consensus        54 ~~C~~C~~~i~~~-~~~~~~~~~H~~Cf~C~~C~~   87 (130)
                      .+|..|+.-|... .+...++.     ++|..|+.
T Consensus         3 ~rC~~C~aylNp~~~~~~~~~~-----w~C~~C~~   32 (40)
T PF04810_consen    3 VRCRRCRAYLNPFCQFDDGGKT-----WICNFCGT   32 (40)
T ss_dssp             -B-TTT--BS-TTSEEETTTTE-----EEETTT--
T ss_pred             cccCCCCCEECCcceEcCCCCE-----EECcCCCC
Confidence            4688888877532 23333344     46777765


No 94 
>PHA03082 DNA-dependent RNA polymerase subunit; Provisional
Probab=28.86  E-value=12  Score=20.59  Aligned_cols=16  Identities=19%  Similarity=0.850  Sum_probs=13.0

Q ss_pred             cccCCCCcccCCCCee
Q psy2501          80 FICTHCNQELGTRNFF   95 (130)
Q Consensus        80 f~C~~C~~~l~~~~~~   95 (130)
                      ..|+.||+.|+..+|.
T Consensus         5 lVCsTCGrDlSeeRy~   20 (63)
T PHA03082          5 LVCSTCGRDLSEERYR   20 (63)
T ss_pred             eeecccCcchhHHHHH
Confidence            4799999999877665


No 95 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=28.72  E-value=23  Score=16.31  Aligned_cols=12  Identities=25%  Similarity=0.399  Sum_probs=5.3

Q ss_pred             cccccccccccc
Q psy2501          54 GCCSSCDKPIVG   65 (130)
Q Consensus        54 ~~C~~C~~~i~~   65 (130)
                      .+|..|+..|..
T Consensus         2 ~~C~rC~~~~~~   13 (30)
T PF06827_consen    2 EKCPRCWNYIED   13 (30)
T ss_dssp             SB-TTT--BBEE
T ss_pred             CcCccCCCcceE
Confidence            357777777643


No 96 
>PF05864 Chordopox_RPO7:  Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7);  InterPro: IPR008448 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This family consists of several Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide sequences. DNA-dependent RNA polymerase catalyses the transcription of DNA into RNA [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=28.61  E-value=13  Score=20.51  Aligned_cols=16  Identities=19%  Similarity=0.850  Sum_probs=13.2

Q ss_pred             cccCCCCcccCCCCee
Q psy2501          80 FICTHCNQELGTRNFF   95 (130)
Q Consensus        80 f~C~~C~~~l~~~~~~   95 (130)
                      ..|+.||+.++..+|.
T Consensus         5 lvCSTCGrDlSeeRy~   20 (63)
T PF05864_consen    5 LVCSTCGRDLSEERYR   20 (63)
T ss_pred             eeecccCCcchHHHHH
Confidence            4799999999877765


No 97 
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer.
Probab=27.67  E-value=42  Score=23.37  Aligned_cols=16  Identities=31%  Similarity=0.758  Sum_probs=12.4

Q ss_pred             CCCCccCccccccCce
Q psy2501         112 SPRCSYCNGPILDVSI  127 (130)
Q Consensus       112 ~~~C~~C~~~I~~~~~  127 (130)
                      .|+|-.|+.++.+.++
T Consensus       133 ~p~C~~Cg~~lrP~Vv  148 (218)
T cd01407         133 VPRCPKCGGLLRPDVV  148 (218)
T ss_pred             CCcCCCCCCccCCCeE
Confidence            4788899888877665


No 98 
>COG2174 RPL34A Ribosomal protein L34E [Translation, ribosomal structure and biogenesis]
Probab=27.66  E-value=26  Score=21.23  Aligned_cols=12  Identities=33%  Similarity=1.088  Sum_probs=8.6

Q ss_pred             CCCccCcccccc
Q psy2501         113 PRCSYCNGPILD  124 (130)
Q Consensus       113 ~~C~~C~~~I~~  124 (130)
                      ++|+.|+.++-|
T Consensus        35 p~C~~cg~pL~G   46 (93)
T COG2174          35 PKCAICGRPLGG   46 (93)
T ss_pred             CcccccCCccCC
Confidence            578888887643


