BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy2527
         (83 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1JQ3|A Chain A, Crystal Structure Of Spermidine Synthase In Complex With
           Transition State Analogue Adodato
 pdb|1JQ3|B Chain B, Crystal Structure Of Spermidine Synthase In Complex With
           Transition State Analogue Adodato
 pdb|1JQ3|C Chain C, Crystal Structure Of Spermidine Synthase In Complex With
           Transition State Analogue Adodato
 pdb|1JQ3|D Chain D, Crystal Structure Of Spermidine Synthase In Complex With
           Transition State Analogue Adodato
 pdb|1INL|A Chain A, Crystal Structure Of Spermidine Synthase From Thermotoga
           Maritima
 pdb|1INL|B Chain B, Crystal Structure Of Spermidine Synthase From Thermotoga
           Maritima
 pdb|1INL|C Chain C, Crystal Structure Of Spermidine Synthase From Thermotoga
           Maritima
 pdb|1INL|D Chain D, Crystal Structure Of Spermidine Synthase From Thermotoga
           Maritima
          Length = 296

 Score = 27.3 bits (59), Expect = 2.1,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 24/48 (50%)

Query: 8   PQKYLIVGSNNAHTKFRVLKIDRTEPRDLILVDDKVVYTADEIKQSTA 55
           P+K LI+G  +  T   VLK D  E   L  VD  V+  A +  + T+
Sbjct: 91  PKKVLIIGGGDGGTLREVLKHDSVEKAILCEVDGLVIEAARKYLKQTS 138


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.136    0.397 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,184,641
Number of Sequences: 62578
Number of extensions: 67644
Number of successful extensions: 173
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 172
Number of HSP's gapped (non-prelim): 1
length of query: 83
length of database: 14,973,337
effective HSP length: 51
effective length of query: 32
effective length of database: 11,781,859
effective search space: 377019488
effective search space used: 377019488
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 45 (21.9 bits)