Query         psy2555
Match_columns 90
No_of_seqs    103 out of 793
Neff          5.9 
Searched_HMMs 46136
Date          Fri Aug 16 19:13:28 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2555.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2555hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02538 Hydantoinase_B:  Hydan 100.0 1.4E-31   3E-36  214.3  10.3   84    2-90     36-119 (527)
  2 COG0146 HyuB N-methylhydantoin 100.0 4.3E-31 9.4E-36  212.7  10.2   83    3-90     38-122 (563)
  3 PLN02666 5-oxoprolinase        100.0 2.4E-29 5.3E-34  216.6  10.0   84    2-90    778-861 (1275)
  4 KOG1939|consensus               99.9 7.9E-25 1.7E-29  182.2   9.6   82    4-90    762-844 (1247)
  5 PF10144 SMP_2:  Bacterial viru  89.6    0.92   2E-05   33.3   5.0   53    5-88     88-143 (210)
  6 TIGR02851 spore_V_T stage V sp  79.3     6.6 0.00014   27.9   5.3   68    5-78     71-145 (180)
  7 PRK11477 carbohydrate diacid t  74.3     6.7 0.00015   30.1   4.5   67    5-89     24-94  (385)
  8 PRK14061 unknown domain/lipoat  74.1     6.6 0.00014   32.9   4.7   56    5-88     88-143 (562)
  9 COG0179 MhpD 2-keto-4-pentenoa  73.0     6.7 0.00014   29.7   4.1   38   30-67    208-248 (266)
 10 KOG0673|consensus               72.4       4 8.6E-05   31.2   2.8   46    2-52    185-230 (293)
 11 PRK06033 hypothetical protein;  69.5     6.5 0.00014   24.7   2.9   30   24-58     12-41  (83)
 12 PF10114 PocR:  Sensory domain   68.2     1.7 3.6E-05   29.5  -0.0   73    5-88     23-102 (173)
 13 PF15072 DUF4539:  Domain of un  67.3      22 0.00048   22.5   5.0   40    3-55     19-58  (86)
 14 PRK11246 hypothetical protein;  61.6      17 0.00036   27.1   4.2   55    5-88     88-143 (218)
 15 PF00609 DAGK_acc:  Diacylglyce  57.5     8.7 0.00019   26.3   2.0   36   49-87     76-120 (161)
 16 COG2127 Uncharacterized conser  57.3     6.6 0.00014   26.2   1.3   14   45-58     26-39  (107)
 17 PF05651 Diacid_rec:  Putative   56.3      26 0.00056   23.8   4.2   68    4-88     18-88  (135)
 18 PRK08433 flagellar motor switc  56.2      13 0.00029   24.7   2.7   29   25-58     38-66  (111)
 19 PRK08916 flagellar motor switc  55.3      13 0.00029   24.9   2.6   40   24-68     50-91  (116)
 20 PRK08983 fliN flagellar motor   55.0      15 0.00032   25.0   2.8   30   24-58     56-85  (127)
 21 PRK06788 flagellar motor switc  55.0      13 0.00029   25.0   2.6   32   23-59     38-69  (119)
 22 PRK09732 hypothetical protein;  54.8      30 0.00065   23.6   4.3   68    5-87     30-111 (134)
 23 PLN02994 1-aminocyclopropane-1  53.2      31 0.00066   23.7   4.2   25   33-60    129-153 (153)
 24 PF05708 DUF830:  Orthopoxvirus  52.6     7.5 0.00016   25.9   1.0   14   44-57      1-14  (158)
 25 PRK03760 hypothetical protein;  52.5     7.2 0.00016   25.9   0.9   50    5-54     61-115 (117)
 26 TIGR02754 sod_Ni_protease nick  52.3      27 0.00059   21.1   3.5   12   43-54     10-21  (90)
 27 TIGR02480 fliN flagellar motor  51.8      10 0.00023   23.0   1.5   28   27-59     16-43  (77)
 28 PF10584 Proteasome_A_N:  Prote  50.7     3.3 7.1E-05   20.4  -0.7   14    4-17      2-15  (23)
 29 TIGR02303 HpaG-C-term 4-hydrox  50.7      11 0.00024   27.9   1.7   36   29-66    191-227 (245)
 30 TIGR03220 catechol_dmpE 2-oxop  50.2      26 0.00057   25.8   3.7   45   11-56    182-229 (255)
 31 PF02743 Cache_1:  Cache domain  48.0      15 0.00032   21.7   1.7   29   55-88      3-33  (81)
 32 PRK09907 toxin MazF; Provision  48.0      16 0.00034   23.8   2.0   15   45-59      7-22  (111)
 33 PF01557 FAA_hydrolase:  Fumary  47.4      19 0.00042   25.5   2.6   42   13-57    144-185 (218)
 34 PRK05698 fliN flagellar motor   47.2      19 0.00041   25.4   2.4   31   23-58     83-113 (155)
 35 COG3726 AhpA Uncharacterized m  47.1      18 0.00039   26.8   2.3   55    5-87     88-142 (214)
 36 KOG2030|consensus               46.7      26 0.00057   30.9   3.6   23   36-62    518-540 (911)
 37 KOG1535|consensus               46.6      37  0.0008   25.3   3.9   38   23-62    157-194 (217)
 38 TIGR02305 HpaG-N-term 4-hydrox  46.6      20 0.00044   25.5   2.5   42   13-57    139-180 (205)
 39 PRK12764 hypothetical protein;  45.6      16 0.00034   29.9   2.1   33   34-66    169-204 (500)
 40 PF02639 DUF188:  Uncharacteriz  44.5      16 0.00034   24.8   1.6   28   25-55     32-59  (130)
 41 PRK13019 clpS ATP-dependent Cl  43.9      16 0.00034   23.6   1.5   12   48-59     22-33  (94)
 42 TIGR02312 HpaH 2-oxo-hepta-3-e  42.3      30 0.00064   25.9   3.0   44   11-55    193-239 (267)
 43 TIGR02219 phage_NlpC_fam putat  41.8      34 0.00075   22.7   3.0   12   43-54     75-86  (134)
 44 PRK11342 mhpD 2-keto-4-penteno  41.8      32 0.00069   25.5   3.1   44   12-56    187-233 (262)
 45 PF02452 PemK:  PemK-like prote  40.8      18 0.00039   22.2   1.4   13   46-58      1-13  (110)
 46 PRK15203 4-hydroxyphenylacetat  40.7      17 0.00037   29.1   1.5   36   33-68    152-190 (429)
 47 PRK10691 hypothetical protein;  40.6      29 0.00063   25.1   2.6   23   43-65    180-203 (219)
 48 PF01052 SpoA:  Surface present  38.4      19 0.00041   21.4   1.1   27   27-58     16-42  (77)
 49 PF01555 N6_N4_Mtase:  DNA meth  38.3      38 0.00083   22.9   2.8   31   25-60    171-202 (231)
 50 PF02814 UreE_N:  UreE urease a  37.6      22 0.00047   20.9   1.3   12   44-55     50-61  (65)
 51 smart00702 P4Hc Prolyl 4-hydro  37.4      33 0.00071   23.2   2.4   27   50-78    116-148 (178)
 52 PF10948 DUF2635:  Protein of u  37.0      23 0.00051   20.1   1.3   13   44-56     34-46  (47)
 53 PRK00033 clpS ATP-dependent Cl  36.5      24 0.00051   23.0   1.5   11   49-59     29-39  (100)
 54 PRK07963 fliN flagellar motor   35.9      43 0.00094   23.0   2.7   31   23-58     64-94  (137)
 55 COG4043 Preprotein translocase  35.8      28  0.0006   23.3   1.7   11   44-54     33-43  (111)
 56 TIGR03218 catechol_dmpH 4-oxal  35.5      53  0.0012   24.4   3.4   48   10-59    189-239 (263)
 57 PF00877 NLPC_P60:  NlpC/P60 fa  35.5     9.3  0.0002   23.8  -0.6   13   43-55     50-62  (105)
 58 PF14827 Cache_3:  Sensory doma  35.2      48   0.001   21.1   2.8   64    7-88     42-108 (116)
 59 PRK00124 hypothetical protein;  35.1      26 0.00057   24.5   1.6   13   43-55     63-75  (151)
 60 PRK11524 putative methyltransf  35.0      26 0.00057   26.0   1.7   22   34-60    198-219 (284)
 61 PF04968 CHORD:  CHORD ;  Inter  34.2      23  0.0005   21.4   1.0    8   70-77     29-36  (64)
 62 PF11213 DUF3006:  Protein of u  33.7      47   0.001   19.9   2.4   13   41-53     30-42  (71)
 63 PF13550 Phage-tail_3:  Putativ  33.6      27 0.00059   22.9   1.5   13   44-56    139-151 (164)
 64 TIGR00113 queA S-adenosylmethi  33.4      25 0.00055   27.7   1.4   15   43-57     47-61  (344)
 65 PTZ00414 10 kDa heat shock pro  32.4      45 0.00098   21.8   2.3   17   43-60     61-77  (100)
 66 COG0309 HypE Hydrogenase matur  32.2      52  0.0011   26.0   3.0   30   45-89     46-75  (339)
 67 PRK00147 queA S-adenosylmethio  32.0      28  0.0006   27.5   1.4   15   43-57     48-62  (342)
 68 KOG2183|consensus               31.9      21 0.00045   29.5   0.8   41   27-67    380-438 (492)
 69 cd06530 S26_SPase_I The S26 Ty  31.8      69  0.0015   18.9   3.0   11   44-54     13-23  (85)
 70 cd03016 PRX_1cys Peroxiredoxin  31.2 1.2E+02  0.0026   21.3   4.5   52    6-58    119-180 (203)
 71 PLN02856 fumarylacetoacetase    30.9      29 0.00062   28.2   1.4   28   30-57    329-359 (424)
 72 cd04474 RPA1_DBD_A RPA1_DBD_A:  30.9      98  0.0021   19.5   3.7   38    5-54     37-74  (104)
 73 PF13651 EcoRI_methylase:  Aden  30.8      25 0.00054   27.8   1.0   15   45-59    133-147 (336)
 74 COG0809 QueA S-adenosylmethion  30.8      30 0.00065   27.5   1.4   15   43-57     48-62  (348)
 75 TIGR02228 sigpep_I_arch signal  30.7      97  0.0021   21.4   3.9   27   44-70     44-70  (158)
 76 PRK10838 spr outer membrane li  30.3      47   0.001   23.9   2.3   13   43-55    127-139 (190)
 77 PF13180 PDZ_2:  PDZ domain; PD  30.2      30 0.00066   20.5   1.1   34   44-77     31-74  (82)
 78 PRK01424 S-adenosylmethionine:  30.2      31 0.00068   27.5   1.5   18   40-57     42-59  (366)
 79 PRK06933 type III secretion sy  29.9      82  0.0018   24.4   3.7   46   27-77    245-294 (308)
 80 PF02938 GAD:  GAD domain;  Int  29.8      75  0.0016   19.8   3.0   20   31-52     63-82  (95)
 81 PF02547 Queuosine_synth:  Queu  29.6      24 0.00051   27.8   0.7   15   43-57     47-61  (341)
 82 PF02353 CMAS:  Mycolic acid cy  29.4      30 0.00066   25.9   1.2   38    4-52     30-67  (273)
 83 PF12600 DUF3769:  Protein of u  29.4      29 0.00064   28.4   1.2   17   43-59     20-36  (451)
 84 cd04480 RPA1_DBD_A_like RPA1_D  29.3   1E+02  0.0022   18.5   3.4   36    6-53     22-57  (86)
 85 PF13756 Stimulus_sens_1:  Stim  29.1      43 0.00093   21.8   1.8   18    6-23     20-37  (112)
 86 cd00989 PDZ_metalloprotease PD  29.0      37 0.00081   19.4   1.4   10   44-53     29-38  (79)
 87 PF14811 TPD:  Protein of unkno  28.8      44 0.00095   23.1   1.8   24   61-89     62-85  (139)
 88 PF13403 Hint_2:  Hint domain    28.7      39 0.00084   23.0   1.6   13   43-55     19-31  (147)
 89 PF09147 DUF1933:  Domain of un  28.6      90   0.002   22.9   3.5   26    2-27     99-127 (201)
 90 PLN02164 sulfotransferase       28.4      75  0.0016   24.8   3.3   17   44-60     76-92  (346)
 91 PRK08432 flagellar motor switc  28.4      59  0.0013   24.7   2.7   40   24-68    211-252 (283)
 92 PLN02376 1-aminocyclopropane-1  28.4   1E+02  0.0023   24.8   4.2   28   30-60    128-155 (496)
 93 PF10084 DUF2322:  Uncharacteri  28.2   1E+02  0.0022   20.3   3.4   35    7-42     17-51  (100)
 94 PF08874 DUF1835:  Domain of un  28.0 1.2E+02  0.0027   19.3   3.8   28   30-60      9-36  (124)
 95 COG3835 CdaR Sugar diacid util  27.8      73  0.0016   25.6   3.1   72    4-89     20-91  (376)
 96 TIGR00523 eIF-1A eukaryotic/ar  27.5      33 0.00071   22.3   1.0   15   44-59     57-71  (99)
 97 cd00991 PDZ_archaeal_metallopr  27.4      41 0.00089   19.9   1.4   10   44-53     27-36  (79)
 98 cd01285 nucleoside_deaminase N  27.4 1.7E+02  0.0036   18.5   5.3   53    4-56     18-76  (109)
 99 cd00990 PDZ_glycyl_aminopeptid  27.1      42 0.00091   19.4   1.3   10   44-53     29-38  (80)
100 cd00714 GFAT Glutamine amidotr  26.8      56  0.0012   23.2   2.2   51    2-52    154-214 (215)
101 PRK11479 hypothetical protein;  26.8      45 0.00097   25.5   1.7   12   43-54     63-74  (274)
102 PLN00139 hypothetical protein;  26.4      64  0.0014   24.8   2.6   21   35-55    276-298 (320)
103 PF05721 PhyH:  Phytanoyl-CoA d  26.4      36 0.00079   22.4   1.1   12   44-55    183-194 (211)
104 PRK08666 5'-methylthioadenosin  26.3      40 0.00088   24.8   1.4   13   44-56     91-103 (261)
105 PRK10040 hypothetical protein;  25.7      47   0.001   19.4   1.3   12   46-57     31-42  (52)
106 TIGR00758 UDG_fam4 uracil-DNA   25.4      95  0.0021   21.4   3.1   28   26-55     42-69  (173)
107 PRK00331 glucosamine--fructose  25.3      91   0.002   25.6   3.4   52    2-54    155-217 (604)
108 COG1443 Idi Isopentenyldiphosp  25.2      49  0.0011   24.1   1.6   18    3-20     34-51  (185)
109 COG2230 Cfa Cyclopropane fatty  25.2 1.1E+02  0.0024   23.5   3.6   39    3-52     39-77  (283)
110 COG1956 GAF domain-containing   24.5      56  0.0012   23.3   1.8   34   45-78     89-127 (163)
111 COG2337 MazF Growth inhibitor   24.4      59  0.0013   21.2   1.8   15   45-59      3-18  (112)
112 PRK09216 rplM 50S ribosomal pr  24.0 1.3E+02  0.0029   20.8   3.6   39    8-56     16-60  (144)
113 CHL00159 rpl13 ribosomal prote  23.9 1.3E+02  0.0029   20.8   3.5   40    8-57     17-62  (143)
114 cd00136 PDZ PDZ domain, also c  23.9      54  0.0012   18.3   1.4    9   44-52     30-38  (70)
115 PF05257 CHAP:  CHAP domain;  I  23.8      49  0.0011   21.1   1.3   31   43-76     61-92  (124)
116 PF07591 PT-HINT:  Pretoxin HIN  23.7      26 0.00057   23.3   0.0   18   43-60     12-29  (130)
117 cd04459 Rho_CSD Rho_CSD: Rho p  23.4      77  0.0017   19.2   2.0   17   35-53     33-49  (68)
118 TIGR01641 phageSPP1_gp7 phage   23.2      90  0.0019   19.5   2.4   27   47-73     78-108 (108)
119 smart00065 GAF Domain present   23.0 1.1E+02  0.0023   17.7   2.7   19   64-87     91-109 (149)
120 TIGR01697 PNPH-PUNA-XAPA inosi  23.0      56  0.0012   23.9   1.6   13   44-56     98-110 (248)
121 cd00992 PDZ_signaling PDZ doma  22.9      57  0.0012   18.7   1.4   10   44-53     43-52  (82)
122 COG2002 AbrB Regulators of sta  22.8 1.5E+02  0.0032   18.4   3.3   16   35-52     20-35  (89)
123 COG1671 Uncharacterized protei  22.7      56  0.0012   23.0   1.5   12   44-55     63-74  (150)
124 KOG4146|consensus               22.5      87  0.0019   20.6   2.2   36   23-58     34-76  (101)
125 TIGR02551 SpaO_YscQ type III s  22.5      52  0.0011   24.8   1.4   31   23-58    141-171 (298)
126 TIGR03633 arc_protsome_A prote  22.4      50  0.0011   23.5   1.2   17    1-17      1-17  (224)
127 COG1015 DeoB Phosphopentomutas  22.4 1.1E+02  0.0024   24.8   3.2   23   43-65    320-348 (397)
128 PF00391 PEP-utilizers:  PEP-ut  22.3      35 0.00076   20.6   0.3   40    6-54     31-76  (80)
129 PF08541 ACP_syn_III_C:  3-Oxoa  22.2 1.8E+02  0.0039   17.3   3.6   11   43-53     64-74  (90)
130 PF09142 TruB_C:  tRNA Pseudour  21.9      75  0.0016   18.3   1.7   14    6-19     28-41  (56)
131 PF02668 TauD:  Taurine catabol  21.9      46   0.001   23.2   0.9   12   44-55    224-235 (258)
132 PF08741 YwhD:  YwhD family;  I  21.8      55  0.0012   23.4   1.3   28   50-77      7-38  (163)
133 PHA02813 hypothetical protein;  21.8 1.2E+02  0.0025   24.3   3.2   33   50-82    127-171 (354)
134 KOG1170|consensus               21.7      67  0.0015   28.8   2.0   36   50-88    689-730 (1099)
135 cd01674 Homoaconitase_Swivel H  21.7 1.4E+02  0.0031   20.4   3.3   32   30-61     24-59  (129)
136 PF05382 Amidase_5:  Bacterioph  21.6      67  0.0015   22.2   1.7   13   44-56     75-87  (145)
137 PF01505 Vault:  Major Vault Pr  21.6      55  0.0012   17.8   1.0   19   44-65     25-43  (43)
138 PRK05967 cystathionine beta-ly  21.4 1.2E+02  0.0026   24.0   3.2   29   31-62     89-117 (395)
139 PRK13699 putative methylase; P  21.1 1.3E+02  0.0028   21.7   3.2   22   34-60    153-174 (227)
140 KOG4207|consensus               21.1 1.1E+02  0.0023   23.3   2.7   29   29-60     25-53  (256)
141 PF03260 Lipoprotein_11:  Lepid  20.9 1.1E+02  0.0023   23.4   2.7   20   66-90    193-212 (253)
142 PF02311 AraC_binding:  AraC-li  20.9      51  0.0011   20.1   0.9   12   44-55     44-55  (136)
143 PRK08202 purine nucleoside pho  20.8      67  0.0015   24.0   1.7   14   44-57    120-133 (272)
144 PHA03200 uracil DNA glycosylas  20.8      99  0.0022   23.5   2.6   20   50-70     88-107 (255)
145 PF08918 PhoQ_Sensor:  PhoQ Sen  20.8      58  0.0013   23.6   1.3   19    7-25     77-95  (180)
146 PRK06666 fliM flagellar motor   20.5      86  0.0019   23.8   2.2   26   27-57    266-291 (337)
147 PF00122 E1-E2_ATPase:  E1-E2 A  20.5      57  0.0012   22.7   1.2   25   43-70     50-74  (230)
148 COG0791 Spr Cell wall-associat  20.4      85  0.0018   21.7   2.0   12   44-55    138-149 (197)
149 PF00717 Peptidase_S24:  Peptid  20.3      61  0.0013   18.2   1.1   12   43-54      9-20  (70)
150 PF02721 DUF223:  Domain of unk  20.3   1E+02  0.0022   19.1   2.2   19   35-53     18-36  (95)
151 PRK13261 ureE urease accessory  20.2      71  0.0015   22.0   1.6   12   44-55     55-66  (159)
152 COG3971 2-keto-4-pentenoate hy  20.1 1.5E+02  0.0032   22.8   3.4   48    8-55    185-234 (264)
153 PF11814 DUF3335:  Peptidase_C3  20.1      74  0.0016   23.5   1.7   14   46-59    155-168 (207)

No 1  
>PF02538 Hydantoinase_B:  Hydantoinase B/oxoprolinase;  InterPro: IPR003692 An appreciable fraction of the sulphur present in mammals occurs in the form of glutathione. The synthesis of glutathione and its utilization take place by the reactions of the gamma-glutamyl cycle, which include those catalysed by gamma-glutamylcysteine and glutathione synthetases, gamma-glutamyl transpeptidase, cysteinylglycinase, gamma-glutamyl cyclotransferease, and 5-oxoprolinase []. This family includes N-methylhydantoinase B which converts hydantoin to N-carbamyl-amino acids, and 5-oxoprolinase 3.5.2.9 from EC which catalyses the formation of L-glutamate from 5-oxo-L-proline. These enzymes are part of the oxoprolinase family and are related to hydantoinase_A.; GO: 0003824 catalytic activity
Probab=99.97  E-value=1.4e-31  Score=214.33  Aligned_cols=84  Identities=42%  Similarity=0.647  Sum_probs=81.2

Q ss_pred             CCceeeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCCCCCCCCCeEEEEeeeeCCCCCCC
Q psy2555           2 NNFVSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAGGSHLPDLTVITPVFIDSQPVEE   81 (90)
Q Consensus         2 ~~d~~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~GgtHl~D~~~~~PVF~~Gel~~~   81 (90)
                      ++||+|+|+|++|++++|+.++|+|++++..++|.+++++.++|+|||||++||||.||+|++|+++++||||+|||   
T Consensus        36 ~~D~~~aI~d~~G~~va~~~~ip~h~~~~~~~v~~~~~~~~~~i~~GDv~i~NDPy~Gg~H~~Dv~~~~PVF~~Gel---  112 (527)
T PF02538_consen   36 AGDFSCAIFDADGRLVAQSEGIPVHVGSMPFAVKAILEYFEDGIRPGDVFITNDPYIGGTHLPDVTVVMPVFHDGEL---  112 (527)
T ss_pred             hcccceeeECCCCCeEEcCCCCcEEEechHHHHHHHHHhccCCCCCCCEEEEcCcccCCccCCccEEEEeEEeCCce---
Confidence            58999999999999999999999999999999999999887899999999999999999999999999999999988   


Q ss_pred             ccEEEEEeC
Q psy2555          82 GPVFFVANR   90 (90)
Q Consensus        82 ~lv~~~a~~   90 (90)
                        ++|++++
T Consensus       113 --v~~~~~~  119 (527)
T PF02538_consen  113 --VGWAASR  119 (527)
T ss_pred             --EEEEeee
Confidence              9999875


No 2  
>COG0146 HyuB N-methylhydantoinase B/acetone carboxylase, alpha subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism]
Probab=99.97  E-value=4.3e-31  Score=212.71  Aligned_cols=83  Identities=48%  Similarity=0.789  Sum_probs=80.2