No 99 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=27.55  E-value=19  Score=18.20  Aligned_cols=9  Identities=22%  Similarity=0.829  Sum_probs=4.5

Q ss_pred             ccccccccc
Q psy2501          55 CCSSCDKPI   63 (130)
Q Consensus        55 ~C~~C~~~i   63 (130)
                      +|..|+...
T Consensus         7 ~C~~Cg~~f   15 (42)
T PF09723_consen    7 RCEECGHEF   15 (42)
T ss_pred             EeCCCCCEE
Confidence            455555443


No 100
>KOG3579|consensus
Probab=26.42  E-value=41  Score=24.98  Aligned_cols=33  Identities=18%  Similarity=0.473  Sum_probs=25.8

Q ss_pred             CCcccccccccccc-ceeeecCcccccCCcccCC
Q psy2501          52 QKGCCSSCDKPIVG-QVITALGKTWHPEHFICTH   84 (130)
Q Consensus        52 ~~~~C~~C~~~i~~-~~~~~~~~~~H~~Cf~C~~   84 (130)
                      ....|.-|++.+.+ .+|..-.-.-|.-||-|+.
T Consensus       267 apLcCTLC~ERLEDTHFVQCPSVp~HKFCFPCSR  300 (352)
T KOG3579|consen  267 APLCCTLCHERLEDTHFVQCPSVPSHKFCFPCSR  300 (352)
T ss_pred             CceeehhhhhhhccCceeecCCCcccceecccCH
Confidence            33689999999974 6677777778999999874


No 101
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=26.10  E-value=22  Score=17.44  Aligned_cols=9  Identities=22%  Similarity=0.863  Sum_probs=4.9

Q ss_pred             ccccccccc
Q psy2501          55 CCSSCDKPI   63 (130)
Q Consensus        55 ~C~~C~~~i   63 (130)
                      +|..|+..+
T Consensus         7 ~C~~Cg~~f   15 (41)
T smart00834        7 RCEDCGHTF   15 (41)
T ss_pred             EcCCCCCEE
Confidence            455565544


No 102
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=26.06  E-value=30  Score=14.40  Aligned_cols=11  Identities=18%  Similarity=0.860  Sum_probs=6.7

Q ss_pred             cccCCCCcccC
Q psy2501          80 FICTHCNQELG   90 (130)
Q Consensus        80 f~C~~C~~~l~   90 (130)
                      |.|..|++.+.
T Consensus         1 y~C~~C~~~f~   11 (23)
T PF00096_consen    1 YKCPICGKSFS   11 (23)
T ss_dssp             EEETTTTEEES
T ss_pred             CCCCCCCCccC
Confidence            45666766654


No 103
>PF04502 DUF572:  Family of unknown function (DUF572) ;  InterPro: IPR007590 This entry represents eukaryotic proteins with undetermined function belonging to the CWC16 family.
Probab=24.82  E-value=23  Score=26.50  Aligned_cols=10  Identities=30%  Similarity=0.883  Sum_probs=6.1

Q ss_pred             CCCccCcccc
Q psy2501         113 PRCSYCNGPI  122 (130)
Q Consensus       113 ~~C~~C~~~I  122 (130)
                      -+|..|+..|
T Consensus        78 ~kC~~C~~~i   87 (324)
T PF04502_consen   78 IKCPRCSNEI   87 (324)
T ss_pred             EEcCCCCCEE
Confidence            4666666655


No 104
>PF11077 DUF2616:  Protein of unknown function (DUF2616);  InterPro: IPR020201 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf52; it is a family of uncharacterised viral proteins.
Probab=24.80  E-value=38  Score=23.13  Aligned_cols=36  Identities=17%  Similarity=0.337  Sum_probs=22.5

Q ss_pred             ccCCcccCCCCcccCCCCeeccCCcccCHHhhhhhc
Q psy2501          76 HPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLF  111 (130)
Q Consensus        76 H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~  111 (130)
                      |..|++|..--...+...++.-+-.++|..|+..+|
T Consensus       136 ~~kC~QC~~~~~~~~~~~~~~F~~~lFC~~ClFPLF  171 (173)
T PF11077_consen  136 YDKCVQCSQKCENVGAKIFTYFNFNLFCKNCLFPLF  171 (173)
T ss_pred             ccccCcCCCCcccccceeEEecChhhcccccCcccc
Confidence            345666655433333333667788899999987665


