Diaphorina citri psyllid: psy2527


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80---
MDISCFPPQKYLIVGSNNAHTKFRVLKIDRTEPRDLILVDDKVVYTADEIKQSTAAVLLPNLFWAFKIATSVHDKVSLKLMME
cccccccccEEEEEECcccccEEEEEEEEccccccCEEECccccccHHHHHHHHHHcccccHHHHHHHHHHccccEEEccccc
***SCFPPQKYLIVGSNNAHTKFRVLKIDRTEPRDLILVDDKVVYTADEIKQSTAAVLLPNLFWAFKIATSVHDKVSLKLMME
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDISCFPPQKYLIVGSNNAHTKFRVLKIDRTEPRDLILVDDKVVYTADEIKQSTAAVLLPNLFWAFKIATSVHDKVSLKLMME

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polyphosphoinositide phosphatase The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). In vitro, hydrolyzes all three D5-phosphorylated polyphosphoinositide substrates in the order PtdIns(4,5)P2 > PtdIns(3,5)P2 > PtdIns(3,4,5)P3. Plays a role in the biogenesis of endosome carrier vesicles (ECV) / multivesicular bodies (MVB) transport intermediates from early endosomes.confidentQ91WF7
Polyphosphoinositide phosphatase The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). In vitro, hydrolyzes all three D5-phosphorylated polyphosphoinositide substrates in the order PtdIns(4,5)P2 > PtdIns(3,5)P2 > PtdIns(3,4,5)P3. Plays a role in the biogenesis of endosome carrier vesicles (ECV) / multivesicular bodies (MVB) transport intermediates from early endosomes.confidentQ92562

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043812 [MF]phosphatidylinositol-4-phosphate phosphatase activityprobableGO:0052866, GO:0016791, GO:0016788, GO:0016787, GO:0052744, GO:0042578, GO:0003824, GO:0003674, GO:0034596
GO:0043813 [MF]phosphatidylinositol-3,5-bisphosphate 5-phosphatase activityprobableGO:0052866, GO:0016791, GO:0016787, GO:0042578, GO:0034593, GO:0003824, GO:0003674, GO:0016788, GO:0034595
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046488 [BP]phosphatidylinositol metabolic processprobableGO:0044238, GO:0006644, GO:0006650, GO:0009987, GO:0044710, GO:0044237, GO:0071704, GO:0006796, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0046486, GO:0044255, GO:0006629
GO:0004438 [MF]phosphatidylinositol-3-phosphatase activityprobableGO:0052866, GO:0016791, GO:0016787, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0052744
GO:0010008 [CC]endosome membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005768, GO:0043226, GO:0044422, GO:0043231
GO:0055037 [CC]recycling endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted