Query         psy2512
Match_columns 115
No_of_seqs    107 out of 403
Neff          4.1 
Searched_HMMs 46136
Date          Fri Aug 16 18:05:43 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2512.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2512hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF12999 PRKCSH-like:  Glucosid 100.0 9.6E-37 2.1E-41  234.9   5.4   82   20-101    15-99  (176)
  2 KOG2397|consensus               99.9 1.3E-25 2.9E-30  193.3   5.8   93    9-101    11-105 (480)
  3 PF12999 PRKCSH-like:  Glucosid  99.1 2.2E-11 4.8E-16   94.4   2.5   44   38-85     74-123 (176)
  4 KOG2397|consensus               98.7 4.4E-09 9.6E-14   91.6   1.9   48   37-87     79-130 (480)
  5 cd00112 LDLa Low Density Lipop  98.6 2.9E-08 6.4E-13   58.1   2.4   32   38-70      3-34  (35)
  6 PF00057 Ldl_recept_a:  Low-den  98.6   5E-08 1.1E-12   58.0   3.3   32   38-70      5-36  (37)
  7 smart00192 LDLa Low-density li  98.4 1.5E-07 3.2E-12   54.3   2.6   29   39-68      5-33  (33)
  8 PF00057 Ldl_recept_a:  Low-den  95.2   0.015 3.3E-07   34.3   2.1   26   73-102     2-27  (37)
  9 cd00112 LDLa Low Density Lipop  95.2   0.011 2.3E-07   34.4   1.2   25   74-102     1-25  (35)
 10 smart00192 LDLa Low-density li  93.8   0.036 7.7E-07   31.6   1.4   25   74-102     2-26  (33)
 11 KOG1215|consensus               93.6   0.099 2.1E-06   47.5   4.4   73   26-102   204-284 (877)
 12 KOG1215|consensus               89.7     0.2 4.3E-06   45.6   1.9   34   38-71    140-174 (877)
 13 PF10905 DUF2695:  Protein of u  48.7     7.1 0.00015   25.1   0.4   14   50-63     36-49  (53)
 14 PF07172 GRP:  Glycine rich pro  48.0      13 0.00027   26.2   1.6   13    4-16      6-18  (95)
 15 smart00004 NL Domain found in   21.6      52  0.0011   19.7   1.0    9   53-61     15-23  (38)
 16 PF15240 Pro-rich:  Proline-ric  20.5      68  0.0015   25.4   1.7   16    1-16      1-16  (179)
 17 COG5567 Predicted small peripl  20.4      87  0.0019   20.7   1.9   28    2-32      6-33  (58)

No 1  
>PF12999 PRKCSH-like:  Glucosidase II beta subunit-like
Probab=100.00  E-value=9.6e-37  Score=234.93  Aligned_cols=82  Identities=48%  Similarity=0.759  Sum_probs=77.5

Q ss_pred             ccCCCccCCcccccccCC--CCcEEeCCCCce-eccCcccCCcCCCCCCCCCCCCCCCCCCceecccCCceeeeeeccce
Q psy2512          20 DVLRPRGVSLMRASLYQP--ASEFTCFDGSLT-IPFSYVNDDYCDCQDSSDEPGTSACPNGTFHSHLLTRRFLIQISAKT   96 (115)
Q Consensus        20 ~~~~~rGv~p~~~~~Y~~--~g~F~C~~gs~~-I~~s~vNDg~CDC~DGSDEpgt~aC~~~~FyC~n~g~~p~~Ipssrv   96 (115)
                      .+.++|||+|+++++|++  ++.|+|++++.. |++++||||||||+||||||||+||++++|||+|+||+|++||+++|
T Consensus        15 ~~~~~~GV~p~~~~~Y~~~~~~~f~Cl~~~~~~I~~~~iNDdyCDC~DGSDEPGTsAC~~~~FyC~N~g~~p~~i~~s~V   94 (176)
T PF12999_consen   15 ASSRIRGVSPSDQHLYEPSENGKFTCLDGSKIVIPFSQINDDYCDCPDGSDEPGTSACSNGKFYCENKGHIPRYIPSSRV   94 (176)
T ss_pred             ccCCCCCCCHHHHHHcCCCCCCceEecCCCCceecHHHccCcceeCCCCCCccccccCcCceEeeccCCCCCceeehhhh
Confidence            478999999999999997  579999998655 99999999999999999999999999999999999999999999999