Q ss_pred             CceeeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcCC--CCCCCcEEEecCCCCCCCCCCCeEEEEeeeeCCCCCC
Q psy2555           3 NFVSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKG--NFKKGSVILSNHPKAGGSHLPDLTVITPVFIDSQPVE   80 (90)
Q Consensus         3 ~d~~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~--~l~~GDv~i~NDPy~GgtHl~D~~~~~PVF~~Gel~~   80 (90)
                      .||||||||++|+++||++++|+|+|+|...||.+++++.+  +|+|||||++||||.|||||||+++++|||++|+|  
T Consensus        38 lD~scAI~d~~G~lVA~a~hipVHlGsM~~~vk~~i~~~~~~~~l~pGDV~~~NdPy~GgTHLpDvt~~~PvF~~~~l--  115 (563)
T COG0146          38 LDFSCAIFDAEGNLVAQAPHIPVHLGSMSVSVKAMIRNNKENPDLEPGDVFITNDPYIGGTHLPDVTLVTPVFHDGKL--  115 (563)
T ss_pred             cceeEEEECCCCCeeccCCCCeEEecccHHHHHHHHHhhccCCCCCCCCEEEecCcccCCccCCceeEEeeeEeCCeE--
Confidence            69999999999999999999999999999999999999875  89999999999999999999999999999999987  


Q ss_pred             CccEEEEEeC
Q psy2555          81 EGPVFFVANR   90 (90)
Q Consensus        81 ~~lv~~~a~~   90 (90)
                         +||+++|
T Consensus       116 ---i~~va~r  122 (563)
T COG0146         116 ---IGYVANR  122 (563)
T ss_pred             ---EEEEEec
Confidence               9999986


No 3  
>PLN02666 5-oxoprolinase
Probab=99.96  E-value=2.4e-29  Score=216.64  Aligned_cols=84  Identities=58%  Similarity=1.007  Sum_probs=81.1

Q ss_pred             CCceeeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCCCCCCCCCeEEEEeeeeCCCCCCC
Q psy2555           2 NNFVSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAGGSHLPDLTVITPVFIDSQPVEE   81 (90)
Q Consensus         2 ~~d~~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~GgtHl~D~~~~~PVF~~Gel~~~   81 (90)
                      ++||+|+|+|++|++++|+.++|+|+|+|..+++.++++|+++|+|||||++||||.||+|+||+++++|||++|||   
T Consensus       778 ~~D~s~ai~d~~G~lva~~~~ip~hlgsm~~~v~~~l~~~~~~l~pGDV~i~NDPy~GgtHl~Dv~~~~PVF~~G~l---  854 (1275)
T PLN02666        778 RLDFSCALFGPDGGLVANAPHVPVHLGAMSSTVRWQLEYWGENLNEGDVLVTNHPQAGGSHLPDITVITPVFRDGKI---  854 (1275)
T ss_pred             ccccceEEECCCCCeeecCCCceEEeecCHHHHHHHHHhccCCCCCCCEEEEcCCcCCCCcCCceEEEeCeEECCEE---
Confidence            58999999999999999999999999999999999999998789999999999999999999999999999999987   


Q ss_pred             ccEEEEEeC
Q psy2555          82 GPVFFVANR   90 (90)
Q Consensus        82 ~lv~~~a~~   90 (90)
                        ++|++++
T Consensus       855 --v~f~a~~  861 (1275)
T PLN02666        855 --VFFVASR  861 (1275)
T ss_pred             --EEEEEEe
Confidence              9999985


No 4  
>KOG1939|consensus
Probab=99.92  E-value=7.9e-25  Score=182.16  Aligned_cols=82  Identities=65%  Similarity=1.070  Sum_probs=79.8

Q ss_pred             ceeeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCCCCCCCCCeEEEEeeeeCC-CCCCCc
Q psy2555           4 FVSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAGGSHLPDLTVITPVFIDS-QPVEEG   82 (90)
Q Consensus         4 d~~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~GgtHl~D~~~~~PVF~~G-el~~~~   82 (90)
                      |||||||+++|.++|.++++|+|+|+|+.+|++.+++|+++|+||||+++|+|-.||+||||+|++.|||.++ ++    
T Consensus       762 DfSCALF~pdGgLVANAPHvPvhLGsMqt~V~~Q~k~~~~kLk~GDVlltNHP~aGG~HLPDiTvITPvF~~~~~~----  837 (1247)
T KOG1939|consen  762 DFSCALFSPDGGLVANAPHVPVHLGSMQTTVKWQLKHWGEKLKPGDVLLTNHPSAGGSHLPDITVITPVFDKGHEP----  837 (1247)
T ss_pred             cceeEeEcCCCCeeccCCCCceeecchHHHHHHHHHHhccCCCCCcEEEecCCCCCCccCCCceEEeeeecCCCcE----
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999988 55    


Q ss_pred             cEEEEEeC
Q psy2555          83 PVFFVANR   90 (90)
Q Consensus        83 lv~~~a~~   90 (90)
                       +||+|+|
T Consensus       838 -vF~vAsR  844 (1247)
T KOG1939|consen  838 -VFFVASR  844 (1247)
T ss_pred             -EEEEecc
Confidence             9999987


No 5  
>PF10144 SMP_2:  Bacterial virulence factor haemolysin;  InterPro: IPR019305  This entry represents a group of bacterial proteins that are membrane proteins that effect the expression of haemolysin under anaerobic conditions []. 
Probab=89.60  E-value=0.92  Score=33.27  Aligned_cols=53  Identities=21%  Similarity=0.560  Sum_probs=33.7

Q ss_pred             eeeEEeCCCCCeeeecCC-CceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCCCC--CCCCCeEEEEeeeeCCCCCCC
Q psy2555           5 VSKESFGPDGGLVSNAPH-IPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAGG--SHLPDLTVITPVFIDSQPVEE   81 (90)
Q Consensus         5 ~~~~i~d~~G~~va~~~g-~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~Gg--tHl~D~~~~~PVF~~Gel~~~   81 (90)
                      +.++|||.+|..+|++.. .|         ++..+   +  +        |-|-.+.  .|    -++.||+.++++   
T Consensus        88 ldAsIYd~~G~lLA~S~~~~~---------vr~~L---~--l--------d~~~~~~~~~q----q~VepI~~~~~~---  138 (210)
T PF10144_consen   88 LDASIYDADGVLLAQSGESVS---------VRERL---G--L--------DGPEAGSYGRQ----QIVEPIYSDDGP---  138 (210)
T ss_pred             eEEEEECCCCCEEEEcCCCcc---------hhhhh---c--C--------CcccccccCCc----eEEEEeccCCCe---
Confidence            468999999999998642 22         23322   1  1        2222221  22    489999999977   


Q ss_pred             ccEEEEE
Q psy2555          82 GPVFFVA   88 (90)
Q Consensus        82 ~lv~~~a   88 (90)
                        +||+=
T Consensus       139 --~GflR  143 (210)
T PF10144_consen  139 --LGFLR  143 (210)
T ss_pred             --eEEEE
Confidence              99963


No 6  
>TIGR02851 spore_V_T stage V sporulation protein T. Members of this protein family are the stage V sporulation protein T (SpoVT), a protein of the sporulation/germination program in Bacillus subtilis and related species. The amino-terminal 50 amino acids are nearly perfectly conserved across all endospore-forming bacteria. SpoVT is a DNA-binding transcriptional regulator related to AbrB (See PFAM model pfam04014).
Probab=79.28  E-value=6.6  Score=27.95  Aligned_cols=68  Identities=9%  Similarity=0.065  Sum_probs=44.1

Q ss_pred             eeeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEEecCC---CCCCCCC----CCeEEEEeeeeCCC
Q psy2555           5 VSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHP---KAGGSHL----PDLTVITPVFIDSQ   77 (90)
Q Consensus         5 ~~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDP---y~GgtHl----~D~~~~~PVF~~Ge   77 (90)
                      ++++|.|++.=+.+.+.|---|.+. .  +....++   -|+.|.+++.++-   |.+.++.    --..++.|++.+|+
T Consensus        71 ~aVaITDr~~ILA~~G~g~d~~~~~-~--is~~t~~---~i~~gk~~~~~~~~~~~i~c~~~~~~~l~s~ii~Pl~~~g~  144 (180)
T TIGR02851        71 HIVLITDRDTVIAVAGVSKKEYLNK-P--ISDELED---TMEERKTVILSDTKDGPIEIIDGQEFEYTSQVIAPIIAEGD  144 (180)
T ss_pred             CEEEEECCCcEEEEECCChhhcCCC-c--cCHHHHH---HHHcCCEEEecCCccceeccccCCCCCcceEEEEEEEECCe
Confidence            4788999887777677776666555 2  2222222   2677888766653   3444422    24899999999997


Q ss_pred             C
Q psy2555          78 P   78 (90)
Q Consensus        78 l   78 (90)
                      .
T Consensus       145 v  145 (180)
T TIGR02851       145 P  145 (180)
T ss_pred             E
Confidence            6


No 7  
>PRK11477 carbohydrate diacid transcriptional activator CdaR; Provisional
Probab=74.25  E-value=6.7  Score=30.13  Aligned_cols=67  Identities=12%  Similarity=0.256  Sum_probs=43.6

Q ss_pred             eeeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEEecCC----CCCCCCCCCeEEEEeeeeCCCCCC
Q psy2555           5 VSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHP----KAGGSHLPDLTVITPVFIDSQPVE   80 (90)
Q Consensus         5 ~~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDP----y~GgtHl~D~~~~~PVF~~Gel~~   80 (90)
                      +..-|.|.+|.++|.+.  |--+|+.....+.++       +.|+.+..+.-    |.| +.   -.+-.||+++|++  
T Consensus        24 ~ninimd~~G~IIaS~d--~~Rig~~HegA~~~~-------~~~~~~~i~~~~~~~~~g-~k---~GiN~Pi~~~~~v--   88 (385)
T PRK11477         24 TNINVMDARGRIIGSGD--RERIGELHEGALLVL-------SQGRVVDIDDAVARHLHG-VR---QGINLPLRLEGEI--   88 (385)
T ss_pred             CCeEEECCCCEEEecCC--hHHcccccHHHHHHH-------hcCCeeeecHHHHhhcCC-CC---cCceeeEEECCEE--
Confidence            45678999999998653  455777776665553       34555555543    333 21   2466899999987  


Q ss_pred             CccEEEEEe
Q psy2555          81 EGPVFFVAN   89 (90)
Q Consensus        81 ~~lv~~~a~   89 (90)
                         +|+++.
T Consensus        89 ---iGvIgI   94 (385)
T PRK11477         89 ---VGVIGL   94 (385)
T ss_pred             ---EEEEec
Confidence               988763


No 8  
>PRK14061 unknown domain/lipoate-protein ligase A fusion protein; Provisional
Probab=74.05  E-value=6.6  Score=32.85  Aligned_cols=56  Identities=16%  Similarity=0.342  Sum_probs=35.8

Q ss_pred             eeeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCCCCCCCCCeEEEEeeeeCCCCCCCccE
Q psy2555           5 VSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAGGSHLPDLTVITPVFIDSQPVEEGPV   84 (90)
Q Consensus         5 ~~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~GgtHl~D~~~~~PVF~~Gel~~~~lv   84 (90)
                      +.++|||++|.++|++..-        ..+|..+   +          .|-|-.++  ..-.-++.|||.++.+     +
T Consensus        88 lDAsiY~~~G~lla~s~~~--------~~~r~~l---~----------l~~~~~~~--~~~qQiVePi~~~~~~-----~  139 (562)
T PRK14061         88 LDAGVYDEQGDLIARSGES--------VEVRDRL---A----------LDGKKAGG--YFNQQIVEPIAGKNGP-----L  139 (562)
T ss_pred             eeeeeecCCCCEEEecCCc--------ccHHHHh---c----------CCCcccCC--ccceeEEEEecCCCCc-----e
Confidence            4689999999999986421        1234433   2          22333321  2235689999999876     9


Q ss_pred             EEEE
Q psy2555          85 FFVA   88 (90)
Q Consensus        85 ~~~a   88 (90)
                      ||+=
T Consensus       140 GflR  143 (562)
T PRK14061        140 GYLR  143 (562)
T ss_pred             EEEE
Confidence            9963


No 9  
>COG0179 MhpD 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=72.96  E-value=6.7  Score=29.70  Aligned_cols=38  Identities=24%  Similarity=0.233  Sum_probs=26.3

Q ss_pred             hHHHHHHHHHhcC--CCCCCCcEEEecCCCC-CCCCCCCeE
Q psy2555          30 MQEAVKFQIDHRK--GNFKKGSVILSNHPKA-GGSHLPDLT   67 (90)
Q Consensus        30 ~~~~v~~~~~~~~--~~l~~GDv~i~NDPy~-GgtHl~D~~   67 (90)
                      |-..+..++++..  -+|+||||+.|-=|=. |-.|.-|..
T Consensus       208 Mi~~i~~lI~~lS~~~tL~pGDvI~TGTP~Gvg~l~~GD~v  248 (266)
T COG0179         208 MIFSIPELIAYLSRFMTLEPGDVILTGTPSGVGFLKPGDVV  248 (266)
T ss_pred             cccCHHHHHHHHhCCcccCCCCEEEeCCCCCcccCCCCCEE
Confidence            4444555555554  4799999999999975 446777743


No 10 
>KOG0673|consensus
Probab=72.41  E-value=4  Score=31.21  Aligned_cols=46  Identities=22%  Similarity=0.312  Sum_probs=32.5

Q ss_pred             CCceeeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEE
Q psy2555           2 NNFVSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVIL   52 (90)
Q Consensus         2 ~~d~~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i   52 (90)
                      ++..||.+|-+.|++   +.|+|..+.+.+.. ..++.+.- +++|||.+=
T Consensus       185 ~GelScq~YQrS~dm---glGVPFnIASYsLL-T~miAhv~-gl~pgdfiH  230 (293)
T KOG0673|consen  185 NGELSCQMYQRSGDM---GLGVPFNIASYSLL-TCMIAHVC-GLKPGDFIH  230 (293)
T ss_pred             CCeeeehhhhhcccc---ccCccchhHHHHHH-HHHHHHHh-CCCCCceEE
Confidence            356778888887776   56889888876543 55566653 799999763


No 11 
>PRK06033 hypothetical protein; Validated
Probab=69.50  E-value=6.5  Score=24.68  Aligned_cols=30  Identities=23%  Similarity=0.315  Sum_probs=23.0

Q ss_pred             ceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCC
Q psy2555          24 PVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKA   58 (90)
Q Consensus        24 p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~   58 (90)
                      .+-+|.....++.++     +|++|||+-.|-+..
T Consensus        12 ~v~Lg~~~i~l~dlL-----~L~~GDVI~L~~~~~   41 (83)
T PRK06033         12 MVVLGRSSMPIHQVL-----RMGRGAVIPLDATEA   41 (83)
T ss_pred             EEEEecccccHHHHh-----CCCCCCEEEeCCCCC
Confidence            344677777777776     799999999987654


No 12 
>PF10114 PocR:  Sensory domain found in PocR;  InterPro: IPR018771 This entry is thought to act as a sensory domain in histidine kinases catalysing the reaction: ATP + protein L-histidine = ADP + protein N- phospho-L-histidine. 
Probab=68.20  E-value=1.7  Score=29.54  Aligned_cols=73  Identities=15%  Similarity=0.239  Sum_probs=40.6

Q ss_pred             eeeEEeCCCCCeeeecCCCceeecchH---H---HHHHHHHhcC-CCCCCCcEEEecCCCCCCCCCCCeEEEEeeeeCCC
Q psy2555           5 VSKESFGPDGGLVSNAPHIPVHLGSMQ---E---AVKFQIDHRK-GNFKKGSVILSNHPKAGGSHLPDLTVITPVFIDSQ   77 (90)
Q Consensus         5 ~~~~i~d~~G~~va~~~g~p~~~g~~~---~---~v~~~~~~~~-~~l~~GDv~i~NDPy~GgtHl~D~~~~~PVF~~Ge   77 (90)
                      .++.|+|.+|+.+.+..+.+-|..-+.   .   .++..-.... ...+.|..++.-      -|..=+.+..||+.+|+
T Consensus        23 l~~~i~d~~G~~l~~~~~~~~fC~~~~~~~~~~~~C~~~~~~~~~~a~~~~~~~i~~------C~~GL~~~~~PI~~~g~   96 (173)
T PF10114_consen   23 LSIVIVDPDGNPLTQPSNFCPFCKLIRSSPEGRERCRESDRRLAEQAMKKGEPYIYR------CHAGLVDIAVPIIVDGE   96 (173)
T ss_pred             CcEEEEeCCCCEEeeCCCchhhhhHHhcCCcccccCHHHHHHHHHHhhccCCCEEEE------cCcCceeeeeeEEECCE
Confidence            578899999999966555444432111   0   1111111111 234444333332      35555678999999998


Q ss_pred             CCCCccEEEEE
Q psy2555          78 PVEEGPVFFVA   88 (90)
Q Consensus        78 l~~~~lv~~~a   88 (90)
                      +     +|+..
T Consensus        97 ~-----iG~i~  102 (173)
T PF10114_consen   97 Y-----IGYII  102 (173)
T ss_pred             E-----EEEEE
Confidence            7     88754


No 13 
>PF15072 DUF4539:  Domain of unknown function (DUF4539)
Probab=67.26  E-value=22  Score=22.54  Aligned_cols=40  Identities=15%  Similarity=0.247  Sum_probs=31.8

Q ss_pred             CceeeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEEecC
Q psy2555           3 NFVSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNH   55 (90)
Q Consensus         3 ~d~~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~ND   55 (90)
                      .|+..-+-|+.|++=+.     +|        +.+++++++.|.+|=+++.-|
T Consensus        19 ~D~~v~l~DpTG~i~~t-----iH--------~~v~~~y~~~l~~GavLlLk~   58 (86)
T PF15072_consen   19 EDAFVVLKDPTGEIRGT-----IH--------RKVLEEYGDELSPGAVLLLKD   58 (86)
T ss_pred             CCeEEEEECCCCcEEEE-----Ee--------HHHHhhcCCccccCEEEEEee
Confidence            48888889999987542     34        788888888899999999754


No 14 
>PRK11246 hypothetical protein; Provisional
Probab=61.62  E-value=17  Score=27.09  Aligned_cols=55  Identities=15%  Similarity=0.317  Sum_probs=34.4

Q ss_pred             eeeEEeCCCCCeeeecC-CCceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCCCCCCCCCeEEEEeeeeCCCCCCCcc
Q psy2555           5 VSKESFGPDGGLVSNAP-HIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAGGSHLPDLTVITPVFIDSQPVEEGP   83 (90)
Q Consensus         5 ~~~~i~d~~G~~va~~~-g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~GgtHl~D~~~~~PVF~~Gel~~~~l   83 (90)
                      +.++|||++|.++|++. .+         .+|..+. . ++=.+|       +|.  .    .-++-||+.+++.     
T Consensus        88 lDAsIY~~~G~llA~S~~~~---------~~re~L~-L-d~~~~~-------s~~--~----qQiVEPI~~~~~~-----  138 (218)
T PRK11246         88 LDASVYDEQGDLIARSGESV---------NVRDRLA-L-DGKKAG-------SYF--N----QQIVEPIAGKNGP-----  138 (218)
T ss_pred             eeEEEECCCCCEEEecCCCc---------cHHHHhC-C-CCcccc-------ccC--C----CceEEEecCCCCc-----
Confidence            57899999999999864 22         2333321 1 222223       221  2    3489999999976     


Q ss_pred             EEEEE
Q psy2555          84 VFFVA   88 (90)
Q Consensus        84 v~~~a   88 (90)
                      +||+=
T Consensus       139 lGFlR  143 (218)
T PRK11246        139 LGFLR  143 (218)
T ss_pred             eeEEE
Confidence            99974


No 15 
>PF00609 DAGK_acc:  Diacylglycerol kinase accessory domain;  InterPro: IPR000756 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Diacylglycerol (DAG) is a second messenger that acts as a protein kinase C activator. The DAG kinase domain is assumed to be an accessory domain. Upon cell stimulation, DAG kinase converts DAG into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity. It catalyses the reaction: ATP + 1,2-diacylglycerol = ADP + 1,2-diacylglycerol 3-phosphate. The enzyme is stimulated by calcium and phosphatidylserine and phosphorylated by protein kinase C. This domain is always associated with IPR001206 from INTERPRO.; GO: 0004143 diacylglycerol kinase activity, 0007205 activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway
Probab=57.53  E-value=8.7  Score=26.30  Aligned_cols=36  Identities=25%  Similarity=0.222  Sum_probs=25.9

Q ss_pred             cEEEecCCCCC-CCCCCCe--------EEEEeeeeCCCCCCCccEEEE
Q psy2555          49 SVILSNHPKAG-GSHLPDL--------TVITPVFIDSQPVEEGPVFFV   87 (90)
Q Consensus        49 Dv~i~NDPy~G-gtHl~D~--------~~~~PVF~~Gel~~~~lv~~~   87 (90)
                      -++++|=|+.+ |.++-.-        .+..|-+.||.|   |++++.
T Consensus        76 ~iv~lNIpSy~gG~~~W~~~~~~~~~~~~~~~~~~Dg~l---EVvg~~  120 (161)
T PF00609_consen   76 SIVFLNIPSYGGGVDLWGNSKPDRSKLKFKKQSMDDGKL---EVVGFR  120 (161)
T ss_pred             EEEEEccccccCCcccccCCcccccccccccccccCceE---EEEEEc
Confidence            47899999864 5544333        356788889998   888875


No 16 
>COG2127 Uncharacterized conserved protein [Function unknown]
Probab=57.32  E-value=6.6  Score=26.17  Aligned_cols=14  Identities=36%  Similarity=0.131  Sum_probs=11.3

Q ss_pred             CCCCcEEEecCCCC
Q psy2555          45 FKKGSVILSNHPKA   58 (90)
Q Consensus        45 l~~GDv~i~NDPy~   58 (90)
                      -..=+|++.||||+
T Consensus        26 p~~ykVillNDd~T   39 (107)
T COG2127          26 PKMYKVILLNDDYT   39 (107)
T ss_pred             CCceeEEEecCCCc
Confidence            34558999999997


No 17 
>PF05651 Diacid_rec:  Putative sugar diacid recognition;  InterPro: IPR008599 This region is found in several proteins characterised as carbohydrate diacid regulators (e.g. P36047 from SWISSPROT). An HTH DNA-binding motif is found at the C terminus of these proteins suggesting that this region includes the sugar recognition region.
Probab=56.29  E-value=26  Score=23.77  Aligned_cols=68  Identities=12%  Similarity=0.239  Sum_probs=45.2

Q ss_pred             ceeeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCc-EEEecCC--CCCCCCCCCeEEEEeeeeCCCCCC
Q psy2555           4 FVSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGS-VILSNHP--KAGGSHLPDLTVITPVFIDSQPVE   80 (90)
Q Consensus         4 d~~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GD-v~i~NDP--y~GgtHl~D~~~~~PVF~~Gel~~   80 (90)
                      ++..-|.|.+|..+|.  +-|--+|+...+.+.+++.       ++ +.++++-  -..|++   -.+-.||+++|++  
T Consensus        18 ~~~inimd~~G~IIAS--td~~RIG~~HegA~~~i~~-------~~~~~i~~~~~~~~~g~k---~GinlPI~~~g~~--   83 (135)
T PF05651_consen   18 GYNINIMDENGIIIAS--TDPERIGTFHEGAKEVIRT-------NKEIEITEEDAEQYPGVK---PGINLPIIFNGEV--   83 (135)
T ss_pred             CCCEEEECCCcEEEec--CChhhcCccCHHHHHHHHc-------CCcccccHhHHhhccCCC---cceeeeEEECCEE--
Confidence            3567799999999976  4566788888887777652       22 3344443  122333   2367899999987  


Q ss_pred             CccEEEEE
Q psy2555          81 EGPVFFVA   88 (90)
Q Consensus        81 ~~lv~~~a   88 (90)
                         +|-++
T Consensus        84 ---iGviG   88 (135)
T PF05651_consen   84 ---IGVIG   88 (135)
T ss_pred             ---EEEEE
Confidence               87654


