Diaphorina citri psyllid: psy2548

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MGNCNAPKSITKSAVMYCLRCMVGYDIPLNQGCLTPIQIKLTPGSILNPNDNVAVVGGNVQTSQRVVDVILKAFGVAASSQGCMNNITFGDQTWGYYETVGGGAGASRIQDFAEGGGPNINSGVHSHMTNTRITDAEILETRYPIMLARFGLREGSAGLGKYSGGSGMIREYVFRKPMTLCMLTERRVFWPQGLQVLPKQKEPKQEG
cccccccHHHHHHHHHHHHHHHHcccccccccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccCEEECccccEEEEEccccccccccccccccccccccccccccccccccccHHHHHHcccEEEEEEEEEcccccccccccccCEEEEEEEcccEEEEEECccCECcccccccccccccccccc
MGNCNAPKSITKSAVMYCLRCMVGYDIPLNQGCLTPIQIKLTPGSILNPNDNVAVVGGNVQTSQRVVDVILKAFGVAASSQGCMNNITFGDQTWGYYETVGGGAGASRIQDFAEGGGPNINSGVHSHMTNTRITDAEILETRYPIMLARFGLREGSAGLGKYSGGSGMIREYVFRKPMTLCMLTERRVFWPQGLQV***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNCNAPKSITKSAVMYCLRCMVGYDIPLNQGCLTPIQIKLTPGSILNPNDNVAVVGGNVQTSQRVVDVILKAFGVAASSQGCMNNITFGDQTWGYYETVGGGAGASRIQDFAEGGGPNINSGVHSHMTNTRITDAEILETRYPIMLARFGLREGSAGLGKYSGGSGMIREYVFRKPMTLCMLTERRVFWPQGLQVLPKQKEPKQEG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
5-oxoprolinase Catalyzes the cleavage of 5-oxo-L-proline to form L-glutamate coupled to the hydrolysis of ATP to ADP and inorganic phosphate.confidentO14841
5-oxoprolinase Catalyzes the cleavage of 5-oxo-L-proline to form L-glutamate coupled to the hydrolysis of ATP to ADP and inorganic phosphate.confidentQ8K010
5-oxoprolinase Catalyzes the cleavage of 5-oxo-L-proline to form L-glutamate coupled to the hydrolysis of ATP to ADP and inorganic phosphate.confidentP28273

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0017168 [MF]5-oxoprolinase (ATP-hydrolyzing) activityprobableGO:0016812, GO:0016787, GO:0016810, GO:0003674, GO:0003824
GO:0006749 [BP]glutathione metabolic processprobableGO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006575, GO:0043603, GO:0006082, GO:0006520, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0006790, GO:0019752, GO:0008152, GO:0043436, GO:0008150, GO:0006518, GO:0044281
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!