Q ss_pred             ecCCC
Q psy2512          97 WNSSS  101 (115)
Q Consensus        97 ~DG~~  101 (115)
                      .||+=
T Consensus        95 nDGIC   99 (176)
T PF12999_consen   95 NDGIC   99 (176)
T ss_pred             cCCcC
Confidence            99984


No 2  
>KOG2397|consensus
Probab=99.92  E-value=1.3e-25  Score=193.30  Aligned_cols=93  Identities=40%  Similarity=0.615  Sum_probs=80.0

Q ss_pred             HHHHHHhhhccccCCCccCC--cccccccCCCCcEEeCCCCceeccCcccCCcCCCCCCCCCCCCCCCCCCceecccCCc
Q psy2512           9 VLFSSIWLTSSDVLRPRGVS--LMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTSACPNGTFHSHLLTR   86 (115)
Q Consensus         9 ~l~~~~~~~~~~~~~~rGv~--p~~~~~Y~~~g~F~C~~gs~~I~~s~vNDg~CDC~DGSDEpgt~aC~~~~FyC~n~g~   86 (115)
                      +|+++...++....+.+||+  ..++++|+++..|+|++++..|+++++||+||||.||||||||+||+|+.|||.|.||
T Consensus        11 ~ll~sp~~aa~~~~~~~~v~~~~~~~~~y~as~~~~CLdgs~~i~f~qlNDd~CDC~DGsDEPGtsACpngkF~C~N~G~   90 (480)
T KOG2397|consen   11 ALLASPLGAAKQLRKDWGVALSIENLYLYDASSMFKCLDGSKTISFSQLNDDSCDCLDGSDEPGTSACPNGKFYCVNQGH   90 (480)
T ss_pred             HhhhcchhhhhccccccccccccccccccccccceeeccCCcccCHHHhccccccCCCCCCCCccccCCCCceeeeecCC
Confidence            33444444445566666654  5588888889999999999999999999999999999999999999999999999999


Q ss_pred             eeeeeeccceecCCC
Q psy2512          87 RFLIQISAKTWNSSS  101 (115)
Q Consensus        87 ~p~~Ipssrv~DG~~  101 (115)
                      +|.+|++++|-||+=
T Consensus        91 ~p~~i~ssrV~DGIC  105 (480)
T KOG2397|consen   91 QPKYIPSSRVNDGIC  105 (480)
T ss_pred             CceeeechhccCccc
Confidence            999999999999973


No 3  
>PF12999 PRKCSH-like:  Glucosidase II beta subunit-like
Probab=99.13  E-value=2.2e-11  Score=94.38  Aligned_cols=44  Identities=45%  Similarity=0.771  Sum_probs=37.9

Q ss_pred             CCcEEeCC-C--CceeccCcccCCcCC---CCCCCCCCCCCCCCCCceecccCC
Q psy2512          38 ASEFTCFD-G--SLTIPFSYVNDDYCD---CQDSSDEPGTSACPNGTFHSHLLT   85 (115)
Q Consensus        38 ~g~F~C~~-g--s~~I~~s~vNDg~CD---C~DGSDEpgt~aC~~~~FyC~n~g   85 (115)
                      +++|||.| |  +..||.++||||+||   |+||||| +...|+|   .|.+.+
T Consensus        74 ~~~FyC~N~g~~p~~i~~s~VnDGICDy~~CCDGSDE-~~~~C~N---~C~e~~  123 (176)
T PF12999_consen   74 NGKFYCENKGHIPRYIPSSRVNDGICDYDICCDGSDE-SGGKCPN---TCAELG  123 (176)
T ss_pred             CceEeeccCCCCCceeehhhhcCCcCcccccCCCCCC-CCCCCcc---HHHHHH
Confidence            47999999 5  578999999999999   9999999 4457999   887654