No 18 
>PRK08433 flagellar motor switch protein; Validated
Probab=56.22  E-value=13  Score=24.69  Aligned_cols=29  Identities=34%  Similarity=0.476  Sum_probs=22.2

Q ss_pred             eeecchHHHHHHHHHhcCCCCCCCcEEEecCCCC
Q psy2555          25 VHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKA   58 (90)
Q Consensus        25 ~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~   58 (90)
                      +-+|.....++.++     +|++|||+..+-|..
T Consensus        38 v~LG~t~itl~dlL-----~Lq~GDVI~Ld~~~~   66 (111)
T PRK08433         38 AELGTTQISLLEIL-----KFEKGSVIDLEKPAG   66 (111)
T ss_pred             EEEecccccHHHHh-----CCCCCCEEEeCCCCC
Confidence            34666677777775     699999999987764


No 19 
>PRK08916 flagellar motor switch protein; Reviewed
Probab=55.31  E-value=13  Score=24.92  Aligned_cols=40  Identities=18%  Similarity=0.156  Sum_probs=27.1

Q ss_pred             ceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCCCC--CCCCCeEE
Q psy2555          24 PVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAGG--SHLPDLTV   68 (90)
Q Consensus        24 p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~Gg--tHl~D~~~   68 (90)
                      .+-+|.....++.++     +|++|||+-+|-+..--  .+.++..+
T Consensus        50 tv~LG~~~ltl~ELL-----~L~~GDVI~Ld~~~~e~V~I~Vng~~~   91 (116)
T PRK08916         50 SAVLGRSKMDVGQLL-----KLGPGSVLELDRKVGEAIDIYVNNRLV   91 (116)
T ss_pred             EEEEecccccHHHHh-----cCCCCCEEEcCCCCCCCEEEEECCEEE
Confidence            455677777777775     69999999998766532  34444333


No 20 
>PRK08983 fliN flagellar motor switch protein; Validated
Probab=54.97  E-value=15  Score=25.00  Aligned_cols=30  Identities=13%  Similarity=0.284  Sum_probs=23.2

Q ss_pred             ceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCC
Q psy2555          24 PVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKA   58 (90)
Q Consensus        24 p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~   58 (90)
                      -+-+|.....++.++     +|++|||+.+|-+..
T Consensus        56 ~v~LG~t~ltl~dlL-----~L~~GDVI~Ld~~~d   85 (127)
T PRK08983         56 SMEVGRSFISIRNLL-----QLNQGSVVELDRVAG   85 (127)
T ss_pred             EEEEecCcccHHHHh-----CCCCCCEEEeCCCCC
Confidence            445666677777775     799999999998765


No 21 
>PRK06788 flagellar motor switch protein; Validated
Probab=54.95  E-value=13  Score=25.00  Aligned_cols=32  Identities=19%  Similarity=0.181  Sum_probs=25.2

Q ss_pred             CceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCCC
Q psy2555          23 IPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAG   59 (90)
Q Consensus        23 ~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~G   59 (90)
                      +.+-+|.....++.++     +|++|||+-+|-+..-
T Consensus        38 v~aeLG~t~ltl~DlL-----~L~vGDVI~Ldk~~~d   69 (119)
T PRK06788         38 LGVKLGKASITLGDVK-----QLKVGDVLEVEKNLGH   69 (119)
T ss_pred             EEEEEecceecHHHHh-----CCCCCCEEEeCCcCCC
Confidence            3456777888888876     6999999999977653


No 22 
>PRK09732 hypothetical protein; Provisional
Probab=54.82  E-value=30  Score=23.56  Aligned_cols=68  Identities=19%  Similarity=0.139  Sum_probs=39.3

Q ss_pred             eeeEEeCCCCCeeeecC--CCceeecchHHHHHHHHH--hcC-------CCCCCCcEEEecCCCCCCCCCCCeEEE---E
Q psy2555           5 VSKESFGPDGGLVSNAP--HIPVHLGSMQEAVKFQID--HRK-------GNFKKGSVILSNHPKAGGSHLPDLTVI---T   70 (90)
Q Consensus         5 ~~~~i~d~~G~~va~~~--g~p~~~g~~~~~v~~~~~--~~~-------~~l~~GDv~i~NDPy~GgtHl~D~~~~---~   70 (90)
                      .+.+|.|+.|.+++...  +-+.  .+...+.+....  .+.       +.+++|...+.+        .+.++.+   .
T Consensus        30 v~iaVvD~~G~l~a~~RmDgA~~--~s~~iA~~KA~TAa~~~~~T~~~~~~~~~g~~~~~~--------~~~~~~~~GG~   99 (134)
T PRK09732         30 VSIAVADDGGHLLALSRMDDCAP--IAAYISQEKARTAALGRRETKGYEEMVNNGRTAFVT--------APLLTSLEGGV   99 (134)
T ss_pred             EEEEEEcCCCCEEEEEEcCCCcc--ccHHHHHHHHHHHHHcCCCHHHHHHHHccCchhhcc--------CCCEEEeCCee
Confidence            57899999999998543  4443  444444433221  122       245667644432        2344333   5


Q ss_pred             eeeeCCCCCCCccEEEE
Q psy2555          71 PVFIDSQPVEEGPVFFV   87 (90)
Q Consensus        71 PVF~~Gel~~~~lv~~~   87 (90)
                      ||..+|++     ||=+
T Consensus       100 Pi~~~g~v-----iGAI  111 (134)
T PRK09732        100 PVVVDGQI-----IGAV  111 (134)
T ss_pred             EEeECCEE-----EEEE
Confidence            99889976     7644


No 23 
>PLN02994 1-aminocyclopropane-1-carboxylate synthase
Probab=53.22  E-value=31  Score=23.73  Aligned_cols=25  Identities=16%  Similarity=0.091  Sum_probs=17.0

Q ss_pred             HHHHHHHhcCCCCCCCcEEEecCCCCCC
Q psy2555          33 AVKFQIDHRKGNFKKGSVILSNHPKAGG   60 (90)
Q Consensus        33 ~v~~~~~~~~~~l~~GDv~i~NDPy~Gg   60 (90)
                      ++..++..+   ..|||.++.-+||..+
T Consensus       129 al~~l~~~l---~dpGD~VlVp~P~Y~~  153 (153)
T PLN02994        129 ANEIIMFCI---ADPGDAFLVPTPYYAA  153 (153)
T ss_pred             HHHHHHHHH---cCCCCEEEEeCCCCCC
Confidence            444444433   5789999999998753


No 24 
>PF05708 DUF830:  Orthopoxvirus protein of unknown function (DUF830); PDB: 2IF6_B 3KW0_C.
Probab=52.58  E-value=7.5  Score=25.87  Aligned_cols=14  Identities=21%  Similarity=0.536  Sum_probs=7.9

Q ss_pred             CCCCCcEEEecCCC
Q psy2555          44 NFKKGSVILSNHPK   57 (90)
Q Consensus        44 ~l~~GDv~i~NDPy   57 (90)
                      .+++|||++.+-+.
T Consensus         1 ~l~~GDIil~~~~~   14 (158)
T PF05708_consen    1 KLQTGDIILTRGKS   14 (158)
T ss_dssp             ---TT-EEEEEE-S
T ss_pred             CCCCeeEEEEECCc
Confidence            47999999998763


No 25 
>PRK03760 hypothetical protein; Provisional
Probab=52.48  E-value=7.2  Score=25.93  Aligned_cols=50  Identities=10%  Similarity=0.045  Sum_probs=31.6

Q ss_pred             eeeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcC-----CCCCCCcEEEec
Q psy2555           5 VSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRK-----GNFKKGSVILSN   54 (90)
Q Consensus         5 ~~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~-----~~l~~GDv~i~N   54 (90)
                      ....-.|++|++++...--|.-.......+++++|--.     -++++||.+-..
T Consensus        61 LDiiFld~~g~Vv~i~~~~P~~~~~~~~~a~~VLEl~aG~~~~~gi~~Gd~v~~~  115 (117)
T PRK03760         61 IDVIFLDSNRRVVDFKTLKPWRIYVPKKPARYIIEGPVGKIRVLKVEVGDEIEWI  115 (117)
T ss_pred             eEEEEECCCCeEEEEEeCCCccccCCCccceEEEEeCCChHHHcCCCCCCEEEEe
Confidence            44567899999998755556544333334556655322     269999998654


No 26 
>TIGR02754 sod_Ni_protease nickel-type superoxide dismutase maturation protease. Members of this protein family are apparent proteases encoded adjacent to the genes for a nickel-type superoxide dismutase. This family belongs to the same larger family (see Pfam model pfam00717) as signal peptidase I, an unusual serine protease suggested to have a Ser/Lys catalytic dyad.
Probab=52.28  E-value=27  Score=21.13  Aligned_cols=12  Identities=17%  Similarity=0.235  Sum_probs=8.9

Q ss_pred             CCCCCCcEEEec
Q psy2555          43 GNFKKGSVILSN   54 (90)
Q Consensus        43 ~~l~~GDv~i~N   54 (90)
                      +.|++||+++.|
T Consensus        10 P~l~~GD~vlv~   21 (90)
T TIGR02754        10 PTLPPGDRIIVV   21 (90)
T ss_pred             CccCCCCEEEEE
Confidence            357788888877


No 27 
>TIGR02480 fliN flagellar motor switch protein FliN. Proteins that consist largely of the domain described by this model can be designated flagellar motor switch protein FliN. Longer proteins in which this region is a C-terminal domain typically are designated FliY. More distantly related sequences, outside the scope of this family, are associated with type III secretion and include the surface presentation of antigens protein SpaO required or invasion of host cells by Salmonella enterica.
Probab=51.84  E-value=10  Score=23.02  Aligned_cols=28  Identities=21%  Similarity=0.247  Sum_probs=20.4

Q ss_pred             ecchHHHHHHHHHhcCCCCCCCcEEEecCCCCC
Q psy2555          27 LGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAG   59 (90)
Q Consensus        27 ~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~G   59 (90)
                      +|.....++.++     +|++||++-.|-+...
T Consensus        16 Lg~~~itl~ell-----~L~~Gdvi~L~~~~~~   43 (77)
T TIGR02480        16 LGRTRITLGDLL-----KLGEGSVIELDKLAGE   43 (77)
T ss_pred             EeceEeEHHHHh-----cCCCCCEEEcCCCCCC
Confidence            555555666664     7999999999876653


No 28 
>PF10584 Proteasome_A_N:  Proteasome subunit A N-terminal signature;  InterPro: IPR000426 The proteasome (or macropain) (3.4.25.1 from EC) [, , , , ] is a eukaryotic and archaeal multicatalytic proteinase complex that seems to be involved in an ATP/ubiquitin-dependent nonlysosomal proteolytic pathway. In eukaryotes the proteasome is composed of about 28 distinct subunits which form a highly ordered ring-shaped structure (20S ring) of about 700 kDa. Most proteasome subunits can be classified, on the basis on sequence similarities into two groups, alpha (A) and beta (B). This family contains the alpha subunit sequences which range from 210 to 290 amino acids. These sequences are classified as non-peptidase homologues in MEROPS peptidase family T1 (clan PB(T)). ; GO: 0004175 endopeptidase activity, 0006511 ubiquitin-dependent protein catabolic process, 0019773 proteasome core complex, alpha-subunit complex; PDB: 3H4P_M 1IRU_O 3UN4_U 1FNT_A 3OEV_G 3OEU_U 3SDK_U 3DY3_G 3MG7_G 3L5Q_C ....
Probab=50.75  E-value=3.3  Score=20.41  Aligned_cols=14  Identities=43%  Similarity=0.581  Sum_probs=11.9

Q ss_pred             ceeeEEeCCCCCee
Q psy2555           4 FVSKESFGPDGGLV   17 (90)
Q Consensus         4 d~~~~i~d~~G~~v   17 (90)
                      |.++.+|+++||+.
T Consensus         2 D~~~t~FSp~Grl~   15 (23)
T PF10584_consen    2 DRSITTFSPDGRLF   15 (23)
T ss_dssp             SSSTTSBBTTSSBH
T ss_pred             CCCceeECCCCeEE
Confidence            67788999999986


No 29 
>TIGR02303 HpaG-C-term 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, C-terminal subunit. This model represents one of two subunits/domains of the bifunctional isomerase/decarboxylase involved in 4-hydroxyphenylacetate degradation. In E. coli and some other species this enzyme is encoded by a single polypeptide containing both this domain and the closely related N-terminal domain (TIGR02305). In other species such as Pasteurella multocida these domains are found as two separate proteins (usually as tandem genes). Together, these domains carry out the decarboxylation of 5-oxopent-3-ene-1,2,5-tricarboxylic acid (OPET) to 2-hydroxy-2,4-diene-1,7-dioate (HHDD) and the subsequent isomerization to 2-oxohept-3-ene-1,7-dioate (OHED).
Probab=50.67  E-value=11  Score=27.89  Aligned_cols=36  Identities=25%  Similarity=0.407  Sum_probs=21.2

Q ss_pred             chHHHHHHHHHhcCCCCCCCcEEEecCCCCCC-CCCCCe
Q psy2555          29 SMQEAVKFQIDHRKGNFKKGSVILSNHPKAGG-SHLPDL   66 (90)
Q Consensus        29 ~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~Gg-tHl~D~   66 (90)
                      .....+..+.+.  ..|+|||++++=-|-..+ ....|.
T Consensus       191 ~v~~Li~~ls~~--~tL~pGDvIlTGTp~g~~~l~~GD~  227 (245)
T TIGR02303       191 SVAELIEYLSEF--MTLEPGDVILTGTPKGLSDVKPGDV  227 (245)
T ss_pred             CHHHHHHHHhcC--CCcCCCCEEEcCCCCCCeEcCCCCE
Confidence            334444444332  479999999998875322 344453


No 30 
>TIGR03220 catechol_dmpE 2-oxopent-4-enoate hydratase. Members of this protein family are 2-oxopent-4-enoate hydratase, which is also called 2-hydroxypent-2,4-dienoate hydratase. It is closely related to another gene found in the same operon, 4-oxalocrotonate decarboxylase, with which it interacts closely.
Probab=50.17  E-value=26  Score=25.82  Aligned_cols=45  Identities=31%  Similarity=0.343  Sum_probs=28.0

Q ss_pred             CCCCCeeeecCCCceeecchHHHHHHHHHhc---CCCCCCCcEEEecCC
Q psy2555          11 GPDGGLVSNAPHIPVHLGSMQEAVKFQIDHR---KGNFKKGSVILSNHP   56 (90)
Q Consensus        11 d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~---~~~l~~GDv~i~NDP   56 (90)
                      ..+|+.+.++.+- -.+|....++.++.+++   +..|++||++++=-|
T Consensus       182 ~vnG~~~~~g~~~-~~lg~p~~~l~~L~~~l~~~g~~L~aGdiV~TGt~  229 (255)
T TIGR03220       182 EKNGEIVSTGAGA-AALGSPVNAVAWLANTLGRLGIPLKAGEVILSGSL  229 (255)
T ss_pred             EECCEEEeecchh-hccCCHHHHHHHHHHHHHHcCCCCCCCCEEECCCC
Confidence            3467666554331 12344555666666654   358999999999865


No 31 
>PF02743 Cache_1:  Cache domain;  InterPro: IPR004010 Cache is an extracellular domain that is predicted to have a role in small-molecule recognition in a wide range of proteins, including the animal dihydropyridine-sensitive voltage-gated Ca2+ channel; alpha-2delta subunit, and various bacterial chemotaxis receptors. The name Cache comes from CAlcium channels and CHEmotaxis receptors. This domain consists of an N-terminal part with three predicted strands and an alpha-helix, and a C-terminal part with a strand dyad followed by a relatively unstructured region. The N-terminal portion of the (unpermuted) Cache domain contains three predicted strands that could form a sheet analogous to that present in the core of the PAS domain structure. Cache domains are particularly widespread in bacteria, with Vibrio cholerae. The animal calcium channel alpha-2delta subunits might have acquired a part of their extracellular domains from a bacterial source []. The Cache domain appears to have arisen from the GAF-PAS fold despite their divergent functions [].; GO: 0016020 membrane; PDB: 3C8C_A 3LIB_D 3LIA_A 3LI8_A 3LI9_A.
Probab=47.95  E-value=15  Score=21.67  Aligned_cols=29  Identities=21%  Similarity=0.395  Sum_probs=20.5

Q ss_pred             CCCCC-CCCCCCeEEEEeeee-CCCCCCCccEEEEE
Q psy2555          55 HPKAG-GSHLPDLTVITPVFI-DSQPVEEGPVFFVA   88 (90)
Q Consensus        55 DPy~G-gtHl~D~~~~~PVF~-~Gel~~~~lv~~~a   88 (90)
                      +||.. .+..+=+++.+||+. +|++     +|.++
T Consensus         3 ~py~~~~~~~~vi~~s~pi~~~~g~~-----~Gvv~   33 (81)
T PF02743_consen    3 EPYVDAATGQPVITISVPIYDDDGKI-----IGVVG   33 (81)
T ss_dssp             --EEETTTTEEEEEEEEEEEETTTEE-----EEEEE
T ss_pred             cCEEeCCCCcEEEEEEEEEECCCCCE-----EEEEE
Confidence            67754 366677899999999 8876     87654


No 32 
>PRK09907 toxin MazF; Provisional
Probab=47.95  E-value=16  Score=23.83  Aligned_cols=15  Identities=27%  Similarity=0.512  Sum_probs=13.3

Q ss_pred             CCCCcEEEec-CCCCC
Q psy2555          45 FKKGSVILSN-HPKAG   59 (90)
Q Consensus        45 l~~GDv~i~N-DPy~G   59 (90)
                      ++.|||++.| ||-.|
T Consensus         7 ~~rGdI~~vdl~P~~G   22 (111)
T PRK09907          7 PDMGDLIWVDFDPTKG   22 (111)
T ss_pred             CCCCcEEEEECCCCCC
Confidence            7899999999 79886


No 33 
>PF01557 FAA_hydrolase:  Fumarylacetoacetate (FAA) hydrolase family Mutations in Swiss:P16930 cause inherited tyrosinemia type I.;  InterPro: IPR002529 Fumarylacetoacetase (3.7.1.2 from EC; also known as fumarylacetoacetate hydrolase or FAH) catalyses the hydrolytic cleavage of a carbon-carbon bond in fumarylacetoacetate to yield fumarate and acetoacetate as the final step in phenylalanine and tyrosine degradation []. This is an essential metabolic function in humans, the lack of FAH causing type I tyrosinaemia, which is associated with liver and kidney abnormalities and neurological disorders [, ]. The enzyme mechanism involves a catalytic metal ion, a Glu/His catalytic dyad, and a charged oxyanion hole []. FAH folds into two domains: an N-terminal domain SH3-like beta-barrel, and a C-terminal with an unusual fold consisting of three layers of beta-sheet structures []. This entry represents the C-terminal domain of fumarylacetoacetase, as well as other domains that share a homologous sequence, including:  5-carboxymethyl-2-hydroxymuconate delta-isomerase (CHM isomerase; 5.3.3.10 from EC), which catalyses the conversion of 5-carboxymethyl-2-hydroxymuconate to 5-carboxy-2-oxohept-3-enedioate []. 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase (OPET decarboxylase; 4.1.1.68 from EC), which catalyses the conversion of 5-oxopent-3-ene-1,2,5-tricarboxylate to 2-oxohept-3-enedioate and carbon dioxide. Bifunctional enzyme HpcE (OPET decarboxylase 4.1.1.68 from EC/HHDD isomerase 5.3.3.10 from EC), which is a duplication consisting of a tandem repeat of two FAH C-terminal-like domains. This enzyme is responsible for the degradation of 4-hydroxyphenylacetate, a product of tyrosine and phenylalanine metabolism also released by lignin catabolism [].  ; GO: 0003824 catalytic activity, 0008152 metabolic process; PDB: 1SAW_B 3LZK_B 3S52_B 2WQT_Q 1SV6_C 2DFU_B 1WZO_D 3QDF_A 1GTT_B 1I7O_C ....
Probab=47.44  E-value=19  Score=25.45  Aligned_cols=42  Identities=24%  Similarity=0.416  Sum_probs=26.8

Q ss_pred             CCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEEecCCC
Q psy2555          13 DGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPK   57 (90)
Q Consensus        13 ~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy   57 (90)
                      +|+.+.++.. --.++....++.++.+..  .|++||++++--|-
T Consensus       144 nG~~~~~~~~-~~~~~~~~~ll~~ls~~~--~L~aGdvI~TGt~~  185 (218)
T PF01557_consen  144 NGEVVQSGST-SDMLGDPAELLAWLSRGL--TLRAGDVILTGTPT  185 (218)
T ss_dssp             TTEEEEEEEG-GGBSSSHHHHHHHHHTTS---B-TTEEEEEEESS
T ss_pred             CCEEEEeccc-hhHHhhHHHHHHHHhCCC--CCCcceEEEcCCcC
Confidence            6777665543 233556666777743333  79999999999984


No 34 
>PRK05698 fliN flagellar motor switch protein; Validated
Probab=47.17  E-value=19  Score=25.42  Aligned_cols=31  Identities=23%  Similarity=0.379  Sum_probs=23.9

Q ss_pred             CceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCC
Q psy2555          23 IPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKA   58 (90)
Q Consensus        23 ~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~   58 (90)
                      +.+-+|.....++.++     +|++|||+-+|-+..
T Consensus        83 lsveLG~t~itlrdLL-----~L~~GDVI~Ldk~~~  113 (155)
T PRK05698         83 ISMEVGSTDINIRNLL-----QLNQGSVIELDRLAG  113 (155)
T ss_pred             EEEEEecCcccHHHHh-----CCCCCCEEEeCCCCC
Confidence            4456677777778776     699999999987654


No 35 
>COG3726 AhpA Uncharacterized membrane protein affecting hemolysin expression [General function prediction only]
Probab=47.10  E-value=18  Score=26.81  Aligned_cols=55  Identities=18%  Similarity=0.204  Sum_probs=32.2

Q ss_pred             eeeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCCCCCCCCCeEEEEeeeeCCCCCCCccE
Q psy2555           5 VSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAGGSHLPDLTVITPVFIDSQPVEEGPV   84 (90)
Q Consensus         5 ~~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~GgtHl~D~~~~~PVF~~Gel~~~~lv   84 (90)
                      +-++|||.+|+++|.+.       +.. -||..   .+          .|-|-.|..-.  .-++-||..++-+     .
T Consensus        88 ldAsIY~~~g~LlA~ag-------~~~-~vR~~---l~----------Ldg~~~g~y~n--qQiVEPI~~~~gi-----~  139 (214)
T COG3726          88 LDASIYDEDGDLLARAG-------SSV-NVRDR---LA----------LDGKTAGLYFN--QQIVEPIAGKNGI-----L  139 (214)
T ss_pred             eeceeecccchhHHhcc-------ccc-chhhh---hh----------cCCCCCccccc--ceeecccccCCCc-----c
Confidence            45789999999998643       111 12222   22          23333332111  4688999988855     8


Q ss_pred             EEE
Q psy2555          85 FFV   87 (90)
Q Consensus        85 ~~~   87 (90)
                      ||+
T Consensus       140 GfL  142 (214)
T COG3726         140 GFL  142 (214)
T ss_pred             eeE
Confidence            886


No 36 
>KOG2030|consensus
Probab=46.69  E-value=26  Score=30.90  Aligned_cols=23  Identities=13%  Similarity=0.332  Sum_probs=16.6

Q ss_pred             HHHHhcCCCCCCCcEEEecCCCCCCCC
Q psy2555          36 FQIDHRKGNFKKGSVILSNHPKAGGSH   62 (90)
Q Consensus        36 ~~~~~~~~~l~~GDv~i~NDPy~GgtH   62 (90)
                      -++++|   |+|||+|++|| ..|.+|
T Consensus       518 llvkky---~~~~DiY~had-~~gaSs  540 (911)
T KOG2030|consen  518 LLVKKY---LEPGDIYVHAD-LHGASS  540 (911)
T ss_pred             HHHHhh---CCCCCeEEecc-cCCCce
Confidence            345555   89999999999 455443


No 37 
>KOG1535|consensus
Probab=46.61  E-value=37  Score=25.28  Aligned_cols=38  Identities=16%  Similarity=0.260  Sum_probs=25.0

Q ss_pred             CceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCCCCCC
Q psy2555          23 IPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAGGSH   62 (90)
Q Consensus        23 ~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~GgtH   62 (90)
                      +-..+......+.++-+.+  .+.||||+++--|-.-|-+
T Consensus       157 T~~mifkip~li~~is~~~--tL~~GDvILTGTP~GVg~v  194 (217)
T KOG1535|consen  157 TSLMIFKIPDLISRLSQIM--TLEPGDVILTGTPEGVGEV  194 (217)
T ss_pred             hhhheecHHHHHHHHhhhe--eecCCCEEEecCCCccccc
Confidence            3344455555555554444  7999999999999864433


No 38 
>TIGR02305 HpaG-N-term 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, N-terminal subunit. This model represents one of two subunits/domains of the bifunctional isomerase/decarboxylase involved in 4-hydroxyphenylacetate degradation. In E. coli and some other species this enzyme is encoded by a single polypeptide containing both this domain and the closely related C-terminal domain (TIGR02303). In other species such as Pasteurella multocida these domains are found as two separate proteins (usually as tandem genes). Together, these domains carry out the decarboxylation of 5-oxopent-3-ene-1,2,5-tricarboxylic acid (OPET) to 2-hydroxy-2,4-diene-1,7-dioate (HHDD) and the subsequent isomerization to 2-oxohept-3-ene-1,7-dioate (OHED).
Probab=46.60  E-value=20  Score=25.49  Aligned_cols=42  Identities=14%  Similarity=0.189  Sum_probs=24.3

Q ss_pred             CCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEEecCCC
Q psy2555          13 DGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPK   57 (90)
Q Consensus        13 ~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy   57 (90)
                      +|+.+.++.+- -.+++....+..+.+.  ..|++||++++=-|=
T Consensus       139 ng~~~~~g~~~-~~~~~~~~li~~ls~~--~~L~aGdvI~TGT~~  180 (205)
T TIGR02305       139 NGKPAQSNNTS-NLVRSAAQLISELSEF--MTLNPGDVLLLGTPE  180 (205)
T ss_pred             CCEEEEeeCHH-HhCcCHHHHHHHHhCC--CCcCCCCEEEeCCCC
Confidence            56655443321 1134444444444432  479999999998864


No 39 
>PRK12764 hypothetical protein; Provisional
Probab=45.56  E-value=16  Score=29.91  Aligned_cols=33  Identities=18%  Similarity=0.290  Sum_probs=20.7

Q ss_pred             HHHHHHhcC--CCCCCCcEEEecCCCCCC-CCCCCe
Q psy2555          34 VKFQIDHRK--GNFKKGSVILSNHPKAGG-SHLPDL   66 (90)
Q Consensus        34 v~~~~~~~~--~~l~~GDv~i~NDPy~Gg-tHl~D~   66 (90)
                      +..+++++.  -.|+|||++++=-|-..+ ....|.
T Consensus       169 v~~LI~~lS~~~tL~pGDvIlTGTp~g~~~l~pGD~  204 (500)
T PRK12764        169 FAQLVADLSQLLTLEEGDVILTGTPAGSSVAAPGDV  204 (500)
T ss_pred             HHHHHHHHhcCCCcCCCCEEEeCCCCCCeecCCCCE
Confidence            344444443  479999999999885322 344443


No 40 
>PF02639 DUF188:  Uncharacterized BCR, YaiI/YqxD family COG1671;  InterPro: IPR003791 This entry describes proteins of unknown function.
Probab=44.54  E-value=16  Score=24.81  Aligned_cols=28  Identities=21%  Similarity=0.380  Sum_probs=17.8

Q ss_pred             eeecchHHHHHHHHHhcCCCCCCCcEEEecC
Q psy2555          25 VHLGSMQEAVKFQIDHRKGNFKKGSVILSNH   55 (90)
Q Consensus        25 ~~~g~~~~~v~~~~~~~~~~l~~GDv~i~ND   55 (90)
                      +.+.+-..++..-+-   ...++||+++|+|
T Consensus        32 i~Vd~g~DaaD~~I~---~~~~~gDiVITqD   59 (130)
T PF02639_consen   32 IVVDSGFDAADFYIV---NHAKPGDIVITQD   59 (130)
T ss_pred             EEECCCCChHHHHHH---HcCCCCCEEEECC
Confidence            344444445433322   4689999999999


No 41 
>PRK13019 clpS ATP-dependent Clp protease adaptor; Reviewed
Probab=43.90  E-value=16  Score=23.61  Aligned_cols=12  Identities=25%  Similarity=0.058  Sum_probs=9.9

Q ss_pred             CcEEEecCCCCC
Q psy2555          48 GSVILSNHPKAG   59 (90)
Q Consensus        48 GDv~i~NDPy~G   59 (90)
                      =-|++.||+|..
T Consensus        22 ykViL~NDd~~t   33 (94)
T PRK13019         22 YKVIVLNDDFNT   33 (94)
T ss_pred             eEEEEEcCCCCC
Confidence            359999999974


No 42 
>TIGR02312 HpaH 2-oxo-hepta-3-ene-1,7-dioic acid hydratase. This model represents the enzyme which hydrates the double bond of 2-oxo-hepta-3-ene-1,7-dioic acid to form 4-hydroxy-2-oxo-heptane-1,7-dioic acid in the catabolism of 4-hydroxyphenylacetic acid. The gene for this enzyme is generally found adjacent to other genes of this pathway in an apparent operon.
Probab=42.33  E-value=30  Score=25.85  Aligned_cols=44  Identities=16%  Similarity=0.209  Sum_probs=26.8

Q ss_pred             CCCCCeeeecCCCceeecchHHHHHHHHHhc---CCCCCCCcEEEecC
Q psy2555          11 GPDGGLVSNAPHIPVHLGSMQEAVKFQIDHR---KGNFKKGSVILSNH   55 (90)
Q Consensus        11 d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~---~~~l~~GDv~i~ND   55 (90)
                      ..+|+.+.++.+-.+ +|....++.++.+++   +..|++||++++=-
T Consensus       193 ~~nG~~~~~g~~~~~-lg~P~~al~wL~~~l~~~G~~L~aGdiV~TGs  239 (267)
T TIGR02312       193 YRNGVVEETGLAAGV-LNHPANGVAWLANKLAPWGETLEAGQVVLAGS  239 (267)
T ss_pred             EECCEEEEEechhhh-cCCHHHHHHHHHHHHHHcCCCCCCCCEEECCC
Confidence            456777666543211 344444555665544   35799999999874


No 43 
>TIGR02219 phage_NlpC_fam putative phage cell wall peptidase, NlpC/P60 family. Members of this family show sequence similarity to members of the NlpC/P60 family described by Pfam model pfam00877 and by Anantharaman and Aravind (PubMed:12620121). The NlpC/P60 family includes a number of characterized bacterial cell wall hydrolases. Members of this related family are all found in prophage regions of bacterial genomes.
Probab=41.83  E-value=34  Score=22.71  Aligned_cols=12  Identities=17%  Similarity=0.307  Sum_probs=10.6

Q ss_pred             CCCCCCcEEEec
Q psy2555          43 GNFKKGSVILSN   54 (90)
Q Consensus        43 ~~l~~GDv~i~N   54 (90)
                      ++++|||+++.+
T Consensus        75 ~~~qpGDlvff~   86 (134)
T TIGR02219        75 DAAQPGDVLVFR   86 (134)
T ss_pred             hcCCCCCEEEEe
Confidence            579999999986


No 44 
>PRK11342 mhpD 2-keto-4-pentenoate hydratase; Provisional
Probab=41.79  E-value=32  Score=25.48  Aligned_cols=44  Identities=18%  Similarity=0.196  Sum_probs=24.7

Q ss_pred             CCCCeeeecCCCceeecchHHHHHHHHHhc---CCCCCCCcEEEecCC
Q psy2555          12 PDGGLVSNAPHIPVHLGSMQEAVKFQIDHR---KGNFKKGSVILSNHP   56 (90)
Q Consensus        12 ~~G~~va~~~g~p~~~g~~~~~v~~~~~~~---~~~l~~GDv~i~NDP   56 (90)
                      .+|+.+.++.+-- .++....++.++.+++   +..|++||++++=-|
T Consensus       187 vng~~~q~g~~~~-~lg~p~~~l~~L~~~l~~~g~~L~aGdvV~TGt~  233 (262)
T PRK11342        187 RNNEEVSSGRGSE-CLGHPLNAAVWLARKMASLGEPLRAGDIILTGAL  233 (262)
T ss_pred             ECCEEEEEEcHHH-hccCHHHHHHHHHHHHHHcCCCcCCCCEEEcCCC
Confidence            3566655443211 1233334444444443   257999999999876


No 45 
>PF02452 PemK:  PemK-like protein;  InterPro: IPR003477 PemK is a growth inhibitor in Escherichia coli known to bind to the promoter region of the Pem operon, auto-regulating synthesis. It is responsible for mediating cell death through inhibiting protein synthesis through the cleavage of single-stranded RNA. PemK is part of the PemK-PemI system, where PemI is an antitoxin that inhibits the action of the PemK toxin []. PemK homologues have been found in a wide range of bacteria, which together form an endonuclease family that interfere with mRNA function. This family consists of the PemK protein in addition to ChpA, ChpB, Kid and MazF.; GO: 0003677 DNA binding; PDB: 1M1F_A 2C06_A 3NFC_F 1UB4_B 1NE8_A.
Probab=40.76  E-value=18  Score=22.23  Aligned_cols=13  Identities=23%  Similarity=0.652  Sum_probs=9.2

Q ss_pred             CCCcEEEecCCCC
Q psy2555          46 KKGSVILSNHPKA   58 (90)
Q Consensus        46 ~~GDv~i~NDPy~   58 (90)
                      ++|||++.+.|..
T Consensus         1 k~GdI~~v~~p~~   13 (110)
T PF02452_consen    1 KRGDIVWVDFPDF   13 (110)
T ss_dssp             STTEEEEEE-S--
T ss_pred             CCceEEEEECCCC
Confidence            6899999999855


No 46 
>PRK15203 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase; Provisional
Probab=40.69  E-value=17  Score=29.11  Aligned_cols=36  Identities=17%  Similarity=0.166  Sum_probs=23.3

Q ss_pred             HHHHHHHhcC--CCCCCCcEEEecCCCCC-CCCCCCeEE
Q psy2555          33 AVKFQIDHRK--GNFKKGSVILSNHPKAG-GSHLPDLTV   68 (90)
Q Consensus        33 ~v~~~~~~~~--~~l~~GDv~i~NDPy~G-gtHl~D~~~   68 (90)
                      .+..++.++.  -+|+|||++++==|=-. -.+..|...
T Consensus       152 ~~~~lis~lS~~~tL~pGDvI~TGTP~g~~~l~~GD~v~  190 (429)
T PRK15203        152 NAAQLLSALSEFATLNPGDAILLGTPQARVEIQPGDRVR  190 (429)
T ss_pred             CHHHHHHHHhCCCCcCCCCEEEcCCCCCceECCCCCEEE
Confidence            3445555544  37999999999998642 245555543


No 47 
>PRK10691 hypothetical protein; Provisional
Probab=40.65  E-value=29  Score=25.12  Aligned_cols=23  Identities=26%  Similarity=0.457  Sum_probs=16.1

Q ss_pred             CCCCCCcEEEecCCCCCC-CCCCC
Q psy2555          43 GNFKKGSVILSNHPKAGG-SHLPD   65 (90)
Q Consensus        43 ~~l~~GDv~i~NDPy~Gg-tHl~D   65 (90)
                      ..|++||++++=-|-..+ ....|
T Consensus       180 ~tL~aGDvI~TGTp~g~~~l~~GD  203 (219)
T PRK10691        180 FTLRAGDVVLTGTPEGVGPLQSGD  203 (219)
T ss_pred             CccCCCCEEEcCCCCCCEECCCCC
Confidence            379999999998875432 34444


No 48 
>PF01052 SpoA:  Surface presentation of antigens (SPOA);  InterPro: IPR001543 Proteins in this group are involved in a secretory pathway responsible for the surface presentation of invasion plasmid antigen needed for the entry of Salmonella and other species into mammalian cells [, ].They could play a role in preserving the translocation competence of the IPA antigens and are required for secretion of the three IPA proteins [].  The C-terminal region of flagellar motor switch proteins FliN and FliM is also included in this entry. ; PDB: 3UEP_A 1O9Y_B 1YAB_A.
Probab=38.36  E-value=19  Score=21.42  Aligned_cols=27  Identities=30%  Similarity=0.411  Sum_probs=15.7

Q ss_pred             ecchHHHHHHHHHhcCCCCCCCcEEEecCCCC
Q psy2555          27 LGSMQEAVKFQIDHRKGNFKKGSVILSNHPKA   58 (90)
Q Consensus        27 ~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~   58 (90)
                      ++.....++.++     +|++||++-.+.|-.
T Consensus        16 l~~~~l~l~el~-----~L~~Gdvi~l~~~~~   42 (77)
T PF01052_consen   16 LGEASLTLGELL-----NLKVGDVIPLDKPAD   42 (77)
T ss_dssp             EEEEEEEHHHHH-----C--TT-EEEECCESS
T ss_pred             EEeeEeEHHHHh-----cCCCCCEEEeCCCCC
Confidence            343344455553     799999999999844


No 49 
>PF01555 N6_N4_Mtase:  DNA methylase;  InterPro: IPR002941 This domain is found in DNA methylases. In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes. This family contains both N-4 cytosine-specific DNA methylases and N-6 Adenine-specific DNA methylases. N-4 cytosine-specific DNA methylases (2.1.1.113 from EC) [] are enzymes that specifically methylate the amino group at the C-4 position of cytosines in DNA. Such enzymes are found as components of type II restriction-modification systems in prokaryotes. Such enzymes recognise a specific sequence in DNA and methylate a cytosine in that sequence. By this action they protect DNA from cleavage by type II restriction enzymes that recognise the same sequence. N-6 adenine-specific DNA methylases (2.1.1.72 from EC) (A-Mtase) are enzymes that specifically methylate the amino group at the C-6 position of adenines in DNA. Such enzymes are found in the three existing types of bacterial restriction-modification systems (in type I system the A-Mtase is the product of the hsdM gene, and in type III it is the product of the mod gene). All of these enzymes recognise a specific sequence in DNA and methylate an adenine in that sequence.; GO: 0003677 DNA binding, 0008170 N-methyltransferase activity, 0006306 DNA methylation; PDB: 2ZIF_A 2ZIE_A 2ZIG_A 1NW6_A 1NW8_A 1NW7_A 1NW5_A 1EG2_A 1BOO_A 1G60_B ....
Probab=38.34  E-value=38  Score=22.93  Aligned_cols=31  Identities=23%  Similarity=0.336  Sum_probs=16.5

Q ss_pred             eeecchHH-HHHHHHHhcCCCCCCCcEEEecCCCCCC
Q psy2555          25 VHLGSMQE-AVKFQIDHRKGNFKKGSVILSNHPKAGG   60 (90)
Q Consensus        25 ~~~g~~~~-~v~~~~~~~~~~l~~GDv~i~NDPy~Gg   60 (90)
                      .|-...+. .++.+++.+.   .|||+++  |||.|+
T Consensus       171 ~h~~~kP~~l~~~lI~~~t---~~gdiVl--DpF~GS  202 (231)
T PF01555_consen  171 KHPTQKPVELIERLIKAST---NPGDIVL--DPFAGS  202 (231)
T ss_dssp             --TT-S-HHHHHHHHHHHS----TT-EEE--ETT-TT
T ss_pred             ceeecCCHHHHHHHHHhhh---ccceeee--hhhhcc
Confidence            34444333 4477777663   6799987  999874


No 50 
>PF02814 UreE_N:  UreE urease accessory protein, N-terminal domain;  InterPro: IPR004029 Urease and other nickel metalloenzymes are synthesised as precursors devoid of the metalloenzyme active site. These precursors then undergo a complex post-translational maturation process that requires a number of accessory proteins. Members of this group are nickel-binding proteins required for urease metallocentre assembly []. They are believed to function as metallochaperones to deliver nickel to urease apoprotein [, ]. It has been shown by yeast two-hybrid analysis that UreE forms a dimeric complex with UreG in Helicobacter pylori []. The UreDFG-apoenzyme complex has also been shown to exist [, ] and is believed to be, with the addition of UreE, the assembly system for active urease []. The complexes, rather than the individual proteins, presumably bind to UreB via UreE/H recognition sites. The structure of Klebsiella aerogenes UreE reveals a unique two-domain architecture.The N-terminal domain is structurally related to a heat shock protein, while the C-terminal domain shows homology to the Atx1 copper metallochaperone [, ]. Significantly, the metal-binding sites in UreE and Atx1 are distinct in location and types of residues despite the relationship between these proteins and the mechanism for UreE activation of urease is proposed to be different from the thiol ligand exchange mechanism used by the copper metallochaperones. The N-terminal domain is termed the peptide-binding domain. Deletion of this domain does not eliminate enzymatic activity, and the truncated protein can still activate urease [].; GO: 0016151 nickel ion binding, 0006461 protein complex assembly, 0019627 urea metabolic process; PDB: 3NXZ_B 3TJA_B 3LA0_B 3TJ9_B 3NY0_A 3L9Z_A 3TJ8_A 1EAR_A 1EB0_A 1GMU_B ....
Probab=37.58  E-value=22  Score=20.88  Aligned_cols=12  Identities=17%  Similarity=0.468  Sum_probs=8.5

Q ss_pred             CCCCCcEEEecC
Q psy2555          44 NFKKGSVILSNH   55 (90)
Q Consensus        44 ~l~~GDv~i~ND   55 (90)
                      .|++||++...|
T Consensus        50 ~L~~GDvL~~d~   61 (65)
T PF02814_consen   50 VLRDGDVLYLDD   61 (65)
T ss_dssp             T--TTEEEEECT
T ss_pred             ccCCCCEEEeCC
Confidence            499999999876


No 51 
>smart00702 P4Hc Prolyl 4-hydroxylase alpha subunit homologues. Mammalian enzymes catalyse hydroxylation of collagen, for example. Prokaryotic enzymes might catalyse hydroxylation of antibiotic peptides. These are 2-oxoglutarate-dependent dioxygenases, requiring 2-oxoglutarate and dioxygen as cosubstrates and ferrous iron as a cofactor.
Probab=37.45  E-value=33  Score=23.23  Aligned_cols=27  Identities=22%  Similarity=0.450  Sum_probs=16.4

Q ss_pred             EEEecCCCCCC-CCCCCeE-----EEEeeeeCCCC
Q psy2555          50 VILSNHPKAGG-SHLPDLT-----VITPVFIDSQP   78 (90)
Q Consensus        50 v~i~NDPy~Gg-tHl~D~~-----~~~PVF~~Gel   78 (90)
                      ++.+||++.|| +..++..     .++|.  .|.+
T Consensus       116 ~~yLn~~~~GG~~~f~~~~~~~~~~v~P~--~G~~  148 (178)
T smart00702      116 LLYLNDVEEGGELVFPGLGLMVCATVKPK--KGDL  148 (178)
T ss_pred             EEEeccCCcCceEEecCCCCccceEEeCC--CCcE
Confidence            45678999877 5555443     45663  4554


No 52 
>PF10948 DUF2635:  Protein of unknown function (DUF2635);  InterPro: IPR024400 This family consists of uncharacterised proteins found in bacteria and bacteriophages. It includes protein Gp38 from Enterobacteria phage Mu.
Probab=37.03  E-value=23  Score=20.14  Aligned_cols=13  Identities=15%  Similarity=0.284  Sum_probs=10.6

Q ss_pred             CCCCCcEEEecCC
Q psy2555          44 NFKKGSVILSNHP   56 (90)
Q Consensus        44 ~l~~GDv~i~NDP   56 (90)
                      -+++|||++.+-+
T Consensus        34 Rl~dGDV~~v~~~   46 (47)
T PF10948_consen   34 RLADGDVVEVTPK   46 (47)
T ss_pred             hhhcCCEEEecCC
Confidence            4899999998754


No 53 
>PRK00033 clpS ATP-dependent Clp protease adaptor protein ClpS; Reviewed
Probab=36.52  E-value=24  Score=23.03  Aligned_cols=11  Identities=27%  Similarity=0.320  Sum_probs=9.3

Q ss_pred             cEEEecCCCCC
Q psy2555          49 SVILSNHPKAG   59 (90)
Q Consensus        49 Dv~i~NDPy~G   59 (90)
                      =|++.||+|..
T Consensus        29 ~ViL~NDd~nt   39 (100)
T PRK00033         29 KVLLHNDDYTP   39 (100)
T ss_pred             EEEEEcCCCCC
Confidence            48999999974


No 54 
>PRK07963 fliN flagellar motor switch protein FliN; Validated
Probab=35.88  E-value=43  Score=23.05  Aligned_cols=31  Identities=23%  Similarity=0.374  Sum_probs=23.5

Q ss_pred             CceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCC
Q psy2555          23 IPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKA   58 (90)
Q Consensus        23 ~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~   58 (90)
                      +.+-+|.....++.++     +|++|||+-++-+..
T Consensus        64 lsveLG~t~itlrdLL-----~L~~GDVI~Ld~~~~   94 (137)
T PRK07963         64 LTVELGRTRMTIKELL-----RLTQGSVVALDGLAG   94 (137)
T ss_pred             EEEEEecccccHHHHh-----CCCCCCEEEeCCCCC
Confidence            3455677777777776     699999999987654


No 55 
>COG4043 Preprotein translocase subunit Sec61beta [Intracellular    trafficking, secretion, and vesicular transport]
Probab=35.83  E-value=28  Score=23.30  Aligned_cols=11  Identities=36%  Similarity=0.531  Sum_probs=10.4

Q ss_pred             CCCCCcEEEec
Q psy2555          44 NFKKGSVILSN   54 (90)
Q Consensus        44 ~l~~GDv~i~N   54 (90)
                      .++|||.++.|
T Consensus        33 ~ik~GD~IiF~   43 (111)
T COG4043          33 QIKPGDKIIFN   43 (111)
T ss_pred             CCCCCCEEEEc
Confidence            69999999999


No 56 
>TIGR03218 catechol_dmpH 4-oxalocrotonate decarboxylase. Members of this protein family are 4-oxalocrotonate decarboxylase. Note that this protein, as characterized (indirectly) in Pseudomonas sp. strain CF600, was inactive except when coexpressed with DmpE, 2-oxopent-4-enoate hydratase, a homologous protein from the same operon. Both of these enzymes are active in the degradation of catechol, a common intermediate in the degradation of aromatic compounds such as benzoate, toluene, phenol, dimethylphenol (dmp), salicylate, etc.
Probab=35.54  E-value=53  Score=24.43  Aligned_cols=48  Identities=25%  Similarity=0.324  Sum_probs=28.2

Q ss_pred             eCCCCCeeeecCCCceeecchHHHHHHHHHhc---CCCCCCCcEEEecCCCCC
Q psy2555          10 FGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHR---KGNFKKGSVILSNHPKAG   59 (90)
Q Consensus        10 ~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~---~~~l~~GDv~i~NDPy~G   59 (90)
                      +..+|+.+.++.|-.+ +|.-..++.+++++.   +..+++||++++- .|.+
T Consensus       189 l~~~g~~v~~g~g~~~-lG~P~~al~wL~~~l~~~G~~L~aG~iV~tG-s~t~  239 (263)
T TIGR03218       189 MEKNGEVVAMGAGAAV-LGHPAAAVAMLANHLAERGEEIPAGSFIMSG-GITE  239 (263)
T ss_pred             EEECCEEEEeeccccc-CCCHHHHHHHHHHHHHHcCCCCCCCCEEECC-cCcC
Confidence            3457777766544211 243344555555544   3579999999986 3443