No 105
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=24.79  E-value=82  Score=21.45  Aligned_cols=31  Identities=19%  Similarity=0.483  Sum_probs=22.3

Q ss_pred             CCccccccccccc-cceeeecCcccccCCcccCCCCcccC
Q psy2501          52 QKGCCSSCDKPIV-GQVITALGKTWHPEHFICTHCNQELG   90 (130)
Q Consensus        52 ~~~~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~l~   90 (130)
                      ....|..|+..+. .+.+.        .-|.|..|+..|.
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~--------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME--------YGFRCPQCGEMLE  147 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh--------cCCcCCCCCCCCe
Confidence            3457999998774 33322        3599999999984


No 106
>cd02343 ZZ_EF Zinc finger, ZZ type. Zinc finger present in proteins with an EF_hand motif. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=24.52  E-value=85  Score=16.60  Aligned_cols=11  Identities=9%  Similarity=0.196  Sum_probs=6.5

Q ss_pred             cccCHHhhhhh
Q psy2501         100 RPYCEPDYHNL  110 (130)
Q Consensus       100 ~~~C~~~~~~~  110 (130)
                      ..+|..||.+-
T Consensus        23 ~DlC~~Cf~~g   33 (48)
T cd02343          23 MDLCKTCFLGG   33 (48)
T ss_pred             chhHHHHHhCC
Confidence            44577777643


No 107
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=24.50  E-value=54  Score=25.64  Aligned_cols=34  Identities=18%  Similarity=0.523  Sum_probs=22.1

Q ss_pred             CCCccccccccccccceeeecCcccccCCcccCCCCcccCCCC
Q psy2501          51 TQKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRN   93 (130)
Q Consensus        51 ~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~   93 (130)
                      ..+++|..|+...     ...|+.    -|+|..|+..+....
T Consensus       348 ~~~p~Cp~Cg~~m-----~S~G~~----g~rC~kCg~~~~~~~  381 (421)
T COG1571         348 RVNPVCPRCGGRM-----KSAGRN----GFRCKKCGTRARETL  381 (421)
T ss_pred             EcCCCCCccCCch-----hhcCCC----CcccccccccCCccc
Confidence            3457888888754     333443    488888888775443


No 108
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=24.35  E-value=45  Score=15.32  Aligned_cols=12  Identities=25%  Similarity=0.833  Sum_probs=2.6

Q ss_pred             cccCCCCcccCC
Q psy2501          80 FICTHCNQELGT   91 (130)
Q Consensus        80 f~C~~C~~~l~~   91 (130)
                      |.|..|+.++.+
T Consensus         1 ~~C~~C~~~~~~   12 (30)
T PF07649_consen    1 FRCDACGKPIDG   12 (30)
T ss_dssp             ---TTTS----S
T ss_pred             CcCCcCCCcCCC
Confidence            345555555543


No 109
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=24.09  E-value=77  Score=23.08  Aligned_cols=12  Identities=25%  Similarity=0.722  Sum_probs=8.1

Q ss_pred             CCccCccccccC
Q psy2501         114 RCSYCNGPILDV  125 (130)
Q Consensus       114 ~C~~C~~~I~~~  125 (130)
                      -|..|+.++.+.
T Consensus       176 PCy~C~~~v~P~  187 (278)
T PF15135_consen  176 PCYGCGNPVYPS  187 (278)
T ss_pred             CccCCCCccCcc
Confidence            577787776543


No 110
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=23.93  E-value=66  Score=28.89  Aligned_cols=50  Identities=16%  Similarity=0.361  Sum_probs=26.8