No 4  
>KOG2397|consensus
Probab=98.72  E-value=4.4e-09  Score=91.63  Aligned_cols=48  Identities=46%  Similarity=0.761  Sum_probs=41.0

Q ss_pred             CCCcEEeCC-C--CceeccCcccCCcCCCCCCCCCCCC-CCCCCCceecccCCce
Q psy2512          37 PASEFTCFD-G--SLTIPFSYVNDDYCDCQDSSDEPGT-SACPNGTFHSHLLTRR   87 (115)
Q Consensus        37 ~~g~F~C~~-g--s~~I~~s~vNDg~CDC~DGSDEpgt-~aC~~~~FyC~n~g~~   87 (115)
                      ++|+|||.| |  +..|+.++||||+|||+|||||..+ -.|+|   .|...|..
T Consensus        79 pngkF~C~N~G~~p~~i~ssrV~DGICDCCDgSDE~~Sgv~c~n---tC~e~gR~  130 (480)
T KOG2397|consen   79 PNGKFYCVNQGHQPKYIPSSRVNDGICDCCDGSDEYLSGVDCPN---TCIELGRA  130 (480)
T ss_pred             CCCceeeeecCCCceeeechhccCcccccccCCCCccCCCCCcc---hHHHHHHH
Confidence            379999999 5  6799999999999999999999877 48988   78766543


No 5  
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure
Probab=98.60  E-value=2.9e-08  Score=58.07  Aligned_cols=32  Identities=47%  Similarity=0.762  Sum_probs=28.7

Q ss_pred             CCcEEeCCCCceeccCcccCCcCCCCCCCCCCC
Q psy2512          38 ASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPG   70 (115)
Q Consensus        38 ~g~F~C~~gs~~I~~s~vNDg~CDC~DGSDEpg   70 (115)
                      .+.|+|.++ .+||.+++||++-||+|||||..
T Consensus         3 ~~~f~C~~~-~Ci~~~~~CDg~~DC~dgsDE~~   34 (35)
T cd00112           3 PNEFRCANG-RCIPSSWVCDGEDDCGDGSDEEN   34 (35)
T ss_pred             CCeEEcCCC-CeeCHHHcCCCccCCCCCccccc
Confidence            468999984 59999999999999999999963


No 6  
>PF00057 Ldl_recept_a:  Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor;  InterPro: IPR002172  The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells. The LDL receptor binds LDL and transports it into cells by acidic endocytosis. In order to be internalized, the receptor-ligand complex must first cluster into clathrin-coated pits. Once inside the cell, the LDLR separates from its ligand, which is degraded in the lysosomes, while the receptor returns to the cell surface []. The internal dissociation of the LDLR with its ligand is mediated by proton pumps within the walls of the endosome that lower the pH. The LDLR is a multi-domain protein, containing:    The ligand-binding domain contains seven or eight 40-amino acid LDLR class A (cysteine-rich) repeats, each of which contains a coordinated calcium ion and six cysteine residues involved in disulphide bond formation []. Similar domains have been found in other extracellular and membrane proteins [].      The second conserved region contains two EGF repeats, followed by six LDLR class B (YWTD) repeats, and another EGF repeat. The LDLR class B repeats each contain a conserved YWTD motif, and is predicted to form a beta-propeller structure []. This region is critical for ligand release and recycling of the receptor [].     The third domain is rich in serine and threonine residues and contains clustered O-linked carbohydrate chains.     The fourth domain is the hydrophobic transmembrane region.     The fifth domain is the cytoplasmic tail that directs the receptor to clathrin-coated pits.   LDLR is closely related in structure to several other receptors, including LRP1, LRP1b, megalin/LRP2, VLDL receptor, lipoprotein receptor, MEGF7/LRP4, and LRP8/apolipoprotein E receptor2); these proteins participate in a wide range of physiological processes, including the regulation of lipid metabolism, protection against atherosclerosis, neurodevelopment, and transport of nutrients and vitamins []. This entry represents the LDLR class A (cyateine-rich) repeat, which contains 6 disulphide-bound cysteines and a highly conserved cluster of negatively charged amino acids, of which many are clustered on one face of the module []. In LDL receptors, the class A domains form the binding site for LDL and calcium. The acidic residues between the fourth and sixth cysteines are important for high-affinity binding of positively charged sequences in LDLR's ligands. The repeat consists of a beta-hairpin structure followed by a series of beta turns. In the absence of calcium, LDL-A domains are unstructured; the bound calcium ion imparts structural integrity. Following these repeats is a 350 residue domain that resembles part of the epidermal growth factor (EGF) precursor. Numerous familial hypercholestorolemia mutations of the LDL receptor alter the calcium coordinating residue of LDL-A domains or other crucial scaffolding residues. ; GO: 0005515 protein binding; PDB: 2I1P_A 3OJY_A 4E0S_B 3T5O_A 4A5W_B 1JRF_A 1K7B_A 1V9U_5 3DPR_E 2KNY_A ....
Probab=98.59  E-value=5e-08  Score=58.04  Aligned_cols=32  Identities=47%  Similarity=0.780  Sum_probs=29.5