No 57 
>PF00877 NLPC_P60:  NlpC/P60 family;  InterPro: IPR000064 The Escherichia coli NLPC/Listeria P60 domain occurs at the C terminus of a number of different bacterial and viral proteins. The viral proteins are either described as tail assembly proteins or Gp19. In bacteria, the proteins are variously described as being putative tail component of prophage, invasin, invasion associated protein, putative lipoprotein, cell wall hydrolase, or putative endopeptidase.  The E. coli NLPC/Listeria P60 domain is contained within the boundaries of the cysteine peptidase domain that defines the MEROPS peptidase family C40 (clan C-). A type example being dipeptidyl-peptidase VI from Bacillus sphaericus and gamma-glutamyl-diamino acid-endopeptidase precursor from Lactococcus lactis 3.4.19.11 from EC. This group also contains proteins classified as non-peptidase homologues in that they either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity of peptidases in the C40 family. ; PDB: 3PVQ_B 3GT2_A 3NPF_B 2K1G_A 3I86_A 3S0Q_A 2XIV_A 3PBC_A 3NE0_A 3M1U_B ....
Probab=35.53  E-value=9.3  Score=23.85  Aligned_cols=13  Identities=15%  Similarity=0.404  Sum_probs=10.9

Q ss_pred             CCCCCCcEEEecC
Q psy2555          43 GNFKKGSVILSNH   55 (90)
Q Consensus        43 ~~l~~GDv~i~ND   55 (90)
                      .+++|||+++...
T Consensus        50 ~~~~pGDlif~~~   62 (105)
T PF00877_consen   50 SELQPGDLIFFKG   62 (105)
T ss_dssp             GG-TTTEEEEEEG
T ss_pred             hcCCcccEEEEeC
Confidence            5799999999988


No 58 
>PF14827 Cache_3:  Sensory domain of two-component sensor kinase; PDB: 1OJG_A 3BY8_A 1P0Z_I 2V9A_A 2J80_B.
Probab=35.17  E-value=48  Score=21.09  Aligned_cols=64  Identities=22%  Similarity=0.319  Sum_probs=36.9

Q ss_pred             eEEeCCCCCeeeecCCCceeecchHH--HHHHHHHhcCCCCCCCcEEEecCCCCCCCCCCCeEEEEeee-eCCCCCCCcc
Q psy2555           7 KESFGPDGGLVSNAPHIPVHLGSMQE--AVKFQIDHRKGNFKKGSVILSNHPKAGGSHLPDLTVITPVF-IDSQPVEEGP   83 (90)
Q Consensus         7 ~~i~d~~G~~va~~~g~p~~~g~~~~--~v~~~~~~~~~~l~~GDv~i~NDPy~GgtHl~D~~~~~PVF-~~Gel~~~~l   83 (90)
                      ..|.|++|..++.+  -|-.+|..-.  .++.       -| .|--+..-.+..+   -+=+..+.||+ .+|++     
T Consensus        42 i~v~D~~g~~l~~s--~~~~iG~~~~~~~~~~-------aL-~G~~~~~~~~~~~---~~~~~~~~PV~d~~g~v-----  103 (116)
T PF14827_consen   42 IVVTDRDGIVLAHS--DPERIGDRYSDEDVRK-------AL-QGKSYTSVSQGTG---GPSLRAFAPVYDSDGKV-----  103 (116)
T ss_dssp             EEEECTTSBECE-S--SCCCTTSB-SSCCHCH-------HC-CT--EEEEEECTT---CEEEEEEEEEE-TTS-E-----
T ss_pred             EEEEcCCCCEEEcC--ChHHcCCcccCCChhh-------hh-cCCceEEeeecCC---ceEEEEEEeeECCCCcE-----
Confidence            35899999998865  3434443111  1111       23 4444555444444   45678999999 89987     


Q ss_pred             EEEEE
Q psy2555          84 VFFVA   88 (90)
Q Consensus        84 v~~~a   88 (90)
                      +|++.
T Consensus       104 iG~V~  108 (116)
T PF14827_consen  104 IGVVS  108 (116)
T ss_dssp             EEEEE
T ss_pred             EEEEE
Confidence            99875


No 59 
>PRK00124 hypothetical protein; Validated
Probab=35.08  E-value=26  Score=24.50  Aligned_cols=13  Identities=15%  Similarity=0.432  Sum_probs=11.5

Q ss_pred             CCCCCCcEEEecC
Q psy2555          43 GNFKKGSVILSNH   55 (90)
Q Consensus        43 ~~l~~GDv~i~ND   55 (90)
                      ...++||+++|+|
T Consensus        63 ~~~~~gDiVIT~D   75 (151)
T PRK00124         63 QLAEKGDIVITQD   75 (151)
T ss_pred             HhCCCCCEEEeCC
Confidence            3589999999999


No 60 
>PRK11524 putative methyltransferase; Provisional
Probab=35.01  E-value=26  Score=25.98  Aligned_cols=22  Identities=32%  Similarity=0.465  Sum_probs=16.2

Q ss_pred             HHHHHHhcCCCCCCCcEEEecCCCCCC
Q psy2555          34 VKFQIDHRKGNFKKGSVILSNHPKAGG   60 (90)
Q Consensus        34 v~~~~~~~~~~l~~GDv~i~NDPy~Gg   60 (90)
                      ++.+++.+.   .|||+++  |||.|+
T Consensus       198 ~erlI~~~S---~~GD~VL--DPF~GS  219 (284)
T PRK11524        198 LKRIILASS---NPGDIVL--DPFAGS  219 (284)
T ss_pred             HHHHHHHhC---CCCCEEE--ECCCCC
Confidence            356665553   7999998  999874


No 61 
>PF04968 CHORD:  CHORD ;  InterPro: IPR007051  Cysteine- and histidine-rich domains (CHORDs) are 60-amino acid modules that bind two zinc ions. They are usually arranged in tandem and are found in all tested eukaryotes, with the exception of yeast, where they are involved in processes ranging from pressure sensing in the heart to maintenance of diploidy in fungi, and exhibit distinct protein-protein interaction specificity. Six cysteine and two histidine residues are invariant within the CHORD domain. Three other residues are also invariant and some positions are confined to positive, negative, or aromatic amino acids [, ].   Silencing of the Caenorhabditis elegansCHORD-containing gene results in semisterility and embryo lethality, suggesting an essential function of the wild-type gene in nematode development. The CHORD domain is sometimes found N-terminal to the CS domain, IPR007052 from INTERPRO, in metazoan proteins, but occurs separately from the CS domain in plants. This association is thought to be indicative of an functional interaction between CS and CHORD domains []. ; PDB: 2XCM_E 2YRT_A.
Probab=34.15  E-value=23  Score=21.42  Aligned_cols=8  Identities=38%  Similarity=0.750  Sum_probs=6.0

Q ss_pred             EeeeeCCC
Q psy2555          70 TPVFIDSQ   77 (90)
Q Consensus        70 ~PVF~~Ge   77 (90)
                      .||||||.
T Consensus        29 ~PvFHeg~   36 (64)
T PF04968_consen   29 PPVFHEGM   36 (64)
T ss_dssp             -EEEETTE
T ss_pred             CceecCCc
Confidence            69999983


No 62 
>PF11213 DUF3006:  Protein of unknown function (DUF3006);  InterPro: IPR021377  This family of proteins has no known function. 
Probab=33.70  E-value=47  Score=19.89  Aligned_cols=13  Identities=23%  Similarity=0.197  Sum_probs=11.0

Q ss_pred             cCCCCCCCcEEEe
Q psy2555          41 RKGNFKKGSVILS   53 (90)
Q Consensus        41 ~~~~l~~GDv~i~   53 (90)
                      ++.+.++|||+..
T Consensus        30 LP~~~keGDvl~i   42 (71)
T PF11213_consen   30 LPEGAKEGDVLEI   42 (71)
T ss_pred             CCCCCCcccEEEE
Confidence            4578999999977


No 63 
>PF13550 Phage-tail_3:  Putative phage tail protein
Probab=33.60  E-value=27  Score=22.90  Aligned_cols=13  Identities=23%  Similarity=0.363  Sum_probs=12.3

Q ss_pred             CCCCCcEEEecCC
Q psy2555          44 NFKKGSVILSNHP   56 (90)
Q Consensus        44 ~l~~GDv~i~NDP   56 (90)
                      .++|||++-.++|
T Consensus       139 ~l~pGDvi~l~~~  151 (164)
T PF13550_consen  139 ALEPGDVIALSDD  151 (164)
T ss_pred             cCCCCCEEEEEeC
Confidence            6899999999999


No 64 
>TIGR00113 queA S-adenosylmethionine:tRNA ribosyltransferase-isomerase. This model describes the enzyme for S-adenosylmethionine:tRNA ribosyltransferase-isomerase (QueA). QueA synthesizes Queuosine which is usually in the first position of the anticodon of tRNAs specific for asparagine, aspartate, histidine, and tyrosine.
Probab=33.45  E-value=25  Score=27.73  Aligned_cols=15  Identities=27%  Similarity=0.572  Sum_probs=12.9

Q ss_pred             CCCCCCcEEEecCCC
Q psy2555          43 GNFKKGSVILSNHPK   57 (90)
Q Consensus        43 ~~l~~GDv~i~NDPy   57 (90)
                      +=++|||+++.||-.
T Consensus        47 ~~l~~gDlLV~NdTk   61 (344)
T TIGR00113        47 DFFNEGDLLVLNNTK   61 (344)
T ss_pred             hhcCCCCEEEEeCcE
Confidence            458999999999965


No 65 
>PTZ00414 10 kDa heat shock protein; Provisional
Probab=32.41  E-value=45  Score=21.80  Aligned_cols=17  Identities=24%  Similarity=0.321  Sum_probs=13.5

Q ss_pred             CCCCCCcEEEecCCCCCC
Q psy2555          43 GNFKKGSVILSNHPKAGG   60 (90)
Q Consensus        43 ~~l~~GDv~i~NDPy~Gg   60 (90)
                      ..+++||.++.+. |.|.
T Consensus        61 ~~Vk~GD~Vl~~~-y~Gt   77 (100)
T PTZ00414         61 PTVKVGDTVLLPE-FGGS   77 (100)
T ss_pred             ceecCCCEEEEcC-CCCc
Confidence            4699999999865 8763


No 66 
>COG0309 HypE Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=32.22  E-value=52  Score=26.04  Aligned_cols=30  Identities=20%  Similarity=0.366  Sum_probs=20.8

Q ss_pred             CCCCcEEEecCCCCCCCCCCCeEEEEeeeeCCCCCCCccEEEEEe
Q psy2555          45 FKKGSVILSNHPKAGGSHLPDLTVITPVFIDSQPVEEGPVFFVAN   89 (90)
Q Consensus        45 l~~GDv~i~NDPy~GgtHl~D~~~~~PVF~~Gel~~~~lv~~~a~   89 (90)
                      +.++.+.++-|||.          +.|+|..|+.     +||.|.
T Consensus        46 l~~~~la~tTD~~~----------i~P~ff~~~d-----iG~lAV   75 (339)
T COG0309          46 LGDGVLAFTTDPFV----------IDPLFFPGGD-----IGKLAV   75 (339)
T ss_pred             cCCceEEEEeCCeE----------ecccccCCCc-----eEEEEE
Confidence            44445777778775          5778877766     898763


No 67 
>PRK00147 queA S-adenosylmethionine:tRNA ribosyltransferase-isomerase; Provisional
Probab=32.03  E-value=28  Score=27.50  Aligned_cols=15  Identities=13%  Similarity=0.414  Sum_probs=12.9

Q ss_pred             CCCCCCcEEEecCCC
Q psy2555          43 GNFKKGSVILSNHPK   57 (90)
Q Consensus        43 ~~l~~GDv~i~NDPy   57 (90)
                      +=++|||+++.||-.
T Consensus        48 ~~l~~gDlLV~NdTk   62 (342)
T PRK00147         48 DYLNPGDLLVFNDTR   62 (342)
T ss_pred             hhcCCCCEEEEEcCe
Confidence            458999999999965


No 68 
>KOG2183|consensus
Probab=31.94  E-value=21  Score=29.46  Aligned_cols=41  Identities=20%  Similarity=0.228  Sum_probs=26.7

Q ss_pred             ecchHHHHHHHHHhcCCCCCC--------C-------cEEEec---CCCCCCCCCCCeE
Q psy2555          27 LGSMQEAVKFQIDHRKGNFKK--------G-------SVILSN---HPKAGGSHLPDLT   67 (90)
Q Consensus        27 ~g~~~~~v~~~~~~~~~~l~~--------G-------Dv~i~N---DPy~GgtHl~D~~   67 (90)
                      -..+..-.+.+++.|+-..+|        |       -+++.|   |||+||.++.|+.
T Consensus       380 ~fn~~~y~e~C~~~~~v~prP~wi~t~fgg~~l~~~SNiIFSNG~LDPWSGGGV~~nis  438 (492)
T KOG2183|consen  380 PFNSESYQEGCMQTFGVTPRPKWITTEFGGADLSAFSNIIFSNGLLDPWSGGGVLKNIS  438 (492)
T ss_pred             CCCHHHHHHHHHHhcCCCCCCcceehhhccccchhhcceeeeCCCcCCccCcCeecccc
Confidence            334566667777777522222        2       567776   9999998887763


No 69 
>cd06530 S26_SPase_I The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3.4.21.89) family members are essential membrane-bound serine proteases that function to cleave the amino-terminal signal peptide extension from proteins that are translocated across biological membranes. The bacterial signal peptidase I, which is the most intensively studied, has two N-terminal transmembrane segments inserted in the plasma membrane and a hydrophilic, C-terminal catalytic region that is located in the periplasmic space. Although the bacterial signal peptidase I is monomeric, signal peptidases of eukaryotic cells commonly function as oligomeric complexes containing two divergent copies of the catalytic monomer. These are the IMP1 and IMP2 signal peptidases of the mitochondrial inner membrane that remove leader peptides from nuclear- and mitochondrial-encoded proteins. Also, two components of the endoplasmic reticulum signal peptidase in mammals (18-kDa and 21-kDa
Probab=31.76  E-value=69  Score=18.89  Aligned_cols=11  Identities=27%  Similarity=0.673  Sum_probs=5.9

Q ss_pred             CCCCCcEEEec
Q psy2555          44 NFKKGSVILSN   54 (90)
Q Consensus        44 ~l~~GDv~i~N   54 (90)
                      .+++||+++.+
T Consensus        13 ~i~~gd~v~v~   23 (85)
T cd06530          13 TLQPGDLVLVN   23 (85)
T ss_pred             cccCCCEEEEE
Confidence            35555555554


No 70 
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes an
Probab=31.18  E-value=1.2e+02  Score=21.26  Aligned_cols=52  Identities=21%  Similarity=0.245  Sum_probs=29.9

Q ss_pred             eeEEeCCCCCeeeecCCCceeecc-hHHH---HHHH--HHhcC----CCCCCCcEEEecCCCC
Q psy2555           6 SKESFGPDGGLVSNAPHIPVHLGS-MQEA---VKFQ--IDHRK----GNFKKGSVILSNHPKA   58 (90)
Q Consensus         6 ~~~i~d~~G~~va~~~g~p~~~g~-~~~~---v~~~--~~~~~----~~l~~GDv~i~NDPy~   58 (90)
                      ++-|.|++|++.....+ |...|. ....   ++.+  .++.+    .+|+|||-.+...|-.
T Consensus       119 ~~fiID~~G~I~~~~~~-~~~~gr~~~ell~~l~~lq~~~~~~~~~p~~w~~g~~~~~~~~~~  180 (203)
T cd03016         119 AVFIIDPDKKIRLILYY-PATTGRNFDEILRVVDALQLTDKHKVATPANWKPGDDVIVPPSVS  180 (203)
T ss_pred             EEEEECCCCeEEEEEec-CCCCCCCHHHHHHHHHHHhhHhhcCcCcCCCCCCCCceecCCCCC
Confidence            46788999987765322 223332 2222   2221  11122    4899999998887765


No 71 
>PLN02856 fumarylacetoacetase
Probab=30.94  E-value=29  Score=28.15  Aligned_cols=28  Identities=18%  Similarity=0.232  Sum_probs=18.8

Q ss_pred             hHHHHHHHHHhc-C--CCCCCCcEEEecCCC
Q psy2555          30 MQEAVKFQIDHR-K--GNFKKGSVILSNHPK   57 (90)
Q Consensus        30 ~~~~v~~~~~~~-~--~~l~~GDv~i~NDPy   57 (90)
                      |...+..++.++ .  -+|+|||++.+==|=
T Consensus       329 M~ws~~qlIah~~s~g~tL~pGDLi~TGTps  359 (424)
T PLN02856        329 LYWTLAQQLAHHTVNGCNLRPGDLLGSGTIS  359 (424)
T ss_pred             cCCCHHHHHHHHHhCCeecCCCCEEEeCCCC
Confidence            344445555542 1  489999999998884


No 72 
>cd04474 RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds corresponding to the second OB fold, the ssDNA-binding domain (DBD)-A, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-A, RPA1 contains three other OB folds: DBD-B, DBD-C, and RPA1N. The major DNA binding activity of human RPA (hRPA) and Saccharomyces cerevisiae RPA (ScRPA) is associated with DBD-A and DBD-B of RPA1. RPA1 DBD-C is involved in trimerization. The ssDNA-binding mechanism is believed to be multistep and to involve conformational change. Although ScRPA and the hRPA have similar ssDNA-binding properties, they differ funct
Probab=30.92  E-value=98  Score=19.52  Aligned_cols=38  Identities=18%  Similarity=0.194  Sum_probs=21.7

Q ss_pred             eeeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEEec
Q psy2555           5 VSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSN   54 (90)
Q Consensus         5 ~~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~N   54 (90)
                      |..-|.|.+|..+.        +-...    ..+++|.+.|++|+|+...
T Consensus        37 ~~~~l~De~~~~I~--------~t~~~----~~~~~f~~~l~eG~vy~i~   74 (104)
T cd04474          37 FSFDLLDEDGGEIR--------ATFFN----DAVDKFYDLLEVGKVYYIS   74 (104)
T ss_pred             EEEEEEECCCCEEE--------EEEeh----HHHHHhhcccccccEEEEe
Confidence            45556676555442        21122    3344455679999998753


No 73 
>PF13651 EcoRI_methylase:  Adenine-specific methyltransferase EcoRI
Probab=30.83  E-value=25  Score=27.79  Aligned_cols=15  Identities=20%  Similarity=0.459  Sum_probs=13.2

Q ss_pred             CCCCcEEEecCCCCC
Q psy2555          45 FKKGSVILSNHPKAG   59 (90)
Q Consensus        45 l~~GDv~i~NDPy~G   59 (90)
                      +++.||++||=||+-
T Consensus       133 l~eADIVVTNPPFSL  147 (336)
T PF13651_consen  133 LKEADIVVTNPPFSL  147 (336)
T ss_pred             HhcCCEEEeCCCcHH
Confidence            578999999999973


No 74 
>COG0809 QueA S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) [Translation, ribosomal structure and biogenesis]
Probab=30.75  E-value=30  Score=27.48  Aligned_cols=15  Identities=13%  Similarity=0.414  Sum_probs=12.8

Q ss_pred             CCCCCCcEEEecCCC
Q psy2555          43 GNFKKGSVILSNHPK   57 (90)
Q Consensus        43 ~~l~~GDv~i~NDPy   57 (90)
                      +-|+|||+++.||--
T Consensus        48 dyl~~GD~LVfNdTr   62 (348)
T COG0809          48 DYLNPGDLLVFNDTR   62 (348)
T ss_pred             hhcCCCCEEEEecCe
Confidence            458999999999954


No 75 
>TIGR02228 sigpep_I_arch signal peptidase I, archaeal type. This model represents signal peptidase I from most archaea, a subunit of the eukaryotic endoplasmic reticulum signal peptidase I complex, and an apparent signal peptidase I from a small number of bacteria. It is related to but does not overlap in hits with TIGR02227, the bacterial and mitochondrial signal peptidase I.
Probab=30.67  E-value=97  Score=21.43  Aligned_cols=27  Identities=19%  Similarity=0.370  Sum_probs=13.5

Q ss_pred             CCCCCcEEEecCCCCCCCCCCCeEEEE
Q psy2555          44 NFKKGSVILSNHPKAGGSHLPDLTVIT   70 (90)
Q Consensus        44 ~l~~GDv~i~NDPy~GgtHl~D~~~~~   70 (90)
                      .+++||.++.+-.........|+.+++
T Consensus        44 tl~~GD~vlv~~~~~~~~~~GDIVvf~   70 (158)
T TIGR02228        44 TFNTGDLILVTGADPNDIQVGDVITYK   70 (158)
T ss_pred             CccCCCEEEEEecccCCCCCCCEEEEE
Confidence            456666666654111234445555554


No 76 
>PRK10838 spr outer membrane lipoprotein; Provisional
Probab=30.25  E-value=47  Score=23.94  Aligned_cols=13  Identities=15%  Similarity=0.480  Sum_probs=10.6

Q ss_pred             CCCCCCcEEEecC
Q psy2555          43 GNFKKGSVILSNH   55 (90)
Q Consensus        43 ~~l~~GDv~i~ND   55 (90)
                      .+++|||+++...
T Consensus       127 ~~lqpGDLVfF~~  139 (190)
T PRK10838        127 SKLRTGDLVLFRA  139 (190)
T ss_pred             CCCCCCcEEEECC
Confidence            4799999998763


No 77 
>PF13180 PDZ_2:  PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C ....
Probab=30.19  E-value=30  Score=20.47  Aligned_cols=34  Identities=26%  Similarity=0.409  Sum_probs=18.1

Q ss_pred             CCCCCcEEEecC--CCCC--------CCCCCCeEEEEeeeeCCC
Q psy2555          44 NFKKGSVILSNH--PKAG--------GSHLPDLTVITPVFIDSQ   77 (90)
Q Consensus        44 ~l~~GDv~i~ND--Py~G--------gtHl~D~~~~~PVF~~Ge   77 (90)
                      +|++||+++.=|  |-..        ..+.++-++-.=|..+|+
T Consensus        31 Gl~~GD~I~~ing~~v~~~~~~~~~l~~~~~g~~v~l~v~R~g~   74 (82)
T PF13180_consen   31 GLQPGDIILAINGKPVNSSEDLVNILSKGKPGDTVTLTVLRDGE   74 (82)
T ss_dssp             TS-TTEEEEEETTEESSSHHHHHHHHHCSSTTSEEEEEEEETTE
T ss_pred             CCCCCcEEEEECCEEcCCHHHHHHHHHhCCCCCEEEEEEEECCE
Confidence            699999998522  1111        145555555555555554


No 78 
>PRK01424 S-adenosylmethionine:tRNA ribosyltransferase-isomerase; Provisional
Probab=30.16  E-value=31  Score=27.54  Aligned_cols=18  Identities=22%  Similarity=0.392  Sum_probs=14.1

Q ss_pred             hcCCCCCCCcEEEecCCC
Q psy2555          40 HRKGNFKKGSVILSNHPK   57 (90)
Q Consensus        40 ~~~~~l~~GDv~i~NDPy   57 (90)
                      .+.+=++|||+++.||-.
T Consensus        42 dl~~~L~~GDlLV~NdTk   59 (366)
T PRK01424         42 NIIDYLKEGDLLVFNNSK   59 (366)
T ss_pred             HHHhhcCCCCEEEEeccE
Confidence            333458999999999965


No 79 
>PRK06933 type III secretion system protein; Validated
Probab=29.90  E-value=82  Score=24.41  Aligned_cols=46  Identities=17%  Similarity=0.129  Sum_probs=28.7

Q ss_pred             ecchHHHHHHHHHhcCCCCCCCcEEEecCCCCCC--CCCCCeEEEE--eeeeCCC
Q psy2555          27 LGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAGG--SHLPDLTVIT--PVFIDSQ   77 (90)
Q Consensus        27 ~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~Gg--tHl~D~~~~~--PVF~~Ge   77 (90)
                      +|.....++.++     +|++|||+-.|-+..+.  ...++..+.+  ++-.+|+
T Consensus       245 LG~~~ltl~eLl-----~L~~GdVi~L~~~~~~~V~I~vng~~i~~Gelv~v~~~  294 (308)
T PRK06933        245 VGRQTLDLHTLT-----SLQPGSLIDLTTPVDGEVRLLANGRLLGHGRLVEIQGR  294 (308)
T ss_pred             EecccccHHHHh-----cCCCCCEEEcCCCCCCCEEEEECCEEEEEEEEEEECCE
Confidence            444444555543     79999999999887653  4555554443  4444554


No 80 
>PF02938 GAD:  GAD domain;  InterPro: IPR004115 This entry represetns an 2 layer alpha/beta insertion domain found in some glutamyl-tRNA amidotransferases and aspartyl tRNA synthetases [, ]. The function of this domain is not yet known.; GO: 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding, 0005737 cytoplasm; PDB: 1ZQ1_D 1EQR_B 1IL2_B 1C0A_A 1L0W_A 1G51_B 1EFW_B 2D6F_D.
Probab=29.83  E-value=75  Score=19.81  Aligned_cols=20  Identities=30%  Similarity=0.466  Sum_probs=12.1

Q ss_pred             HHHHHHHHHhcCCCCCCCcEEE
Q psy2555          31 QEAVKFQIDHRKGNFKKGSVIL   52 (90)
Q Consensus        31 ~~~v~~~~~~~~~~l~~GDv~i   52 (90)
                      ..-.+.+++++  ++++||+++
T Consensus        63 e~~~~~l~~~~--~a~~GD~ll   82 (95)
T PF02938_consen   63 EEELKALIERL--GAKPGDLLL   82 (95)
T ss_dssp             HHHHHHHHHHT--T--TTEEEE
T ss_pred             HHHHHHHHHHh--CCCCCCEEE
Confidence            34456666666  699999965


No 81 
>PF02547 Queuosine_synth:  Queuosine biosynthesis protein;  InterPro: IPR003699 This entry represents the queuosine biosynthesis proteins QueA. Queuosine is a hypermodified nucleoside that usually occurs in the first position of the anticodon of tRNAs specifying the amino acids asparagine, aspartate, histidine, and tyrosine. The hypermodified nucleoside is found in bacteria and eukaryotes []. Queuosine is synthesized de novo exclusively in bacteria; for eukaryotes the compound is a nutrient factor. Queuosine biosynthesis protein, or S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (QueA) catalyses the formation of the 2,3-epoxy-4,5-dihydroxycyclopentane ring of the Q precursor epoxyqueuosine (oQ). S-adenosyl-L-methionine (AdoMet) reacts with 7-aminomethyl-7-deazaguanine of tRNA at position 34 to yield adenine, methionine, and a modified tRNA with oQ at position 34.  QueA consists of two domains: domain 1 has 3 layers alpha/beta/alpha, while domain 2 is a closed beta-barrel with Greek-key topology [].; GO: 0016740 transferase activity, 0016853 isomerase activity, 0008616 queuosine biosynthetic process; PDB: 1WDI_A 1VKY_B 1YY3_A.
Probab=29.58  E-value=24  Score=27.83  Aligned_cols=15  Identities=20%  Similarity=0.468  Sum_probs=10.9

Q ss_pred             CCCCCCcEEEecCCC
Q psy2555          43 GNFKKGSVILSNHPK   57 (90)
Q Consensus        43 ~~l~~GDv~i~NDPy   57 (90)
                      +=|+|||+++.||-.
T Consensus        47 ~~L~~GDlLV~NdTk   61 (341)
T PF02547_consen   47 DYLRPGDLLVFNDTK   61 (341)
T ss_dssp             GG--TTEEEEEEEEE
T ss_pred             HhhCCCCEEEEeCCE
Confidence            458999999999954


No 82 
>PF02353 CMAS:  Mycolic acid cyclopropane synthetase;  InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4). All are thought to be S-adenosyl-L-methionine (SAM) utilising methyltransferases []. Mycolic acid cyclopropane synthase or cyclopropane-fatty-acyl-phospholipid synthase (CFA synthase) 2.1.1.79 from EC catalyses the reaction:   S-adenosyl-L-methionine + phospholipid olefinic fatty acid -> S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid.  The major mycolic acid produced by Mycobacterium tuberculosis contains two cis-cyclopropanes in the meromycolate chain. Cyclopropanation may contribute to the structural integrity of the cell wall complex [].; GO: 0008610 lipid biosynthetic process; PDB: 3HA5_A 2FK8_A 3HA7_A 3HA3_A 2FK7_A 1KPG_D 1KP9_B 1KPH_D 3VC2_E 3VC1_D ....
Probab=29.41  E-value=30  Score=25.88  Aligned_cols=38  Identities=16%  Similarity=0.225  Sum_probs=13.8

Q ss_pred             ceeeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEE
Q psy2555           4 FVSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVIL   52 (90)
Q Consensus         4 d~~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i   52 (90)
                      -+|||+++...+.+.+++         ..-++.++++.  +++||+-++
T Consensus        30 ~YS~~~~~~~~~~Le~AQ---------~~k~~~~~~~~--~l~~G~~vL   67 (273)
T PF02353_consen   30 KYSCAYFDEGDDTLEEAQ---------ERKLDLLCEKL--GLKPGDRVL   67 (273)
T ss_dssp             --S----SSTT--HHHHH---------HHHHHHHHTTT--T--TT-EEE
T ss_pred             CCCCeecCCchhhHHHHH---------HHHHHHHHHHh--CCCCCCEEE
Confidence            467788877555553322         22234444444  699999766


No 83 
>PF12600 DUF3769:  Protein of unknown function (DUF3769);  InterPro: IPR022244  This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 560 and 931 amino acids in length. 
Probab=29.39  E-value=29  Score=28.37  Aligned_cols=17  Identities=24%  Similarity=0.389  Sum_probs=15.1

Q ss_pred             CCCCCCcEEEecCCCCC
Q psy2555          43 GNFKKGSVILSNHPKAG   59 (90)
Q Consensus        43 ~~l~~GDv~i~NDPy~G   59 (90)
                      ++|+-=+|-++||||+-
T Consensus        20 ~gW~a~~~~~TNDPf~P   36 (451)
T PF12600_consen   20 NGWKAENVRFTNDPFSP   36 (451)
T ss_pred             CCcEEeeeEEcCCCCCc
Confidence            57999999999999984


No 84 
>cd04480 RPA1_DBD_A_like RPA1_DBD_A_like: A subgroup of uncharacterized plant OB folds with similarity to the second OB fold, the ssDNA-binding domain (DBD)-A, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-A, RPA1 contains three other OB folds: DBD-B, DBD-C, and RPA1N. The major DNA binding activity of RPA is associated with DBD-A and DBD-B of RPA1. RPA1 DBD-C is involved in trimerization. The ssDNA-binding mechanism is believed to be multistep and to involve conformational change.
Probab=29.32  E-value=1e+02  Score=18.54  Aligned_cols=36  Identities=11%  Similarity=-0.037  Sum_probs=22.4

Q ss_pred             eeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEEe
Q psy2555           6 SKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILS   53 (90)
Q Consensus         6 ~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~   53 (90)
                      ..-|.|.+|..+-        ...-    +..+++|.+-|++|.++..
T Consensus        22 ~miL~De~G~~I~--------a~i~----~~~~~~f~~~L~eg~vy~i   57 (86)
T cd04480          22 EMVLVDEKGNRIH--------ATIP----KRLAAKFRPLLKEGKWYTI   57 (86)
T ss_pred             EEEEEcCCCCEEE--------EEEC----HHHHHhhhhhceeCCEEEE
Confidence            4457787776542        1111    4446667677999998874


No 85 
>PF13756 Stimulus_sens_1:  Stimulus-sensing domain
Probab=29.13  E-value=43  Score=21.83  Aligned_cols=18  Identities=22%  Similarity=0.599  Sum_probs=13.8

Q ss_pred             eeEEeCCCCCeeeecCCC
Q psy2555           6 SKESFGPDGGLVSNAPHI   23 (90)
Q Consensus         6 ~~~i~d~~G~~va~~~g~   23 (90)
                      -+=|||++|.+++-+..+
T Consensus        20 RARlyd~dG~Ll~DSr~l   37 (112)
T PF13756_consen   20 RARLYDPDGNLLADSRVL   37 (112)
T ss_pred             eEEEECCCCCEEeecccc
Confidence            356999999999966543


No 86 
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
Probab=29.01  E-value=37  Score=19.43  Aligned_cols=10  Identities=40%  Similarity=0.647  Sum_probs=8.8

Q ss_pred             CCCCCcEEEe
Q psy2555          44 NFKKGSVILS   53 (90)
Q Consensus        44 ~l~~GDv~i~   53 (90)
                      +|++||+++.
T Consensus        29 gl~~GD~I~~   38 (79)
T cd00989          29 GLKAGDRILA   38 (79)
T ss_pred             CCCCCCEEEE
Confidence            6999999985


No 87 
>PF14811 TPD:  Protein of unknown function TPD sequence-motif
Probab=28.78  E-value=44  Score=23.13  Aligned_cols=24  Identities=21%  Similarity=0.506  Sum_probs=20.8

Q ss_pred             CCCCCeEEEEeeeeCCCCCCCccEEEEEe
Q psy2555          61 SHLPDLTVITPVFIDSQPVEEGPVFFVAN   89 (90)
Q Consensus        61 tHl~D~~~~~PVF~~Gel~~~~lv~~~a~   89 (90)
                      .-.||+.+-.||-.+|.+     |-|.=|
T Consensus        62 ~kTPDi~l~~Pi~i~g~~-----V~WIES   85 (139)
T PF14811_consen   62 DKTPDIKLEVPIAINGHV-----VNWIES   85 (139)
T ss_pred             CCCCCEEecCCceECCeE-----Eeeeeh
Confidence            569999999999999977     888654


No 88 
>PF13403 Hint_2:  Hint domain
Probab=28.66  E-value=39  Score=23.03  Aligned_cols=13  Identities=15%  Similarity=0.511  Sum_probs=12.2

Q ss_pred             CCCCCCcEEEecC
Q psy2555          43 GNFKKGSVILSNH   55 (90)
Q Consensus        43 ~~l~~GDv~i~ND   55 (90)
                      ++|++||.+++-|
T Consensus        19 e~L~~GD~V~T~d   31 (147)
T PF13403_consen   19 EDLRPGDRVLTRD   31 (147)
T ss_pred             eccCCCCEEEecC
Confidence            6899999999998


No 89 
>PF09147 DUF1933:  Domain of unknown function (DUF1933);  InterPro: IPR015230 This domain is predominantly found in carbapenam synthetase, and is composed of two antiparallel six-stranded beta-sheets that form a sandwich, flanked on each side by two alpha-helices. Their exact function has not, as yet, been determined []. ; PDB: 1Q19_A 1Q15_D.
Probab=28.63  E-value=90  Score=22.94  Aligned_cols=26  Identities=19%  Similarity=0.106  Sum_probs=17.6

Q ss_pred             CCceeeEEeCCCCCee--eecCC-Cceee
Q psy2555           2 NNFVSKESFGPDGGLV--SNAPH-IPVHL   27 (90)
Q Consensus         2 ~~d~~~~i~d~~G~~v--a~~~g-~p~~~   27 (90)
                      -+||+.-|=|++|++.  ..+.| -|+|+
T Consensus        99 EGdfcffiE~kng~L~l~Tds~G~~pv~l  127 (201)
T PF09147_consen   99 EGDFCFFIEDKNGELTLITDSRGFNPVYL  127 (201)
T ss_dssp             -SSEEEEEEETTSEEEEEE-SSSSS-EEE
T ss_pred             cCceEEEEecCCCcEEEEecCCCCceEEE
Confidence            3799999999999754  45566 47776


No 90 
>PLN02164 sulfotransferase
Probab=28.45  E-value=75  Score=24.84  Aligned_cols=17  Identities=18%  Similarity=0.428  Sum_probs=15.7

Q ss_pred             CCCCCcEEEecCCCCCC
Q psy2555          44 NFKKGSVILSNHPKAGG   60 (90)
Q Consensus        44 ~l~~GDv~i~NDPy~Gg   60 (90)
                      ..+|+||||.--|-+|.
T Consensus        76 ~~r~~DV~laSyPKsGT   92 (346)
T PLN02164         76 QARPNDFLVCSYPKTGT   92 (346)
T ss_pred             CCCCCCEEEEcCCCchh
Confidence            68999999999999985


No 91 
>PRK08432 flagellar motor switch protein FliY; Validated
Probab=28.43  E-value=59  Score=24.66  Aligned_cols=40  Identities=20%  Similarity=0.221  Sum_probs=27.0

Q ss_pred             ceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCCCC--CCCCCeEE
Q psy2555          24 PVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAGG--SHLPDLTV   68 (90)
Q Consensus        24 p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~Gg--tHl~D~~~   68 (90)
                      .+-+|.....++.++     +|++|||+-.|-+..--  .+.++..+
T Consensus       211 ~v~lG~~~~~i~dlL-----~L~~GdVI~Ld~~~~~pv~v~v~~~~~  252 (283)
T PRK08432        211 RVRIGQKKMLLKDVL-----SMDIGSVVELNQLANDPLEILVDDKVI  252 (283)
T ss_pred             EEEEecCcccHHHHh-----CCCCCCEEEeCCCCCCcEEEEECCEEE
Confidence            345666666777775     69999999999887532  34444433


No 92 
>PLN02376 1-aminocyclopropane-1-carboxylate synthase
Probab=28.38  E-value=1e+02  Score=24.81  Aligned_cols=28  Identities=18%  Similarity=0.059  Sum_probs=20.8

Q ss_pred             hHHHHHHHHHhcCCCCCCCcEEEecCCCCCC
Q psy2555          30 MQEAVKFQIDHRKGNFKKGSVILSNHPKAGG   60 (90)
Q Consensus        30 ~~~~v~~~~~~~~~~l~~GDv~i~NDPy~Gg   60 (90)
                      ...++..++..+   .+|||.++.-+||..+
T Consensus       128 a~~al~~l~~~l---~~pGD~Vlv~~P~Y~~  155 (496)
T PLN02376        128 ATGANETIMFCL---ADPGDVFLIPSPYYAA  155 (496)
T ss_pred             hHHHHHHHHHHh---CCCCCEEEECCCCccc
Confidence            344556666555   5799999999999865


No 93 
>PF10084 DUF2322:  Uncharacterized protein conserved in bacteria (DUF2322);  InterPro: IPR016755 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=28.17  E-value=1e+02  Score=20.33  Aligned_cols=35  Identities=20%  Similarity=0.263  Sum_probs=26.9

Q ss_pred             eEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcC
Q psy2555           7 KESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRK   42 (90)
Q Consensus         7 ~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~   42 (90)
                      .-|+|.+|+.++.-+..|.-.||+... .++.++|+
T Consensus        17 l~l~d~~g~~v~~I~n~pGk~GSL~VY-~~La~~fg   51 (100)
T PF10084_consen   17 LDLLDADGNVVAHIENKPGKLGSLAVY-NALAQKFG   51 (100)
T ss_pred             eEeecCCCcEEEEecCCCCcceeHHHH-HHHHHHhC
Confidence            458899999999888899999987633 55556664


No 94 
>PF08874 DUF1835:  Domain of unknown function (DUF1835);  InterPro: IPR014973 This group of proteins are functionally uncharacterised. 
Probab=28.00  E-value=1.2e+02  Score=19.28  Aligned_cols=28  Identities=18%  Similarity=0.169  Sum_probs=20.0

Q ss_pred             hHHHHHHHHHhcCCCCCCCcEEEecCCCCCC
Q psy2555          30 MQEAVKFQIDHRKGNFKKGSVILSNHPKAGG   60 (90)
Q Consensus        30 ~~~~v~~~~~~~~~~l~~GDv~i~NDPy~Gg   60 (90)
                      ....+|..++.-+   .+|||+..+|+++=|
T Consensus         9 ~a~sLk~a~~~~g---~~~~Vi~~~d~lsiG   36 (124)
T PF08874_consen    9 AAGSLKQALKQSG---FEGDVICFRDDLSIG   36 (124)
T ss_pred             hHHHHHHHHHhcC---CCCcEEEEeCCCccc
Confidence            4445566655432   899999999999844


No 95 
>COG3835 CdaR Sugar diacid utilization regulator [Transcription / Signal transduction mechanisms]
Probab=27.75  E-value=73  Score=25.59  Aligned_cols=72  Identities=15%  Similarity=0.191  Sum_probs=39.8

Q ss_pred             ceeeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCCCCCCCCCeEEEEeeeeCCCCCCCcc
Q psy2555           4 FVSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAGGSHLPDLTVITPVFIDSQPVEEGP   83 (90)
Q Consensus         4 d~~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~GgtHl~D~~~~~PVF~~Gel~~~~l   83 (90)
                      |++.-+.|++|..++.+  =|-=+|......--       -+++++++..-+--..-.+--=-.+=.|||++|++     
T Consensus        20 ~~nInVMd~~GvIIgSg--d~~Rigq~HEGAll-------al~e~R~V~Id~~~a~~l~gVkpGINLPi~~~~~v-----   85 (376)
T COG3835          20 DYNINVMDADGVIIGSG--DPERIGQLHEGALL-------ALKERRVVEIDQAVARKLKGVKPGINLPIRFDGKV-----   85 (376)
T ss_pred             cccceEECCCCeEEecC--ChHHhcchhhHHHH-------HHhcCcEEEeeHHHHHHhcCCCCCCCcceEecCce-----
Confidence            56778899999999754  34334443332211       25566666555432110010011244699999987     


Q ss_pred             EEEEEe
Q psy2555          84 VFFVAN   89 (90)
Q Consensus        84 v~~~a~   89 (90)
                      ||-.+.
T Consensus        86 VGViGI   91 (376)
T COG3835          86 VGVIGI   91 (376)
T ss_pred             EEEEec
Confidence            886653


No 96 
>TIGR00523 eIF-1A eukaryotic/archaeal initiation factor 1A. Recommended nomenclature: eIF-1A for eukaryotes, aIF-1A for Archaea. Also called eIF-4C
Probab=27.52  E-value=33  Score=22.31  Aligned_cols=15  Identities=20%  Similarity=0.362  Sum_probs=12.9

Q ss_pred             CCCCCcEEEecCCCCC
Q psy2555          44 NFKKGSVILSNHPKAG   59 (90)
Q Consensus        44 ~l~~GDv~i~NDPy~G   59 (90)
                      -|++||.++. +||-.
T Consensus        57 wI~~GD~VlV-sp~d~   71 (99)
T TIGR00523        57 WIREGDVVIV-KPWEF   71 (99)
T ss_pred             EecCCCEEEE-EEccC
Confidence            4899999999 89964


No 97 
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
Probab=27.44  E-value=41  Score=19.88  Aligned_cols=10  Identities=40%  Similarity=0.574  Sum_probs=8.9

Q ss_pred             CCCCCcEEEe
Q psy2555          44 NFKKGSVILS   53 (90)
Q Consensus        44 ~l~~GDv~i~   53 (90)
                      +|++||+++.
T Consensus        27 GL~~GDiI~~   36 (79)
T cd00991          27 VLHTGDVIYS   36 (79)
T ss_pred             CCCCCCEEEE
Confidence            6999999985


No 98 
>cd01285 nucleoside_deaminase Nucleoside deaminases include adenosine, guanine and cytosine deaminases. These enzymes are Zn dependent and catalyze the deamination of nucleosides. The zinc ion in the active site plays a central role in the proposed catalytic mechanism, activating a water molecule to form a hydroxide ion that performs a nucleophilic attack on the substrate. The functional enzyme is a homodimer. Cytosine deaminase catalyzes the deamination of cytosine to uracil and ammonia and is a member of the pyrimidine salvage pathway. Cytosine deaminase is found in bacteria and fungi but is not present in mammals; for this reason, the enzyme is currently of interest for antimicrobial drug design and gene therapy applications against tumors. Some members of this family are tRNA-specific adenosine deaminases that generate inosine at the first position of their anticodon (position 34) of specific tRNAs; this modification is thought to enlarge the codon recognition capacity during protei
Probab=27.40  E-value=1.7e+02  Score=18.47  Aligned_cols=53  Identities=8%  Similarity=0.023  Sum_probs=29.9

Q ss_pred             ceeeEEeCCCCCeeeecCC-Cc----eeecchHHHHHHHHHhcC-CCCCCCcEEEecCC
Q psy2555           4 FVSKESFGPDGGLVSNAPH-IP----VHLGSMQEAVKFQIDHRK-GNFKKGSVILSNHP   56 (90)
Q Consensus         4 d~~~~i~d~~G~~va~~~g-~p----~~~g~~~~~v~~~~~~~~-~~l~~GDv~i~NDP   56 (90)
                      -+.+.|++++|++++.+.. .+    ...=+-..+++.+.++.. ..++.-++|.+-.|
T Consensus        18 ~vgaviv~~~~~ii~~g~n~~~~~~~~~~HAE~~ai~~~~~~~~~~~~~~~~ly~t~EP   76 (109)
T cd01285          18 PFGAVIVDDDGKVIARGHNRVEQDGDPTAHAEIVAIRNAARRLGSYLLSGCTLYTTLEP   76 (109)
T ss_pred             cEEEEEEeCCCEEEEEEeCCCCCCCCCcccHHHHHHHHHHHHhCCCccCCeEEEEeCCC
Confidence            3678999999999987632 21    111122334455555443 24566666666555


No 99 
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand is presumed to form the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
Probab=27.06  E-value=42  Score=19.38  Aligned_cols=10  Identities=10%  Similarity=0.375  Sum_probs=8.8

Q ss_pred             CCCCCcEEEe
Q psy2555          44 NFKKGSVILS   53 (90)
Q Consensus        44 ~l~~GDv~i~   53 (90)
                      +|++||+++.
T Consensus        29 Gl~~GD~I~~   38 (80)
T cd00990          29 GLVAGDELVA   38 (80)
T ss_pred             CCCCCCEEEE
Confidence            6999999985


No 100
>cd00714 GFAT Glutamine amidotransferases class-II (Gn-AT)_GFAT-type. This domain is found at the N-terminus of glucosamine-6P synthase (GlmS, or GFAT in humans).  The glutaminase domain catalyzes amide nitrogen transfer from glutamine to the appropriate substrate. In this process, glutamine is hydrolyzed to glutamic acid and ammonia. In humans, GFAT catalyzes the first and rate-limiting step of hexosamine metabolism, the conversion of D-fructose-6P (Fru6P) into D-glucosamine-6P using L-glutamine as a nitrogen source.  The end product of this pathway, UDP-N-acetyl glucosamine, is a major building block of the bacterial peptidoglycan and fungal chitin.
Probab=26.83  E-value=56  Score=23.23  Aligned_cols=51  Identities=12%  Similarity=0.223  Sum_probs=29.9

Q ss_pred             CCceeeEEeCCC--CCeeeecCCCceeecchH------HHHHHHHHhcC--CCCCCCcEEE
Q psy2555           2 NNFVSKESFGPD--GGLVSNAPHIPVHLGSMQ------EAVKFQIDHRK--GNFKKGSVIL   52 (90)
Q Consensus         2 ~~d~~~~i~d~~--G~~va~~~g~p~~~g~~~------~~v~~~~~~~~--~~l~~GDv~i   52 (90)
                      .+.|+.+++|.+  +++++....-|.+++-..      +=.+.+.++..  ..|++||++.
T Consensus       154 ~G~fa~~~~d~~~~~~l~~~RD~~PL~~~~~~~~~~~aSE~~al~~~~~~~~~~~~~~~~~  214 (215)
T cd00714         154 EGAYALAVISKDEPDEIVAARNGSPLVIGIGDGENFVASDAPALLEHTRRVIYLEDGDIAV  214 (215)
T ss_pred             ccceEEEEEEeCCCCEEEEEECCCCcEEEEcCCeEEEEECHHHHHHhcCEEEEECCCCEEe
Confidence            467899999974  367776656677765211      11123332222  3678888764


No 101
>PRK11479 hypothetical protein; Provisional
Probab=26.78  E-value=45  Score=25.54  Aligned_cols=12  Identities=25%  Similarity=0.611  Sum_probs=10.3

Q ss_pred             CCCCCCcEEEec
Q psy2555          43 GNFKKGSVILSN   54 (90)
Q Consensus        43 ~~l~~GDv~i~N   54 (90)
                      .+++|||+++..
T Consensus        63 ~~LqpGDLVFfs   74 (274)
T PRK11479         63 PDLKPGDLLFSS   74 (274)
T ss_pred             hhCCCCCEEEEe
Confidence            579999999964


No 102
>PLN00139 hypothetical protein; Provisional
Probab=26.40  E-value=64  Score=24.80  Aligned_cols=21  Identities=19%  Similarity=0.354  Sum_probs=14.5

Q ss_pred             HHHHHhcC--CCCCCCcEEEecC
Q psy2555          35 KFQIDHRK--GNFKKGSVILSNH   55 (90)
Q Consensus        35 ~~~~~~~~--~~l~~GDv~i~ND   55 (90)
                      +.+++...  -.|++|||++.+-
T Consensus       276 ~~~~~~~~~~~~Wq~GDvl~iDN  298 (320)
T PLN00139        276 GQIIEEESIQFKWEKGDVLFLDN  298 (320)
T ss_pred             HHHHHHhhccCCCCCCCEEEEeC
Confidence            44444432  4799999999875


No 103
>PF05721 PhyH:  Phytanoyl-CoA dioxygenase (PhyH);  InterPro: IPR008775 This family is made up of several eukaryotic phytanoyl-CoA dioxygenase (PhyH) proteins as well as a number of bacterial deoxygenases. PhyH is a peroxisomal enzyme catalysing the first step of phytanic acid alpha-oxidation. PhyH deficiency causes Refsum's disease (RD) which is an inherited neurological syndrome biochemically characterised by the accumulation of phytanic acid in plasma and tissues [].; PDB: 3GJA_A 3EMR_A 3OBZ_A 2OPW_A 3NNL_B 3NNF_A 3NNM_B 3NNJ_A 2FCV_B 2FCU_A ....
Probab=26.36  E-value=36  Score=22.42  Aligned_cols=12  Identities=25%  Similarity=0.473  Sum_probs=10.0

Q ss_pred             CCCCCcEEEecC
Q psy2555          44 NFKKGSVILSNH   55 (90)
Q Consensus        44 ~l~~GDv~i~ND   55 (90)
                      .+++||+++.|-
T Consensus       183 ~~~~Gdvl~~~~  194 (211)
T PF05721_consen  183 PMKAGDVLFFHS  194 (211)
T ss_dssp             -BSTTEEEEEET
T ss_pred             ecCCCeEEEEcC
Confidence            689999999875


No 104
>PRK08666 5'-methylthioadenosine phosphorylase; Validated
Probab=26.30  E-value=40  Score=24.84  Aligned_cols=13  Identities=23%  Similarity=0.478  Sum_probs=11.8

Q ss_pred             CCCCCcEEEecCC
Q psy2555          44 NFKKGSVILSNHP   56 (90)
Q Consensus        44 ~l~~GDv~i~NDP   56 (90)
                      ++++||+++.+|=
T Consensus        91 ~l~~GDiVi~~d~  103 (261)
T PRK08666         91 NMKPGDFVILDQF  103 (261)
T ss_pred             CCCCCCEEeehhh
Confidence            7999999999985


No 105
>PRK10040 hypothetical protein; Provisional
Probab=25.70  E-value=47  Score=19.36  Aligned_cols=12  Identities=17%  Similarity=0.230  Sum_probs=9.8

Q ss_pred             CCCcEEEecCCC
Q psy2555          46 KKGSVILSNHPK   57 (90)
Q Consensus        46 ~~GDv~i~NDPy   57 (90)
                      -.|+.|++||--
T Consensus        31 C~g~~FvCnDGS   42 (52)
T PRK10040         31 CTGGKFVCNDGS   42 (52)
T ss_pred             ccCCEEEeCCCc
Confidence            469999999943


No 106
>TIGR00758 UDG_fam4 uracil-DNA glycosylase, family 4. This well-conserved family of proteins is about 200 residues in length and homologous to the N-terminus of the DNA polymerase of phage SPO1 of Bacillus subtilis. The member from Thermus thermophilus HB8 is known to act as uracil-DNA glycosylase, an enzyme of DNA base excision repair. Its appearance as a domain of phage DNA polymerases could be consistent with uracil-DNA glycosylase activity.
Probab=25.40  E-value=95  Score=21.40  Aligned_cols=28  Identities=11%  Similarity=0.207  Sum_probs=22.2

Q ss_pred             eecchHHHHHHHHHhcCCCCCCCcEEEecC
Q psy2555          26 HLGSMQEAVKFQIDHRKGNFKKGSVILSNH   55 (90)
Q Consensus        26 ~~g~~~~~v~~~~~~~~~~l~~GDv~i~ND   55 (90)
                      |.|..+..++.+++..  ++.+.|++++|=
T Consensus        42 f~g~sG~~L~~~l~~~--gl~~~~vy~t~~   69 (173)
T TIGR00758        42 FVGRAGKLLDEMLAAI--GLSRENVYITNV   69 (173)
T ss_pred             CcChHHHHHHHHHHHc--CCCcccEEEecc
Confidence            5676777778888766  588999999986


No 107
>PRK00331 glucosamine--fructose-6-phosphate aminotransferase; Reviewed
Probab=25.27  E-value=91  Score=25.57  Aligned_cols=52  Identities=12%  Similarity=0.091  Sum_probs=33.5

Q ss_pred             CCceeeEEeCCC--CCeeeecCCCceeecchH---------HHHHHHHHhcCCCCCCCcEEEec
Q psy2555           2 NNFVSKESFGPD--GGLVSNAPHIPVHLGSMQ---------EAVKFQIDHRKGNFKKGSVILSN   54 (90)
Q Consensus         2 ~~d~~~~i~d~~--G~~va~~~g~p~~~g~~~---------~~v~~~~~~~~~~l~~GDv~i~N   54 (90)
                      .+.|+.+++|++  +++++...+-|.++|--.         .++...-+.+ -.++||+++..+
T Consensus       155 ~G~~a~~~~d~~~~~~l~~~Rd~~PL~~g~~~~~~~~aSE~~al~~~~~~~-~~l~pg~~~~i~  217 (604)
T PRK00331        155 EGAYALAVIDKDEPDTIVAARNGSPLVIGLGEGENFLASDALALLPYTRRV-IYLEDGEIAVLT  217 (604)
T ss_pred             cCeeEEEEEecCCCCEEEEEECCCceEEEEcCCeEEEEECHHHHHHhcCEE-EEECCCeEEEEE
Confidence            467999999986  467776667788776321         1222221222 369999988875


No 108
>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism]
Probab=25.23  E-value=49  Score=24.11  Aligned_cols=18  Identities=22%  Similarity=0.191  Sum_probs=15.2

Q ss_pred             CceeeEEeCCCCCeeeec
Q psy2555           3 NFVSKESFGPDGGLVSNA   20 (90)
Q Consensus         3 ~d~~~~i~d~~G~~va~~   20 (90)
                      .-||+-|||.+|+++.|.
T Consensus        34 rAFS~~lFne~g~LLltr   51 (185)
T COG1443          34 RAFSSFLFNERGQLLLTR   51 (185)
T ss_pred             hhhheeEECCCCceeeeh
Confidence            358999999999988764


No 109
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane]
Probab=25.22  E-value=1.1e+02  Score=23.47  Aligned_cols=39  Identities=15%  Similarity=0.187  Sum_probs=24.8

Q ss_pred             CceeeEEeCCCCCeeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEE
Q psy2555           3 NFVSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVIL   52 (90)
Q Consensus         3 ~d~~~~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i   52 (90)
                      +-+||+.|.....++.+++         ...++.+++++  .|+||+-+|
T Consensus        39 ~~Yscayf~~~~~tL~eAQ---------~~k~~~~~~kl--~L~~G~~lL   77 (283)
T COG2230          39 MTYSCAYFEDPDMTLEEAQ---------RAKLDLILEKL--GLKPGMTLL   77 (283)
T ss_pred             CceeeEEeCCCCCChHHHH---------HHHHHHHHHhc--CCCCCCEEE
Confidence            4578888887665544332         22345555555  599999887


No 110
>COG1956 GAF domain-containing protein [Signal transduction mechanisms]
Probab=24.48  E-value=56  Score=23.34  Aligned_cols=34  Identities=18%  Similarity=0.361  Sum_probs=20.0

Q ss_pred             CCCCcEEEecCCCCCCCCCC-----CeEEEEeeeeCCCC
Q psy2555          45 FKKGSVILSNHPKAGGSHLP-----DLTVITPVFIDSQP   78 (90)
Q Consensus        45 l~~GDv~i~NDPy~GgtHl~-----D~~~~~PVF~~Gel   78 (90)
                      .+.|.+.+..|-..--.|..     -==++.|||.+|++
T Consensus        89 ~~~~~t~~V~DV~~~~ghiaCD~as~SEIVvPi~~~g~~  127 (163)
T COG1956          89 AATGETVRVDDVHAFPGHIACDAASNSEIVVPIFKDGKL  127 (163)
T ss_pred             HhcCCeEEecccccCCCccccccccCceEEEEEEECCEE
Confidence            45556666666543222332     12368899999987


No 111
>COG2337 MazF Growth inhibitor [Signal transduction mechanisms]
Probab=24.43  E-value=59  Score=21.25  Aligned_cols=15  Identities=33%  Similarity=0.623  Sum_probs=12.5

Q ss_pred             CCCCcEEEec-CCCCC
Q psy2555          45 FKKGSVILSN-HPKAG   59 (90)
Q Consensus        45 l~~GDv~i~N-DPy~G   59 (90)
                      ++.||++..| +|+.|
T Consensus         3 ~~rg~i~~~~l~p~~g   18 (112)
T COG2337           3 PKRGDIYLVDLGPVVG   18 (112)
T ss_pred             cccccEEEecCCCccc
Confidence            5789999999 88865


No 112
>PRK09216 rplM 50S ribosomal protein L13; Reviewed
Probab=24.00  E-value=1.3e+02  Score=20.78  Aligned_cols=39  Identities=21%  Similarity=0.313  Sum_probs=22.7

Q ss_pred             EEeCCCCCeeeecCCCceeecchHHHHHHHHH-h----cCCCCCCCc-EEEecCC
Q psy2555           8 ESFGPDGGLVSNAPHIPVHLGSMQEAVKFQID-H----RKGNFKKGS-VILSNHP   56 (90)
Q Consensus         8 ~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~-~----~~~~l~~GD-v~i~NDP   56 (90)
                      -|.|++|..          +|-+...|...+. +    |..+...|| |++.|-=
T Consensus        16 ~viDA~~~~----------lGRlAs~IAk~L~GKhKp~y~p~~d~Gd~VvViNa~   60 (144)
T PRK09216         16 YVIDAEGKV----------LGRLASEVASILRGKHKPTFTPHVDTGDFVIVINAE   60 (144)
T ss_pred             EEEeCCCCc----------hHHHHHHHHHHHhccCCCCcCCCCCCCCEEEEEeCc
Confidence            356666655          4555555655554 2    335677898 5566643


No 113
>CHL00159 rpl13 ribosomal protein L13; Validated
Probab=23.91  E-value=1.3e+02  Score=20.80  Aligned_cols=40  Identities=18%  Similarity=0.236  Sum_probs=22.3

Q ss_pred             EEeCCCCCeeeecCCCceeecchHHHHHHHHH-h----cCCCCCCCc-EEEecCCC
Q psy2555           8 ESFGPDGGLVSNAPHIPVHLGSMQEAVKFQID-H----RKGNFKKGS-VILSNHPK   57 (90)
Q Consensus         8 ~i~d~~G~~va~~~g~p~~~g~~~~~v~~~~~-~----~~~~l~~GD-v~i~NDPy   57 (90)
                      -|.|++|..          +|-+..-|...+. +    |..+...|| |++.|-=-
T Consensus        17 ~viDA~~~~----------lGRlAs~iA~~L~GKhKp~ytP~~d~Gd~VVViNa~k   62 (143)
T CHL00159         17 YIIDAKDQT----------LGRLATKIASLLRGKNKPSYHPSVDTGDYVIVINAEK   62 (143)
T ss_pred             EEEeCCCCc----------hHHHHHHHHHHHhccCCCCcCCCcCCCCEEEEEecce
Confidence            355666655          4555555555554 2    334677788 55666433


No 114
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif). Many PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. Heterodimerization through PDZ-PDZ domain interactions adds to the domain's versatility, and PDZ domain-mediated interactions may be modulated dynamically through target phosphorylation. Some PDZ domains play a role in scaffolding supramolecular complexes. PDZ domains are found in diverse signaling proteins in bacteria, archebacteria, and eurkayotes. This CD contains two distinct structural subgroups with either a N- or C-terminal beta-strand forming the peptide-binding groove base. The circular permutation placing the strand on the N-terminus appears to be found in Eumetazoa only, while the C-terminal variant is found in all three kingdoms of life, and seems to co-occur with protease domains. PDZ domains have been named after PSD95(pos
Probab=23.89  E-value=54  Score=18.30  Aligned_cols=9  Identities=44%  Similarity=0.815  Sum_probs=8.3

Q ss_pred             CCCCCcEEE
Q psy2555          44 NFKKGSVIL   52 (90)
Q Consensus        44 ~l~~GDv~i   52 (90)
                      .|++||+++
T Consensus        30 gl~~GD~I~   38 (70)
T cd00136          30 GLQAGDVIL   38 (70)
T ss_pred             CCCCCCEEE
Confidence            699999997


No 115
>PF05257 CHAP:  CHAP domain;  InterPro: IPR007921 The CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain is a region between 110 and 140 amino acids that is found in proteins from bacteria, bacteriophages, archaea and eukaryotes of the Trypanosomidae family. Many of these proteins are uncharacterised, but it has been proposed that they may function mainly in peptidoglycan hydrolysis. The CHAP domain is found in a wide range of protein architectures; it is commonly associated with bacterial type SH3 domains and with several families of amidase domains. It has been suggested that CHAP domain containing proteins utilise a catalytic cysteine residue in a nucleophilic-attack mechanism [, ]. The CHAP domain contains two invariant residues, a cysteine and a histidine. These residues form part of the putative active site of CHAP domain containing proteins. Secondary structure predictions show that the CHAP domain belongs to the alpha + beta structural class, with the N-terminal half largely containing predicted alpha helices and the C-terminal half principally composed of predicted beta strands [, ]. Some proteins known to contain a CHAP domain are listed below:   Bacterial and trypanosomal glutathionylspermidine amidases.  A variety of bacterial autolysins.  A Nocardia aerocolonigenes putative esterase.  Streptococcus pneumoniae choline-binding protein D.  Methanosarcina mazei protein MM2478, a putative chloride channel.  Several phage-encoded peptidoglycan hydrolases.  Cysteine peptidases belonging to MEROPS peptidase family C51 (D-alanyl-glycyl endopeptidase, clan CA).  ; PDB: 2LRJ_A 2VPM_B 2VOB_B 2VPS_A 2K3A_A 2IO9_A 2IO8_A 2IOB_A 2IOA_B 2IO7_B ....
Probab=23.84  E-value=49  Score=21.15  Aligned_cols=31  Identities=13%  Similarity=0.274  Sum_probs=15.5

Q ss_pred             CCCCCCcEEEec-CCCCCCCCCCCeEEEEeeeeCC
Q psy2555          43 GNFKKGSVILSN-HPKAGGSHLPDLTVITPVFIDS   76 (90)
Q Consensus        43 ~~l~~GDv~i~N-DPy~GgtHl~D~~~~~PVF~~G   76 (90)
                      ...++||+++.+ .+..+-.|   +.++.=|..+|
T Consensus        61 ~~P~~Gdivv~~~~~~~~~GH---VaIV~~v~~~~   92 (124)
T PF05257_consen   61 STPQPGDIVVWDSGSGGGYGH---VAIVESVNDGG   92 (124)
T ss_dssp             S---TTEEEEEEECTTTTT-E---EEEEEEE-TTS
T ss_pred             cccccceEEEeccCCCCCCCe---EEEEEEECCCC
Confidence            578999999994 33333355   45555554343


No 116
>PF07591 PT-HINT:  Pretoxin HINT domain;  InterPro: IPR011451 This entry represents a cluster of homologous proteins identified in Leptospira interrogans. One member (Q8EZX6 from SWISSPROT) has been predicted to be a phenazine biosynthesis family protein.; PDB: 2JNQ_A 2JMZ_A.
Probab=23.72  E-value=26  Score=23.33  Aligned_cols=18  Identities=28%  Similarity=0.453  Sum_probs=0.0

Q ss_pred             CCCCCCcEEEecCCCCCC
Q psy2555          43 GNFKKGSVILSNHPKAGG   60 (90)
Q Consensus        43 ~~l~~GDv~i~NDPy~Gg   60 (90)
                      ++|++||.++.=||-.|.
T Consensus        12 e~I~~GD~Vls~d~~tg~   29 (130)
T PF07591_consen   12 EDIKVGDRVLSYDEETGE   29 (130)
T ss_dssp             ------------------
T ss_pred             cccccccccccccccccc
Confidence            689999999999998874


No 117
>cd04459 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CSD). Rho protein is a transcription termination factor in most bacteria. In bacteria, there are two distinct mechanisms for mRNA transcription termination. In intrinsic termination, RNA polymerase and nascent mRNA are released from DNA template by an mRNA stem loop structure, which resembles the transcription termination mechanism used by eukaryotic pol III. The second mechanism is mediated by Rho factor. Rho factor terminates transcription by using energy from ATP hydrolysis to forcibly dissociate the transcripts from RNA polymerase. Rho protein contains an N-terminal S1-like domain, which binds single-stranded RNA. Rho has a C-terminal ATPase domain which hydrolyzes ATP to provide energy to strip RNA polymerase and mRNA from the DNA template. Rho functions as a homohexamer.
Probab=23.36  E-value=77  Score=19.20  Aligned_cols=17  Identities=24%  Similarity=0.421  Sum_probs=13.2

Q ss_pred             HHHHHhcCCCCCCCcEEEe
Q psy2555          35 KFQIDHRKGNFKKGSVILS   53 (90)
Q Consensus        35 ~~~~~~~~~~l~~GDv~i~   53 (90)
                      ...+++|  +|+.||.+.-
T Consensus        33 ~~~Irr~--~LR~GD~V~G   49 (68)
T cd04459          33 PSQIRRF--NLRTGDTVVG   49 (68)
T ss_pred             HHHHHHh--CCCCCCEEEE
Confidence            4566667  5999999875


No 118
>TIGR01641 phageSPP1_gp7 phage putative head morphogenesis protein, SPP1 gp7 family. This model describes a region of about 110 amino acids found exclusively in phage-related proteins, internally or toward the C-terminus. One member, gp7 of phage SPP1, appears involved in head morphogenesis.
Probab=23.24  E-value=90  Score=19.53  Aligned_cols=27  Identities=19%  Similarity=0.233  Sum_probs=22.5

Q ss_pred             CCcEEEecCCCCCC----CCCCCeEEEEeee
Q psy2555          47 KGSVILSNHPKAGG----SHLPDLTVITPVF   73 (90)
Q Consensus        47 ~GDv~i~NDPy~Gg----tHl~D~~~~~PVF   73 (90)
                      .|=+|-.+||..|.    .|.+.=+.+.|||
T Consensus        78 dG~~~~~d~~~~~~~~pp~h~~CRC~~~pv~  108 (108)
T TIGR01641        78 NGKIFKVDDAVPGVNAPPLHPNCRCTLAPVP  108 (108)
T ss_pred             CCcEEecCCCCcCCcCCCCCCCcCCeeeeCC
Confidence            57788899998654    7999999999986


No 119
>smart00065 GAF Domain present in phytochromes and cGMP-specific phosphodiesterases. Mutations within these domains in PDE6B result in autosomal recessive  inheritance of retinitis pigmentosa.
Probab=23.00  E-value=1.1e+02  Score=17.69  Aligned_cols=19  Identities=16%  Similarity=0.141  Sum_probs=14.8

Q ss_pred             CCeEEEEeeeeCCCCCCCccEEEE
Q psy2555          64 PDLTVITPVFIDSQPVEEGPVFFV   87 (90)
Q Consensus        64 ~D~~~~~PVF~~Gel~~~~lv~~~   87 (90)
                      ..-.+..|++.+|++     +|..
T Consensus        91 ~~s~~~~Pl~~~~~~-----~G~l  109 (149)
T smart00065       91 VRSFLAVPLVADGEL-----VGVL  109 (149)
T ss_pred             eeeEEEeeeeecCEE-----EEEE
Confidence            456788999999976     7754


No 120
>TIGR01697 PNPH-PUNA-XAPA inosine guanosine and xanthosine phosphorylase family. Sequences from Clostridium and Thermotoga fall between these last two clades and are uncharacterized with respect to substrate range and operon.
Probab=22.98  E-value=56  Score=23.92  Aligned_cols=13  Identities=23%  Similarity=0.623  Sum_probs=11.8

Q ss_pred             CCCCCcEEEecCC
Q psy2555          44 NFKKGSVILSNHP   56 (90)
Q Consensus        44 ~l~~GDv~i~NDP   56 (90)
                      ++++||+++.+|-
T Consensus        98 ~l~~GDiVI~~~~  110 (248)
T TIGR01697        98 DFKPGDLMIIKDH  110 (248)
T ss_pred             CCCCCCEEEEhhh
Confidence            6999999999986


No 121
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements. May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases.
Probab=22.88  E-value=57  Score=18.66  Aligned_cols=10  Identities=30%  Similarity=0.557  Sum_probs=8.5

Q ss_pred             CCCCCcEEEe
Q psy2555          44 NFKKGSVILS   53 (90)
Q Consensus        44 ~l~~GDv~i~   53 (90)
                      .+++||+++.
T Consensus        43 gl~~GD~I~~   52 (82)
T cd00992          43 GLRVGDRILE   52 (82)
T ss_pred             CCCCCCEEEE
Confidence            6999999874


No 122
>COG2002 AbrB Regulators of stationary/sporulation gene expression [Transcription]
Probab=22.77  E-value=1.5e+02  Score=18.36  Aligned_cols=16  Identities=25%  Similarity=0.231  Sum_probs=10.6

Q ss_pred             HHHHHhcCCCCCCCcEEE
Q psy2555          35 KFQIDHRKGNFKKGSVIL   52 (90)
Q Consensus        35 ~~~~~~~~~~l~~GDv~i   52 (90)
                      +.+.+.+  +|++||++.
T Consensus        20 keiR~~l--gi~~Gd~le   35 (89)
T COG2002          20 KEIREAL--GIKEGDVLE   35 (89)
T ss_pred             HHHHHHh--CCCCCCEEE
Confidence            4444445  599999764


No 123
>COG1671 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.70  E-value=56  Score=23.02  Aligned_cols=12  Identities=17%  Similarity=0.404  Sum_probs=10.7