Q ss_pred             CccccccccccccceeeecCcccccCCcccCCCCcccCCCCeeccCCcccCHHhhhhhcC-----CCCccCcccccc
Q psy2501          53 KGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFS-----PRCSYCNGPILD  124 (130)
Q Consensus        53 ~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~-----~~C~~C~~~I~~  124 (130)
                      ..+|..|+..+..              +.|..|+.++..        ...|..|-...-.     ..|..|+.+...
T Consensus       667 ~rkCPkCG~~t~~--------------~fCP~CGs~te~--------vy~CPsCGaev~~des~a~~CP~CGtplv~  721 (1337)
T PRK14714        667 RRRCPSCGTETYE--------------NRCPDCGTHTEP--------VYVCPDCGAEVPPDESGRVECPRCDVELTP  721 (1337)
T ss_pred             EEECCCCCCcccc--------------ccCcccCCcCCC--------ceeCccCCCccCCCccccccCCCCCCcccc
Confidence            4678888875421              145556655421        1145555443222     268888776543


No 111
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=23.90  E-value=39  Score=13.74  Aligned_cols=11  Identities=27%  Similarity=0.881  Sum_probs=5.0

Q ss_pred             cccCCCCcccC
Q psy2501          80 FICTHCNQELG   90 (130)
Q Consensus        80 f~C~~C~~~l~   90 (130)
                      |.|..|+..+.
T Consensus         1 ~~C~~C~~~~~   11 (24)
T PF13894_consen    1 FQCPICGKSFR   11 (24)
T ss_dssp             EE-SSTS-EES
T ss_pred             CCCcCCCCcCC
Confidence            45666666553


No 112
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=23.82  E-value=39  Score=16.53  Aligned_cols=31  Identities=23%  Similarity=0.626  Sum_probs=16.3

Q ss_pred             ccccccccccceeeecCcccccCCcccCCCCcccC
Q psy2501          56 CSSCDKPIVGQVITALGKTWHPEHFICTHCNQELG   90 (130)
Q Consensus        56 C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~   90 (130)
                      |..|.+.+.    ...++.||-.-..|..||-.+.
T Consensus         2 C~~C~~Ey~----~p~~RR~~~~~isC~~CGPr~~   32 (35)
T PF07503_consen    2 CDDCLKEYF----DPSNRRFHYQFISCTNCGPRYS   32 (35)
T ss_dssp             -HHHHHHHC----STTSTTTT-TT--BTTCC-SCC
T ss_pred             CHHHHHHHc----CCCCCcccCcCccCCCCCCCEE
Confidence            444544332    3356788888888888887653


No 113
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=22.91  E-value=21  Score=17.35  Aligned_cols=16  Identities=19%  Similarity=0.642  Sum_probs=10.5

Q ss_pred             cccCCCCcccCCCCee
Q psy2501          80 FICTHCNQELGTRNFF   95 (130)
Q Consensus        80 f~C~~C~~~l~~~~~~   95 (130)
                      |.|..|++++....|+
T Consensus         5 ~~C~nC~R~v~a~RfA   20 (33)
T PF08209_consen    5 VECPNCGRPVAASRFA   20 (33)
T ss_dssp             EE-TTTSSEEEGGGHH
T ss_pred             EECCCCcCCcchhhhH
Confidence            5677788877666654


No 114
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=22.82  E-value=1.5e+02  Score=17.76  Aligned_cols=12  Identities=25%  Similarity=0.974  Sum_probs=8.0

Q ss_pred             Cccccccccccc
Q psy2501          53 KGCCSSCDKPIV   64 (130)
Q Consensus        53 ~~~C~~C~~~i~   64 (130)
                      ..+|..|++++.
T Consensus        33 rS~C~~C~~~L~   44 (92)
T PF06750_consen   33 RSHCPHCGHPLS   44 (92)
T ss_pred             CCcCcCCCCcCc
Confidence            456777777763


No 115
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=22.78  E-value=36  Score=16.62  Aligned_cols=8  Identities=25%  Similarity=0.978  Sum_probs=4.2

Q ss_pred             cccccccc
Q psy2501          56 CSSCDKPI   63 (130)
Q Consensus        56 C~~C~~~i   63 (130)
                      |..|+...
T Consensus         5 Cp~C~~~y   12 (36)
T PF13717_consen    5 CPNCQAKY   12 (36)
T ss_pred             CCCCCCEE
Confidence            55555544