Q ss_pred             CCcEEeCCCCceeccCcccCCcCCCCCCCCCCC
Q psy2512          38 ASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPG   70 (115)
Q Consensus        38 ~g~F~C~~gs~~I~~s~vNDg~CDC~DGSDEpg   70 (115)
                      .+.|+|.++. +|+..++||++-||.|||||.+
T Consensus         5 ~~~f~C~~~~-CI~~~~~CDg~~DC~dgsDE~~   36 (37)
T PF00057_consen    5 PGEFRCGNGQ-CIPKSWVCDGIPDCPDGSDEQN   36 (37)
T ss_dssp             TTEEEETTSS-EEEGGGTTSSSCSSSSSTTTSS
T ss_pred             CCeeEcCCCC-EEChHHcCCCCCCCCCCccccc
Confidence            5789999987 9999999999999999999953


No 7  
>smart00192 LDLa Low-density lipoprotein receptor domain class A. Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that  plays a central role in mammalian cholesterol metabolism. The N-terminal  type A repeats in LDL receptor bind the lipoproteins. Other homologous  domains occur in related receptors, including the very low-density  lipoprotein receptor and the LDL receptor-related protein/alpha  2-macroglobulin receptor, and in proteins which are functionally  unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.
Probab=98.44  E-value=1.5e-07  Score=54.25  Aligned_cols=29  Identities=52%  Similarity=0.920  Sum_probs=26.9

Q ss_pred             CcEEeCCCCceeccCcccCCcCCCCCCCCC
Q psy2512          39 SEFTCFDGSLTIPFSYVNDDYCDCQDSSDE   68 (115)
Q Consensus        39 g~F~C~~gs~~I~~s~vNDg~CDC~DGSDE   68 (115)
                      ++|+|.++. +||..++||++-||.|||||
T Consensus         5 ~~f~C~~~~-Ci~~~~~Cdg~~dC~dgsDE   33 (33)
T smart00192        5 GEFQCDNGR-CIPLSWVCDGVDDCSDGSDE   33 (33)
T ss_pred             CeEECCCCC-EECchhhCCCcCcCcCCCCC
Confidence            489998766 99999999999999999999


