Diaphorina citri psyllid: psy2532


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410
MPSFLSDHDDHNGEADDVSTSSVLGVLMSAMALLRGCRLNVLGVLMSAMALLRGCRLNAALTIQLFSKLFHFLNVWAFNRLVANNSIYCSKAWGVRIKNRLAHIQMWAERQGLELAADCHLAKLMQAAHLLQAPKYTGDELAELTSTCFKLNSLQLRALLLKYQPTPDEPRLPHEVIENVVRVAENLADELARSDGRDVCLEEESELLLPFLLPDDGYSCEVVRGVPQGLIEFISPLQAAGLCRLSAQPTSNGYWTVYMGPHNSQGPVIRSPSAMSNRSAGYIANREEPDIQVIKLHKSSTYERYTRGTDPILPAVLEIREETEEAFLHALITDLEPSAPSFKLAPAYTLYLAARYRASTHYRPELIPTERAHRLTLVLVRVAAMIHNVIEMLLMSIVFCFRIVTVMFSP
cccccccccccccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHccHHHcccccccccccccccccEEEccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccEEcccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
**********************VLGVLMSAMALLRGCRLNVLGVLMSAMALLRGCRLNAALTIQLFSKLFHFLNVWAFNRLVANNSIYCSKAWGVRIKNRLAHIQMWAERQGLELAADCHLAKLMQAAHLLQAPKYTGDELAELTSTCFKLNSLQLRALLLKYQPTPDEPRLPHEVIENVVRVAENLADELARSDGRDVCLEEESELLLPFLLPDDGYSCEVVRGVPQGLIEFISPLQAAGLCRLSAQPTSNGYWTVYMG******************************IQVIKLHKSSTYERYTRGTDPILPAVLEIREETEEAFLHALITDLEPSAPSFKLAPAYTLYLAARYRASTHYRPELIPTERAHRLTLVLVRVAAMIHNVIEMLLMSIVFCFRIVTVMFS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSFLSDHDDHNGEADDVSTSSVLGVLMSAMALLRGCRLNVLGVLMSAMALLRGCRLNAALTIQLFSKLFHFLNVWAFNRLVANNSIYCSKAWGVRIKNRLAHIQMWAERQGLELAADCHLAKLMQAAHLLQAPKYTGDELAELTSTCFKLNSLQLRALLLKYQPTPDEPRLPHEVIENVVRVAENLADELARSDGRDVCLEEESELLLPFLLPDDGYSCEVVRGVPQGLIEFISPLQAAGLCRLSAQPTSNGYWTVYMGPHNSQGPVIRSPSAMSNRSAGYIANREEPDIQVIKLHKSSTYERYTRGTDPILPAVLEIREETEEAFLHALITDLEPSAPSFKLAPAYTLYLAARYRASTHYRPELIPTERAHRLTLVLVRVAAMIHNVIEMLLMSIVFCFRIVTVMFSP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Afadin Belongs to an adhesion system, probably together with the E-cadherin-catenin system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). Nectin- and actin-filament-binding protein that connects nectin to the actin cytoskeleton. May play a key role in the organization of epithelial structures of the embryonic ectoderm.confidentO35889
Afadin Belongs to an adhesion system, probably together with the E-cadherin-catenin system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). Nectin- and actin-filament-binding protein that connects nectin to the actin cytoskeleton. May play a key role in the organization of epithelial structures of the embryonic ectoderm.confidentQ9QZQ1
Afadin Belongs to an adhesion system, probably together with the E-cadherin-catenin system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). Nectin- and actin-filament-binding protein that connects nectin to the actin cytoskeleton.confidentP55196

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0005926 [CC]connecting hemi-adherens junctionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MMI, chain A
Confidence level:very confident
Coverage over the Query: 34-190
View the alignment between query and template
View the model in PyMOL
Template: 2F6H, chain X
Confidence level:very confident
Coverage over the Query: 35-228
View the alignment between query and template
View the model in PyMOL
Template: 2F6H, chain X
Confidence level:confident
Coverage over the Query: 316-407
View the alignment between query and template
View the model in PyMOL