No 116
>PF11571 Med27:  Mediator complex subunit 27;  InterPro: IPR021627  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. The ubiquitous expression of Med27 mRNA suggests a universal requirement for Med27 in transcriptional initiation. Loss of Crsp34/Med27 decreases amacrine cell number, but increases the number of rod photoreceptor cells []. 
Probab=22.74  E-value=25  Score=21.04  Aligned_cols=18  Identities=39%  Similarity=0.857  Sum_probs=14.0

Q ss_pred             HhhhhhcCCCCccCcccc
Q psy2501         105 PDYHNLFSPRCSYCNGPI  122 (130)
Q Consensus       105 ~~~~~~~~~~C~~C~~~I  122 (130)
                      .-|..+|...|..|++-+
T Consensus        47 ~sY~~lfs~pC~~C~klL   64 (90)
T PF11571_consen   47 SSYRNLFSTPCKKCGKLL   64 (90)
T ss_pred             HHHhhhccchhhHHHhHh
Confidence            346677888999998876


No 117
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=22.73  E-value=68  Score=18.90  Aligned_cols=21  Identities=29%  Similarity=0.635  Sum_probs=7.5

Q ss_pred             cccCHHhhhh--hcC-CCCccCcc
Q psy2501         100 RPYCEPDYHN--LFS-PRCSYCNG  120 (130)
Q Consensus       100 ~~~C~~~~~~--~~~-~~C~~C~~  120 (130)
                      .+.|+.||..  +-+ ..|..|.-
T Consensus        36 fPvCr~CyEYErkeg~q~CpqCkt   59 (80)
T PF14569_consen   36 FPVCRPCYEYERKEGNQVCPQCKT   59 (80)
T ss_dssp             ----HHHHHHHHHTS-SB-TTT--
T ss_pred             CccchhHHHHHhhcCcccccccCC
Confidence            4457777752  222 25666653


No 118
>PF12898 Stc1:  Stc1 domain;  InterPro: IPR024630 The domain contains 8 conserved cysteines that may bind to zinc. In S. pombe, proteins containing the domain act as protein linkers, which link the chromatin modifying CLRC complex to RNAi by tethering it to the RITS complex. This domain has a slightly different arrangement of its CxxC pairs from the LIM domain, hence it is not part of that family []. The tandem zinc-finger structure could mediate protein-protein interactions.
Probab=22.72  E-value=1.7e+02  Score=17.20  Aligned_cols=55  Identities=16%  Similarity=0.276  Sum_probs=30.7

Q ss_pred             CCCCchhHHHHHHHHHHHHhhhcCCCCCCCccccccccccccceeeecCcccccCCcccCCCCcccCCCCe
Q psy2501          24 PVHQKGKQLDCMLDSLTAEMSRQGVTTTQKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNF   94 (130)
Q Consensus        24 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~   94 (130)
                      .+.|+..+++.....+...   ........-.|..|...-..+             +.|..|++.++-..|
T Consensus        11 ~~~FS~~Ql~~~~~~~~~~---~~~~~~~~i~C~~ct~~q~~E-------------l~C~~C~~~k~ld~F   65 (84)
T PF12898_consen   11 LSAFSKNQLEKLRKQIRAN---RVDPANSGIRCRECTGGQVVE-------------LTCSPCGKTKPLDEF   65 (84)
T ss_pred             hHHcCHHHHHHHHHHHhhc---cCccCCCCCCCccCCCCCcCc-------------CEeccCCCCcCHHHH
Confidence            3467888888877766555   111223334676665432111             277788877653334


No 119
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=22.72  E-value=37  Score=17.13  Aligned_cols=10  Identities=30%  Similarity=1.009  Sum_probs=5.0

Q ss_pred             cccCCCCccc
Q psy2501          80 FICTHCNQEL   89 (130)
Q Consensus        80 f~C~~C~~~l   89 (130)
                      +.|..|+.-|
T Consensus        20 ~vC~~CG~Vl   29 (43)
T PF08271_consen   20 LVCPNCGLVL   29 (43)
T ss_dssp             EEETTT-BBE
T ss_pred             EECCCCCCEe
Confidence            4556665554