No 8  
>PF00057 Ldl_recept_a:  Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor;  InterPro: IPR002172  The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells. The LDL receptor binds LDL and transports it into cells by acidic endocytosis. In order to be internalized, the receptor-ligand complex must first cluster into clathrin-coated pits. Once inside the cell, the LDLR separates from its ligand, which is degraded in the lysosomes, while the receptor returns to the cell surface []. The internal dissociation of the LDLR with its ligand is mediated by proton pumps within the walls of the endosome that lower the pH. The LDLR is a multi-domain protein, containing:    The ligand-binding domain contains seven or eight 40-amino acid LDLR class A (cysteine-rich) repeats, each of which contains a coordinated calcium ion and six cysteine residues involved in disulphide bond formation []. Similar domains have been found in other extracellular and membrane proteins [].      The second conserved region contains two EGF repeats, followed by six LDLR class B (YWTD) repeats, and another EGF repeat. The LDLR class B repeats each contain a conserved YWTD motif, and is predicted to form a beta-propeller structure []. This region is critical for ligand release and recycling of the receptor [].     The third domain is rich in serine and threonine residues and contains clustered O-linked carbohydrate chains.     The fourth domain is the hydrophobic transmembrane region.     The fifth domain is the cytoplasmic tail that directs the receptor to clathrin-coated pits.   LDLR is closely related in structure to several other receptors, including LRP1, LRP1b, megalin/LRP2, VLDL receptor, lipoprotein receptor, MEGF7/LRP4, and LRP8/apolipoprotein E receptor2); these proteins participate in a wide range of physiological processes, including the regulation of lipid metabolism, protection against atherosclerosis, neurodevelopment, and transport of nutrients and vitamins []. This entry represents the LDLR class A (cyateine-rich) repeat, which contains 6 disulphide-bound cysteines and a highly conserved cluster of negatively charged amino acids, of which many are clustered on one face of the module []. In LDL receptors, the class A domains form the binding site for LDL and calcium. The acidic residues between the fourth and sixth cysteines are important for high-affinity binding of positively charged sequences in LDLR's ligands. The repeat consists of a beta-hairpin structure followed by a series of beta turns. In the absence of calcium, LDL-A domains are unstructured; the bound calcium ion imparts structural integrity. Following these repeats is a 350 residue domain that resembles part of the epidermal growth factor (EGF) precursor. Numerous familial hypercholestorolemia mutations of the LDL receptor alter the calcium coordinating residue of LDL-A domains or other crucial scaffolding residues. ; GO: 0005515 protein binding; PDB: 2I1P_A 3OJY_A 4E0S_B 3T5O_A 4A5W_B 1JRF_A 1K7B_A 1V9U_5 3DPR_E 2KNY_A ....
Probab=95.21  E-value=0.015  Score=34.30  Aligned_cols=26  Identities=15%  Similarity=0.204  Sum_probs=23.1

Q ss_pred             CCCCCceecccCCceeeeeeccceecCCCC
Q psy2512          73 ACPNGTFHSHLLTRRFLIQISAKTWNSSSQ  102 (115)
Q Consensus        73 aC~~~~FyC~n~g~~p~~Ipssrv~DG~~~  102 (115)
                      .|+.+.|.|.++    .+|+..+++||+..
T Consensus         2 ~C~~~~f~C~~~----~CI~~~~~CDg~~D   27 (37)
T PF00057_consen    2 TCPPGEFRCGNG----QCIPKSWVCDGIPD   27 (37)
T ss_dssp             SSSTTEEEETTS----SEEEGGGTTSSSCS
T ss_pred             cCcCCeeEcCCC----CEEChHHcCCCCCC
Confidence            588999999988    49999999999864


No 9  
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure
Probab=95.17  E-value=0.011  Score=34.37  Aligned_cols=25  Identities=16%  Similarity=0.178  Sum_probs=21.7

Q ss_pred             CCCCceecccCCceeeeeeccceecCCCC
Q psy2512          74 CPNGTFHSHLLTRRFLIQISAKTWNSSSQ  102 (115)
Q Consensus        74 C~~~~FyC~n~g~~p~~Ipssrv~DG~~~  102 (115)
                      |+..+|.|.++    .+|+.++++||+..
T Consensus         1 C~~~~f~C~~~----~Ci~~~~~CDg~~D   25 (35)
T cd00112           1 CPPNEFRCANG----RCIPSSWVCDGEDD   25 (35)
T ss_pred             CCCCeEEcCCC----CeeCHHHcCCCccC
Confidence            66789999985    89999999999864