No 120
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=22.61  E-value=29  Score=18.10  Aligned_cols=10  Identities=20%  Similarity=0.674  Sum_probs=5.9

Q ss_pred             cccccccccc
Q psy2501          54 GCCSSCDKPI   63 (130)
Q Consensus        54 ~~C~~C~~~i   63 (130)
                      -+|..|+...
T Consensus         6 y~C~~Cg~~f   15 (52)
T TIGR02605         6 YRCTACGHRF   15 (52)
T ss_pred             EEeCCCCCEe
Confidence            3566666644


No 121
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=22.36  E-value=77  Score=15.35  Aligned_cols=27  Identities=11%  Similarity=0.219  Sum_probs=11.8

Q ss_pred             cCCCCcccCCCCeeccCCcc-cCHHhhh
Q psy2501          82 CTHCNQELGTRNFFERDSRP-YCEPDYH  108 (130)
Q Consensus        82 C~~C~~~l~~~~~~~~~~~~-~C~~~~~  108 (130)
                      |..|+..-+..-....++.. +|..|+.
T Consensus         1 C~~C~tt~t~~WR~~~~g~~~LCn~Cg~   28 (36)
T PF00320_consen    1 CSNCGTTETPQWRRGPNGNRTLCNACGL   28 (36)
T ss_dssp             -TTT--ST-SSEEEETTSEE-EEHHHHH
T ss_pred             CcCCcCCCCchhhcCCCCCCHHHHHHHH
Confidence            34444443322222445555 8888865


No 122
>PF11331 DUF3133:  Protein of unknown function (DUF3133);  InterPro: IPR021480  This eukaryotic family of proteins has no known function. 
Probab=22.13  E-value=54  Score=17.20  Aligned_cols=11  Identities=27%  Similarity=0.685  Sum_probs=8.2

Q ss_pred             CCCccCccccc
Q psy2501         113 PRCSYCNGPIL  123 (130)
Q Consensus       113 ~~C~~C~~~I~  123 (130)
                      -+|++|++-|.
T Consensus        32 lrCGaCs~vl~   42 (46)
T PF11331_consen   32 LRCGACSEVLS   42 (46)
T ss_pred             EeCCCCceeEE
Confidence            36999988764


No 123
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=22.02  E-value=86  Score=20.46  Aligned_cols=36  Identities=22%  Similarity=0.447  Sum_probs=22.7

Q ss_pred             CCccccccccccc-cceeeecCcccccCCcccCCCCcccC
Q psy2501          52 QKGCCSSCDKPIV-GQVITALGKTWHPEHFICTHCNQELG   90 (130)
Q Consensus        52 ~~~~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~l~   90 (130)
                      ..-.|..|+..+. ...+...+.   ..=|.|..|+..|.
T Consensus        98 ~~Y~Cp~C~~~y~~~ea~~~~d~---~~~f~Cp~Cg~~l~  134 (147)
T smart00531       98 AYYKCPNCQSKYTFLEANQLLDM---DGTFTCPRCGEELE  134 (147)
T ss_pred             cEEECcCCCCEeeHHHHHHhcCC---CCcEECCCCCCEEE
Confidence            3457999998874 332222221   22399999999873


No 124
>PRK00085 recO DNA repair protein RecO; Reviewed
Probab=21.97  E-value=45  Score=23.49  Aligned_cols=32  Identities=16%  Similarity=0.232  Sum_probs=18.0

Q ss_pred             ccCCcccCCCCcccCCCCeeccCCcccCHHhh
Q psy2501          76 HPEHFICTHCNQELGTRNFFERDSRPYCEPDY  107 (130)
Q Consensus        76 H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~  107 (130)
                      -++-..|..|+..+....|...+|.++|..|.
T Consensus       146 ~p~l~~C~~Cg~~~~~~~f~~~~gg~~c~~c~  177 (247)
T PRK00085        146 GLDLDHCAVCGAPGDHRYFSPKEGGAVCSECG  177 (247)
T ss_pred             ccchhhHhcCCCCCCceEEecccCCccccccc
Confidence            33444666777665422333566666676663


No 125
>PRK12495 hypothetical protein; Provisional
Probab=21.58  E-value=40  Score=23.96  Aligned_cols=28  Identities=29%  Similarity=0.770  Sum_probs=18.6