No 10 
>smart00192 LDLa Low-density lipoprotein receptor domain class A. Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that  plays a central role in mammalian cholesterol metabolism. The N-terminal  type A repeats in LDL receptor bind the lipoproteins. Other homologous  domains occur in related receptors, including the very low-density  lipoprotein receptor and the LDL receptor-related protein/alpha  2-macroglobulin receptor, and in proteins which are functionally  unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.
Probab=93.83  E-value=0.036  Score=31.60  Aligned_cols=25  Identities=16%  Similarity=0.211  Sum_probs=20.9

Q ss_pred             CCCCceecccCCceeeeeeccceecCCCC
Q psy2512          74 CPNGTFHSHLLTRRFLIQISAKTWNSSSQ  102 (115)
Q Consensus        74 C~~~~FyC~n~g~~p~~Ipssrv~DG~~~  102 (115)
                      |+...|.|.++    .+||..+++||+..
T Consensus         2 C~~~~f~C~~~----~Ci~~~~~Cdg~~d   26 (33)
T smart00192        2 CPPGEFQCDNG----RCIPLSWVCDGVDD   26 (33)
T ss_pred             CCCCeEECCCC----CEECchhhCCCcCc
Confidence            66679999966    69999999999853


No 11 
>KOG1215|consensus
Probab=93.56  E-value=0.099  Score=47.53  Aligned_cols=73  Identities=19%  Similarity=0.155  Sum_probs=54.9

Q ss_pred             cCCcccccccCCC----CcEEeCCCCceeccCcccCCcCCCCCCCCCC--CC--CCCCCCceecccCCceeeeeecccee
Q psy2512          26 GVSLMRASLYQPA----SEFTCFDGSLTIPFSYVNDDYCDCQDSSDEP--GT--SACPNGTFHSHLLTRRFLIQISAKTW   97 (115)
Q Consensus        26 Gv~p~~~~~Y~~~----g~F~C~~gs~~I~~s~vNDg~CDC~DGSDEp--gt--~aC~~~~FyC~n~g~~p~~Ipssrv~   97 (115)
                      |..+.....|...    ..+.|..+..+|..++.+|+.-||.|++||-  ..  .+|....|.|.+.    .+++..+.+
T Consensus       204 ~~d~~~~~~~~~~~~~~~~~~c~g~~~~i~~~~~~Dg~~dc~~~~de~~~~~~~~~~~~~e~~~~~~----~~~~~~~~~  279 (877)
T KOG1215|consen  204 DYDESEGRIYWTDDSRIEVTRCDGSSRCILISEVCDGPRDCVDGPDEGVMNCSDATCEAPEIECADG----DCSDRQKLC  279 (877)
T ss_pred             ccccccCcccccCCcceeEEEecCCCcEEeehhccCCCcccccCCcCceeEeeccccCCcceeecCC----CCccceEEe
Confidence            4455555555442    5788988778999999999999999999994  11  4677778999776    577777778


Q ss_pred             cCCCC
Q psy2512          98 NSSSQ  102 (115)
Q Consensus        98 DG~~~  102 (115)
                      ||...
T Consensus       280 ~g~~d  284 (877)
T KOG1215|consen  280 DGDLD  284 (877)
T ss_pred             cCccC
Confidence            88764


No 12 
>KOG1215|consensus
Probab=89.73  E-value=0.2  Score=45.60  Aligned_cols=34  Identities=35%  Similarity=0.630  Sum_probs=28.8

Q ss_pred             CCcEEeCCC-CceeccCcccCCcCCCCCCCCCCCC
Q psy2512          38 ASEFTCFDG-SLTIPFSYVNDDYCDCQDSSDEPGT   71 (115)
Q Consensus        38 ~g~F~C~~g-s~~I~~s~vNDg~CDC~DGSDEpgt   71 (115)
                      ...|.|..+ .++||..+.||+-.||.||+||...
T Consensus       140 ~~~~~c~~~~~~Cip~~~~cd~~~~C~dg~de~~~  174 (877)
T KOG1215|consen  140 LDKFSCRTGSCKCIPGDWLCDGEADCPDGSDELNC  174 (877)
T ss_pred             CCCCCCcCccccCCCCceeCCCCCccccchhhhcc
Confidence            357888853 5699999999999999999999764


No 13 
>PF10905 DUF2695:  Protein of unknown function (DUF2695);  InterPro: IPR024248 This bacterial family of proteins has no known function.
Probab=48.73  E-value=7.1  Score=25.15  Aligned_cols=14  Identities=36%  Similarity=0.982  Sum_probs=10.4

Q ss_pred             eccCcccCCcCCCC
Q psy2512          50 IPFSYVNDDYCDCQ   63 (115)
Q Consensus        50 I~~s~vNDg~CDC~   63 (115)
                      |+.=+-|.|||||+
T Consensus        36 l~~l~~nGg~CDCE   49 (53)
T PF10905_consen   36 LEWLRENGGYCDCE   49 (53)
T ss_pred             HHHHHHcCCCccee
Confidence            34446789999996


No 14 
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=47.96  E-value=13  Score=26.21  Aligned_cols=13  Identities=38%  Similarity=0.876  Sum_probs=6.4

Q ss_pred             hHHHHHHHHHHhh
Q psy2512           4 FVTLGVLFSSIWL   16 (115)
Q Consensus         4 ~~~~~~l~~~~~~   16 (115)
                      ||||.+||++.+.
T Consensus         6 ~llL~l~LA~lLl   18 (95)
T PF07172_consen    6 FLLLGLLLAALLL   18 (95)
T ss_pred             HHHHHHHHHHHHH
Confidence            5555555444433


No 15 
>smart00004 NL Domain found in Notch and Lin-12. The Notch protein is essential for the proper differentiation of the Drosophila ectoderm. This protein contains 3 NL domains.
Probab=21.58  E-value=52  Score=19.74  Aligned_cols=9  Identities=33%  Similarity=0.697  Sum_probs=6.5

Q ss_pred             CcccCCcCC
Q psy2512          53 SYVNDDYCD   61 (115)
Q Consensus        53 s~vNDg~CD   61 (115)
                      ++..|++||
T Consensus        15 ~~~~dg~CD   23 (38)
T smart00004       15 DKFGDGVCD   23 (38)
T ss_pred             hhhCCCccc
Confidence            467788887


No 16 
>PF15240 Pro-rich:  Proline-rich
Probab=20.50  E-value=68  Score=25.37  Aligned_cols=16  Identities=13%  Similarity=-0.168  Sum_probs=8.4

Q ss_pred             CchhHHHHHHHHHHhh
Q psy2512           1 MSGFVTLGVLFSSIWL   16 (115)
Q Consensus         1 ~~~~~~~~~l~~~~~~   16 (115)
                      |.-+||..+|||.+++
T Consensus         1 MLlVLLSvALLALSSA   16 (179)
T PF15240_consen    1 MLLVLLSVALLALSSA   16 (179)
T ss_pred             ChhHHHHHHHHHhhhc
Confidence            4444444456665555


No 17 
>COG5567 Predicted small periplasmic lipoprotein [Cell motility and secretion]
Probab=20.38  E-value=87  Score=20.74  Aligned_cols=28  Identities=18%  Similarity=0.135  Sum_probs=18.0

Q ss_pred             chhHHHHHHHHHHhhhccccCCCccCCcccc
Q psy2512           2 SGFVTLGVLFSSIWLTSSDVLRPRGVSLMRA   32 (115)
Q Consensus         2 ~~~~~~~~l~~~~~~~~~~~~~~rGv~p~~~   32 (115)
                      ++++++.+|++.+.+   -.+.+-.++|++.
T Consensus         6 ~s~~ala~l~sLA~C---G~KGPLy~Ppadk   33 (58)
T COG5567           6 KSLLALATLFSLAGC---GLKGPLYFPPADK   33 (58)
T ss_pred             HHHHHHHHHHHHHhc---ccCCCccCChhhc
Confidence            456677777755544   3677777777665


Done!