Q ss_pred             CCccccccccccccceeeecCcccccCCcccCCCCccc
Q psy2501          52 QKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQEL   89 (130)
Q Consensus        52 ~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l   89 (130)
                      ....|..|+.+|.          -++.+-.|..|....
T Consensus        41 sa~hC~~CG~PIp----------a~pG~~~Cp~CQ~~~   68 (226)
T PRK12495         41 TNAHCDECGDPIF----------RHDGQEFCPTCQQPV   68 (226)
T ss_pred             chhhcccccCccc----------CCCCeeECCCCCCcc
Confidence            3457888998886          124556677777654


No 126
>PRK13796 GTPase YqeH; Provisional
Probab=21.28  E-value=63  Score=24.54  Aligned_cols=9  Identities=33%  Similarity=0.866  Sum_probs=5.6

Q ss_pred             ccccccccc
Q psy2501          55 CCSSCDKPI   63 (130)
Q Consensus        55 ~C~~C~~~i   63 (130)
                      +|.+||..+
T Consensus         2 ~C~GCG~~l   10 (365)
T PRK13796          2 RCIGCGAAI   10 (365)
T ss_pred             cccCCCcee
Confidence            466666655


No 127
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=21.12  E-value=36  Score=17.55  Aligned_cols=9  Identities=22%  Similarity=0.815  Sum_probs=5.0

Q ss_pred             ccccccccc
Q psy2501          55 CCSSCDKPI   63 (130)
Q Consensus        55 ~C~~C~~~i   63 (130)
                      +|+.|+..+
T Consensus         4 ~C~~Cg~~~   12 (44)
T smart00659        4 ICGECGREN   12 (44)
T ss_pred             ECCCCCCEe
Confidence            455665544


No 128
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=20.94  E-value=1.2e+02  Score=18.29  Aligned_cols=35  Identities=20%  Similarity=0.590  Sum_probs=23.3

Q ss_pred             CccccccccccccceeeecCcccccCCcccCCCCcccCCCCee
Q psy2501          53 KGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFF   95 (130)
Q Consensus        53 ~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~   95 (130)
                      ...|..|+....-   ......|     .|..|+..+.++.|.
T Consensus        35 ~~~Cp~C~~~~Vk---R~a~GIW-----~C~kCg~~fAGgay~   69 (89)
T COG1997          35 KHVCPFCGRTTVK---RIATGIW-----KCRKCGAKFAGGAYT   69 (89)
T ss_pred             CCcCCCCCCccee---eeccCeE-----EcCCCCCeecccccc
Confidence            3579999998421   2223334     788999998877664


No 129
>TIGR00270 conserved hypothetical protein TIGR00270.
Probab=20.88  E-value=90  Score=20.76  Aligned_cols=9  Identities=22%  Similarity=0.944  Sum_probs=4.1

Q ss_pred             cCCCCcccC
Q psy2501          82 CTHCNQELG   90 (130)
Q Consensus        82 C~~C~~~l~   90 (130)
                      |..|++.+.
T Consensus         3 CEiCG~~i~   11 (154)
T TIGR00270         3 CEICGRKIK   11 (154)
T ss_pred             cccCCCccC
Confidence            444444443


No 130
>KOG2186|consensus
Probab=20.67  E-value=23  Score=25.73  Aligned_cols=41  Identities=12%  Similarity=0.390  Sum_probs=24.9

Q ss_pred             cccccccccccceeeecCcccccCCcccCCCCcccCCCCee
Q psy2501          55 CCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFF   95 (130)
Q Consensus        55 ~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~   95 (130)
                      .|..|+..|--..+.----..|..+|.|-.|+..+.+..|.
T Consensus         5 tCnvCgEsvKKp~vekH~srCrn~~fSCIDC~k~F~~~sYk   45 (276)
T KOG2186|consen    5 TCNVCGESVKKPQVEKHMSRCRNAYFSCIDCGKTFERVSYK   45 (276)
T ss_pred             ehhhhhhhccccchHHHHHhccCCeeEEeecccccccchhh
Confidence            47778887731111111112466889999999998766554


No 131
>PF08746 zf-RING-like:  RING-like domain;  InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO). ; PDB: 3NW0_A 2CT0_A.
Probab=20.57  E-value=20  Score=18.37  Aligned_cols=8  Identities=25%  Similarity=1.103  Sum_probs=2.6

Q ss_pred             cccccccc
Q psy2501          56 CSSCDKPI   63 (130)
Q Consensus        56 C~~C~~~i   63 (130)
                      |..|++.+
T Consensus         1 C~~C~~iv    8 (43)
T PF08746_consen    1 CEACKEIV    8 (43)
T ss_dssp             -TTT-SB-
T ss_pred             CcccchhH
Confidence            34455555


No 132
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=20.50  E-value=46  Score=20.61  Aligned_cols=27  Identities=15%  Similarity=0.508  Sum_probs=19.5

Q ss_pred             cccCCCCcccCCCCeeccCCcccCHHhhhhh
Q psy2501          80 FICTHCNQELGTRNFFERDSRPYCEPDYHNL  110 (130)
Q Consensus        80 f~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~  110 (130)
                      =.|..|    ++..|+..++.+.|..|-.+.
T Consensus        36 daCeiC----~~~GY~q~g~~lvC~~C~~~~   62 (102)
T PF10080_consen   36 DACEIC----GPKGYYQEGDQLVCKNCGVRF   62 (102)
T ss_pred             Eecccc----CCCceEEECCEEEEecCCCEE
Confidence            356666    456788889999999886543


No 133
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=20.26  E-value=49  Score=23.82  Aligned_cols=15  Identities=13%  Similarity=0.488  Sum_probs=10.9

Q ss_pred             CCCcccccccccccc
Q psy2501          51 TQKGCCSSCDKPIVG   65 (130)
Q Consensus        51 ~~~~~C~~C~~~i~~   65 (130)
                      ..+.+|++|+-.|..
T Consensus       195 l~g~~C~GC~m~l~~  209 (239)
T COG1579         195 LEGRVCGGCHMKLPS  209 (239)
T ss_pred             ecCCcccCCeeeecH
Confidence            455789999888753


No 134
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=20.06  E-value=70  Score=19.62  Aligned_cols=35  Identities=23%  Similarity=0.228  Sum_probs=23.7

Q ss_pred             cccccccccc-ccceeeec-CcccccCCcccCCCCcc
Q psy2501          54 GCCSSCDKPI-VGQVITAL-GKTWHPEHFICTHCNQE   88 (130)
Q Consensus        54 ~~C~~C~~~i-~~~~~~~~-~~~~H~~Cf~C~~C~~~   88 (130)
                      .+|..|++.| .|+.+.+- ..+-|-+||.-+.-+++
T Consensus         7 wkC~VCg~~iieGqkFTF~~kGsVH~eCl~~s~~~k~   43 (103)
T COG4847           7 WKCYVCGGTIIEGQKFTFTKKGSVHYECLAESKRKKP   43 (103)
T ss_pred             eeEeeeCCEeeeccEEEEeeCCcchHHHHHHHHhcCc
Confidence            4688999988 47776643 34568888876654443


No 135
>KOG1829|consensus
Probab=20.04  E-value=42  Score=27.36  Aligned_cols=32  Identities=19%  Similarity=0.545  Sum_probs=20.7

Q ss_pred             CCcccCCCCcccCCC-----CeeccCCcccCHHhhhh
Q psy2501          78 EHFICTHCNQELGTR-----NFFERDSRPYCEPDYHN  109 (130)
Q Consensus        78 ~Cf~C~~C~~~l~~~-----~~~~~~~~~~C~~~~~~  109 (130)
                      .-|+|+.|+..+...     ++-...|+.||..|...
T Consensus       339 Q~~~CAgC~~~i~~~~~~~~R~C~y~G~y~C~~Ch~~  375 (580)
T KOG1829|consen  339 QNFRCAGCGHTIGPDLEQRPRLCRYLGKYFCDCCHQN  375 (580)
T ss_pred             cCceecccCCCcccccccchhHhhhhhhhhCchhccc
Confidence            457899999998632     12244567777777653


Done!