Q ss_pred             CCCCCcEEEecC
Q psy2555          44 NFKKGSVILSNH   55 (90)
Q Consensus        44 ~l~~GDv~i~ND   55 (90)
                      --++||+++|.|
T Consensus        63 ~a~~gDlVVT~D   74 (150)
T COG1671          63 LAEKGDLVVTAD   74 (150)
T ss_pred             hCCCCCEEEECc
Confidence            468999999999


No 124
>KOG4146|consensus
Probab=22.52  E-value=87  Score=20.63  Aligned_cols=36  Identities=22%  Similarity=0.389  Sum_probs=21.7

Q ss_pred             Cceeecc-hHHHHHHHHHhcC------CCCCCCcEEEecCCCC
Q psy2555          23 IPVHLGS-MQEAVKFQIDHRK------GNFKKGSVILSNHPKA   58 (90)
Q Consensus        23 ~p~~~g~-~~~~v~~~~~~~~------~~l~~GDv~i~NDPy~   58 (90)
                      -|.-+|. +.+..+..+++.+      +.++||=+.+.||--+
T Consensus        34 ~~~tvgdll~yi~~~~ie~r~~lFi~~gsvrpGii~lINd~DW   76 (101)
T KOG4146|consen   34 SPATVGDLLDYIFGKYIETRDSLFIHHGSVRPGIIVLINDMDW   76 (101)
T ss_pred             CcccHHHHHHHHHHHHhcCCcceEeeCCcCcCcEEEEEeccch
Confidence            3555654 3334444554422      4789999999998643


No 125
>TIGR02551 SpaO_YscQ type III secretion system apparatus protein YscQ/HrcQ. Genes in this family are found in type III secretion operons. The gene (YscQ) in Yersinia is essential for YOPs secretion, while SpaO in Shigella is involved in the Surface Presentation of Antigens apparatus found on the virulence plasmid, and HrcQ is involved in the Harpin secretory system in organisms like Pseudomonas syringae.
Probab=22.47  E-value=52  Score=24.77  Aligned_cols=31  Identities=26%  Similarity=0.459  Sum_probs=21.7

Q ss_pred             CceeecchHHHHHHHHHhcCCCCCCCcEEEecCCCC
Q psy2555          23 IPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKA   58 (90)
Q Consensus        23 ~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~   58 (90)
                      ++..+|....+.+..     ..+++|||++...++.
T Consensus       141 ~~l~lG~~~Ls~~~L-----~~L~~GDvLl~~~~~~  171 (298)
T TIGR02551       141 VRLEIGSSRLALDEL-----RSLEVGDVLLLDNPSA  171 (298)
T ss_pred             EEEEEccEEecHHHH-----hccCCCCEEeeccccc
Confidence            345566555555444     4799999999998865


No 126
>TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit. This protein family describes the archaeal proteasome alpha subunit, homologous to both the beta subunit and to the alpha and beta subunits of eukaryotic proteasome subunits. This family is universal in the first 29 complete archaeal genomes but occasionally is duplicated.
Probab=22.39  E-value=50  Score=23.46  Aligned_cols=17  Identities=35%  Similarity=0.450  Sum_probs=15.1

Q ss_pred             CCCceeeEEeCCCCCee
Q psy2555           1 MNNFVSKESFGPDGGLV   17 (90)
Q Consensus         1 ~~~d~~~~i~d~~G~~v   17 (90)
                      |.-|+...+|+++||+.
T Consensus         1 ~~~~~~~~~f~p~Grl~   17 (224)
T TIGR03633         1 MGYDRAITVFSPDGRLY   17 (224)
T ss_pred             CCCCCCCceECCCCeEe
Confidence            66789999999999987


No 127
>COG1015 DeoB Phosphopentomutase [Carbohydrate transport and metabolism]
Probab=22.35  E-value=1.1e+02  Score=24.77  Aligned_cols=23  Identities=26%  Similarity=0.647  Sum_probs=18.5

Q ss_pred             CCCCCCcEEEe-----cCCCCCCC-CCCC
Q psy2555          43 GNFKKGSVILS-----NHPKAGGS-HLPD   65 (90)
Q Consensus        43 ~~l~~GDv~i~-----NDPy~Ggt-Hl~D   65 (90)
                      +.|+|+|++|.     |||=++|| |.-.
T Consensus       320 ~~l~edDlLiiTADHGnDPT~~gTdHTRE  348 (397)
T COG1015         320 ENLREDDLLIITADHGNDPTWGGTDHTRE  348 (397)
T ss_pred             HhcCCCCEEEEecCCCCCCCCCCCCcccc
Confidence            58999999986     99988665 6554


No 128
>PF00391 PEP-utilizers:  PEP-utilising enzyme, mobile domain;  InterPro: IPR008279 A number of enzymes that catalyze the transfer of a phosphoryl group from phosphoenolpyruvate (PEP) via a phospho-histidine intermediate have been shown to be structurally related [, , , ]. All these enzymes share the same catalytic mechanism: they bind PEP and transfer the phosphoryl group from it to a histidine residue. This domain is a "swivelling" beta/beta/alpha domain which is thought to be mobile in all proteins known to contain it []. It is often found associated with the pyruvate phosphate dikinase, PEP/pyruvate-binding domain (IPR002192 from INTERPRO) at its N terminus.; GO: 0016772 transferase activity, transferring phosphorus-containing groups, 0016310 phosphorylation; PDB: 2X0S_A 2OLS_A 2HRO_A 2E28_A 2WQD_A 3T05_D 3T0T_D 3T07_B 2DIK_A 2FM4_A ....
Probab=22.27  E-value=35  Score=20.63  Aligned_cols=40  Identities=18%  Similarity=0.315  Sum_probs=26.1

Q ss_pred             eeEEeCCCCC------eeeecCCCceeecchHHHHHHHHHhcCCCCCCCcEEEec
Q psy2555           6 SKESFGPDGG------LVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSN   54 (90)
Q Consensus         6 ~~~i~d~~G~------~va~~~g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~N   54 (90)
                      ..+|...+|.      ++|.+.|+|.-++.-...         ..+++||.+..|
T Consensus        31 ~~Giv~~~Gg~~SH~aIlAr~~giP~ivg~~~~~---------~~i~~g~~v~lD   76 (80)
T PF00391_consen   31 VAGIVTEEGGPTSHAAILARELGIPAIVGVGDAT---------EAIKDGDWVTLD   76 (80)
T ss_dssp             SSEEEESSSSTTSHHHHHHHHTT-EEEESTTTHH---------HHSCTTEEEEEE
T ss_pred             eEEEEEEcCCccchHHHHHHHcCCCEEEeeccHh---------hccCCCCEEEEE
Confidence            4567777665      455677899888874211         258889988874


No 129
>PF08541 ACP_syn_III_C:  3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal  ;  InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2.3.1.41 from EC, the enzyme responsible for initiating the chain of reactions of the fatty acid synthase in plants and bacteria. ; GO: 0016747 transferase activity, transferring acyl groups other than amino-acyl groups, 0008610 lipid biosynthetic process; PDB: 3IL3_A 1ZOW_C 3GWE_B 3GWA_B 1UB7_B 3LED_B 2EBD_A 1HNJ_A 2EFT_B 1HN9_B ....
Probab=22.24  E-value=1.8e+02  Score=17.26  Aligned_cols=11  Identities=36%  Similarity=0.625  Sum_probs=9.1

Q ss_pred             CCCCCCcEEEe
Q psy2555          43 GNFKKGSVILS   53 (90)
Q Consensus        43 ~~l~~GDv~i~   53 (90)
                      +.++|||.++.
T Consensus        64 g~~~~Gd~vl~   74 (90)
T PF08541_consen   64 GRIKPGDRVLL   74 (90)
T ss_dssp             TSSCTTEEEEE
T ss_pred             CCCCCCCEEEE
Confidence            47999999875


No 130
>PF09142 TruB_C:  tRNA Pseudouridine synthase II, C terminal;  InterPro: IPR015225 Pseudouridine synthases catalyse the isomerisation of uridine to pseudouridine (Psi) in a variety of RNA molecules, and may function as RNA chaperones. Pseudouridine is the most abundant modified nucleotide found in all cellular RNAs. There are four distinct families of pseudouridine synthases that share no global sequence similarity, but which do share the same fold of their catalytic domain(s) and uracil-binding site and are descended from a common molecular ancestor. The catalytic domain consists of two subdomains, each of which has an alpha+beta structure that has some similarity to the ferredoxin-like fold (note: some pseudouridine synthases contain additional domains). The active site is the most conserved structural region of the superfamily and is located between the two homologous domains. These families are []:   Pseudouridine synthase I, TruA. Pseudouridine synthase II, TruB, which contains and additional C-terminal PUA domain. Pseudouridine synthase RsuA (ribosomal small subunit) and RluC/RluD (ribosomal large subunits), both of which contain an additional N-terminal alpha-L RNA-binding motif.  Pseudouridine synthase TruD, which has a natural circular permutation in the catalytic domain, as well as an insertion of a family-specific alpha+beta subdomain.    TruB is responsible for the pseudouridine residue present in the T loops of virtually all tRNAs. TruB recognises the preformed 3-D structure of the T loop primarily through shape complementarity. It accesses its substrate uridyl residue by flipping out the nucleotide and disrupts the tertiary structure of tRNA []. The C-terminal domain adopts a secondary structure consisting of a four-stranded beta sheet and one alpha helix, similar to that found in PUA domains. It is predominantly involved in RNA-binding, being mostly found in tRNA pseudouridine synthase B (TruB) []. ; GO: 0003723 RNA binding, 0009982 pseudouridine synthase activity, 0001522 pseudouridine synthesis, 0009451 RNA modification; PDB: 1SGV_B.
Probab=21.88  E-value=75  Score=18.29  Aligned_cols=14  Identities=43%  Similarity=0.731  Sum_probs=9.3

Q ss_pred             eeEEeCCCCCeeee
Q psy2555           6 SKESFGPDGGLVSN   19 (90)
Q Consensus         6 ~~~i~d~~G~~va~   19 (90)
                      .++.++++|+++|.
T Consensus        28 ~~aa~~pdG~lvAL   41 (56)
T PF09142_consen   28 PVAAFAPDGRLVAL   41 (56)
T ss_dssp             -EEEE-TTS-EEEE
T ss_pred             eEEEECCCCcEEEE
Confidence            46889999999984


No 131
>PF02668 TauD:  Taurine catabolism dioxygenase TauD, TfdA family;  InterPro: IPR003819 This family consists of TauD/TfdA taurine catabolism dioxygenases. The Escherichia coli tauD gene is required for the utilization of taurine (2-aminoethanesulphonic acid) as a sulphur source and is expressed only under conditions of sulphate starvation. TauD is an alpha-ketoglutarate-dependent dioxygenase catalyzing the oxygenolytic release of sulphite from taurine []. The 2,4-dichlorophenoxyacetic acid/alpha-ketoglutarate dioxygenase from Burkholderia sp. (strain RASC) also belongs to this family []. TfdA from Ralstonia eutropha (Alcaligenes eutrophus) is a 2,4-D monooxygenase [].; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3SWT_B 3R1J_A 1GVG_A 1DRT_A 1DS1_A 1DS0_A 1DRY_A 3V15_A 3PVJ_D 3V17_A ....
Probab=21.86  E-value=46  Score=23.24  Aligned_cols=12  Identities=8%  Similarity=0.539  Sum_probs=8.9

Q ss_pred             CCCCCcEEEecC
Q psy2555          44 NFKKGSVILSNH   55 (90)
Q Consensus        44 ~l~~GDv~i~ND   55 (90)
                      .|++||++|.|.
T Consensus       224 ~~~~GDlli~dN  235 (258)
T PF02668_consen  224 RWQPGDLLIWDN  235 (258)
T ss_dssp             E--TTEEEEEET
T ss_pred             cCCCceEEEEcC
Confidence            699999999886


No 132
>PF08741 YwhD:  YwhD family;  InterPro: IPR014852 The members of this entry are currently uncharacterised. They are around 170 amino acids in length. 
Probab=21.79  E-value=55  Score=23.36  Aligned_cols=28  Identities=32%  Similarity=0.550  Sum_probs=20.5

Q ss_pred             EEEecCCCC--CC--CCCCCeEEEEeeeeCCC
Q psy2555          50 VILSNHPKA--GG--SHLPDLTVITPVFIDSQ   77 (90)
Q Consensus        50 v~i~NDPy~--Gg--tHl~D~~~~~PVF~~Ge   77 (90)
                      -||.|||--  ||  .=.-|+.-++|||.|+|
T Consensus         7 nIi~~d~tdgH~G~g~Gsi~L~nvspViID~e   38 (163)
T PF08741_consen    7 NIIKNDSTDGHGGFGAGSISLNNVSPVIIDVE   38 (163)
T ss_pred             EEecCCCCCCCCCcceeeEeccccccEEEecC
Confidence            478999973  33  45567777899999964


No 133
>PHA02813 hypothetical protein; Provisional
Probab=21.76  E-value=1.2e+02  Score=24.30  Aligned_cols=33  Identities=24%  Similarity=0.438  Sum_probs=24.8

Q ss_pred             EEEecCCCCCC-C--CCC---------CeEEEEeeeeCCCCCCCc
Q psy2555          50 VILSNHPKAGG-S--HLP---------DLTVITPVFIDSQPVEEG   82 (90)
Q Consensus        50 v~i~NDPy~Gg-t--Hl~---------D~~~~~PVF~~Gel~~~~   82 (90)
                      ++.+|+|..|| |  +.+         |+.+-.++.|+|..|+++
T Consensus       127 LLYLN~~~~GGeT~f~~~~~tsI~~g~dlLFdh~l~Heg~~V~sG  171 (354)
T PHA02813        127 VLYLNNTSKGGNTNIHIKDNTIFSTKNDVLFDKTLNHSSDIITDG  171 (354)
T ss_pred             EEEEeccCCCCceEEEcCCCceEeecceEEEecccccCCcEeccC
Confidence            45689999987 2  555         777788888998776665


No 134
>KOG1170|consensus
Probab=21.73  E-value=67  Score=28.82  Aligned_cols=36  Identities=31%  Similarity=0.374  Sum_probs=27.0

Q ss_pred             EEEecCC-CCCC-----CCCCCeEEEEeeeeCCCCCCCccEEEEE
Q psy2555          50 VILSNHP-KAGG-----SHLPDLTVITPVFIDSQPVEEGPVFFVA   88 (90)
Q Consensus        50 v~i~NDP-y~Gg-----tHl~D~~~~~PVF~~Gel~~~~lv~~~a   88 (90)
                      |+|.|=| |.||     +---|-.+..|-|.|+.|   |.|+..+
T Consensus       689 IviLNIpSyaGGtNFWGsnk~dd~f~apSfDDriL---EVVAvFG  730 (1099)
T KOG1170|consen  689 IVILNIPSYAGGTNFWGSNKDDDEFTAPSFDDRIL---EVVAVFG  730 (1099)
T ss_pred             eEEEecccccCcccccCCCCCCCcccCCCccccee---EEeeeeh
Confidence            6777877 5675     456788899999999987   6666443


No 135
>cd01674 Homoaconitase_Swivel Homoaconitase swivel domain. This family includes homoaconitase and other uncharacterized proteins of the Aconitase family. Homoaconitase is part of an unusual lysine biosynthesis pathway found only in filamentous fungi, in which lysine is synthesized via the alpha-aminoadipate pathway. In this pathway, homoaconitase catalyzes the conversion of cis-homoaconitic acid into homoisocitric acid. The reaction mechanism is believed to be similar to that of other aconitases. This is the swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism.
Probab=21.71  E-value=1.4e+02  Score=20.44  Aligned_cols=32  Identities=16%  Similarity=0.287  Sum_probs=24.0

Q ss_pred             hHHHHHHHHHhcC----CCCCCCcEEEecCCCCCCC
Q psy2555          30 MQEAVKFQIDHRK----GNFKKGSVILSNHPKAGGS   61 (90)
Q Consensus        30 ~~~~v~~~~~~~~----~~l~~GDv~i~NDPy~Ggt   61 (90)
                      .....+++++.+.    ..+++|||++.-.=|-.|+
T Consensus        24 ~e~la~~~~e~~dp~f~~~v~~gdilVaG~nFG~GS   59 (129)
T cd01674          24 PEKMAEVCMENYDSEFSTKTKQGDILVSGFNFGTGS   59 (129)
T ss_pred             HHHHHHhhcccCCchhhhcCCCCCEEEeCCccCCCC
Confidence            4556677777764    4689999999999887553


No 136
>PF05382 Amidase_5:  Bacteriophage peptidoglycan hydrolase ;  InterPro: IPR008044 This entry is represented by Bacteriophage SFi21, lysin (Cell wall hydrolase; 3.5.1.28 from EC). At least one of proteins in this entry, the Pal protein from the pneumococcal bacteriophage Dp-1 (O03979 from SWISSPROT) has been shown to be an N-acetylmuramoyl-L-alanine amidase []. According to the known modular structure of this and other peptidoglycan hydrolases from the pneumococcal system, the active site should reside within this domain while a C-terminal domain binds to the choline residues of the cell wall teichoic acids [, ].
Probab=21.64  E-value=67  Score=22.24  Aligned_cols=13  Identities=15%  Similarity=0.534  Sum_probs=11.3

Q ss_pred             CCCCCcEEEecCC
Q psy2555          44 NFKKGSVILSNHP   56 (90)
Q Consensus        44 ~l~~GDv~i~NDP   56 (90)
                      +++.|||+|...+
T Consensus        75 ~~q~GDI~I~g~~   87 (145)
T PF05382_consen   75 NLQRGDIFIWGRR   87 (145)
T ss_pred             cccCCCEEEEcCC
Confidence            6899999998776


No 137
>PF01505 Vault:  Major Vault Protein repeat;  InterPro: IPR002499 Vaults are the largest ribonucleoprotein particles known, having a mass of approximately 13 MDa. They are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction and may also play a role in nucleo-cytoplasmic transport. Vaults are present in most normal tissues, but are more highly expressed in epithelial cells with secretory and excretory functions, as well as in cells chronically exposed to xenobiotics, such as bronchial cells and cells lining the intestine []. Overexpression of these proteins is linked with multidrug-resistance in cancer cells. The mammalian vault structure is highly regular and consists of approximately 96 molecules of the 100 kDa major vault protein (MVP), 2 molecules of the 240 kDa minor vault protein TEP1, 8 molecules of the 193 kDa minor vault protein VPARP and at least 6 copies of a small untranslated RNA of 88-141 bases. The MVP molecules form the core of the complex, which is a barrel-like structure with an invaginated waist and two protruding caps. The complex can unfold into two symmetrical flower-like structures with 8 petals each supposedly consisting of 6 MVP molecules [].  The MVP protein is composed of two distinct domains []. The N-terminal domain contains ~8 copies of the vault repeat (or MVP repeat) in tandem. The MVP repeat is composed of ~53 amino acids and forms a structural part of the vault wall. The C-terminal part of MVP may be involved in oligomerization and be located in the vault cap, while the MVP repeats in the N-terminal part can be packed like staves in a barrel to form the vault wall. The 3D structure of the repeat forms a fold that consists of a three stranded (B) antiparallel beta-sheet in a unique topology B2-B1-B3 and two loops. MVP repeats can be interaction-mediating modules, as MVP repeats 3 and 4 bind VPARP, which is one of the other vault proteins.; PDB: 3GF5_A 3GNG_A 3GNF_B 2ZUO_G 2QZV_B 2ZV5_c 2ZV4_Y 1Y7X_A.
Probab=21.60  E-value=55  Score=17.78  Aligned_cols=19  Identities=32%  Similarity=0.513  Sum_probs=14.2

Q ss_pred             CCCCCcEEEecCCCCCCCCCCC
Q psy2555          44 NFKKGSVILSNHPKAGGSHLPD   65 (90)
Q Consensus        44 ~l~~GDv~i~NDPy~GgtHl~D   65 (90)
                      .-++||.++..-|   +++.|+
T Consensus        25 ~R~~Ge~WLv~gP---~~YiP~   43 (43)
T PF01505_consen   25 KRKAGEEWLVTGP---GTYIPR   43 (43)
T ss_dssp             EECTTEEEEEESS---SEECST
T ss_pred             EEeCCCEEEEeCC---eeEcCC
Confidence            4688999999888   555553


No 138
>PRK05967 cystathionine beta-lyase; Provisional
Probab=21.35  E-value=1.2e+02  Score=23.98  Aligned_cols=29  Identities=14%  Similarity=-0.046  Sum_probs=21.1

Q ss_pred             HHHHHHHHHhcCCCCCCCcEEEecCCCCCCCC
Q psy2555          31 QEAVKFQIDHRKGNFKKGSVILSNHPKAGGSH   62 (90)
Q Consensus        31 ~~~v~~~~~~~~~~l~~GDv~i~NDPy~GgtH   62 (90)
                      ..++..++..+   ++|||-++..+|..+++.
T Consensus        89 ~aAi~~~l~al---l~~GD~Vlv~~~~Y~~~~  117 (395)
T PRK05967         89 LAAVTVPFLGF---LSPGDHALIVDSVYYPTR  117 (395)
T ss_pred             HHHHHHHHHHh---cCCCCEEEEccCCcHHHH
Confidence            34555555444   899999999999887754


No 139
>PRK13699 putative methylase; Provisional
Probab=21.13  E-value=1.3e+02  Score=21.74  Aligned_cols=22  Identities=23%  Similarity=0.377  Sum_probs=15.5

Q ss_pred             HHHHHHhcCCCCCCCcEEEecCCCCCC
Q psy2555          34 VKFQIDHRKGNFKKGSVILSNHPKAGG   60 (90)
Q Consensus        34 v~~~~~~~~~~l~~GDv~i~NDPy~Gg   60 (90)
                      ++.+++.+   -++||+++  |||.|+
T Consensus       153 ~~~~i~~~---s~~g~~vl--Dpf~Gs  174 (227)
T PRK13699        153 LQPLIESF---THPNAIVL--DPFAGS  174 (227)
T ss_pred             HHHHHHHh---CCCCCEEE--eCCCCC
Confidence            35566655   36999877  999874


No 140
>KOG4207|consensus
Probab=21.11  E-value=1.1e+02  Score=23.25  Aligned_cols=29  Identities=7%  Similarity=0.161  Sum_probs=23.6

Q ss_pred             chHHHHHHHHHhcCCCCCCCcEEEecCCCCCC
Q psy2555          29 SMQEAVKFQIDHRKGNFKKGSVILSNHPKAGG   60 (90)
Q Consensus        29 ~~~~~v~~~~~~~~~~l~~GDv~i~NDPy~Gg   60 (90)
                      +.+..++.+.++|+   +-|||+|--|+|+..
T Consensus        25 Tspd~LrrvFekYG---~vgDVyIPrdr~Tr~   53 (256)
T KOG4207|consen   25 TSPDDLRRVFEKYG---RVGDVYIPRDRYTRQ   53 (256)
T ss_pred             CCHHHHHHHHHHhC---cccceeccccccccc
Confidence            45667788999886   569999999999863


No 141
>PF03260 Lipoprotein_11:  Lepidopteran low molecular weight (30 kD) lipoprotein;  InterPro: IPR004943  This family includes Lepidopteran low molecular weight (30 kDa) lipoprotein, which is an extracellular protein of unknown function. Biosynthesis occurs in a stage-dependent fashion in the fat body. ; GO: 0005576 extracellular region; PDB: 3PUB_B.
Probab=20.90  E-value=1.1e+02  Score=23.42  Aligned_cols=20  Identities=30%  Similarity=0.514  Sum_probs=16.6

Q ss_pred             eEEEEeeeeCCCCCCCccEEEEEeC
Q psy2555          66 LTVITPVFIDSQPVEEGPVFFVANR   90 (90)
Q Consensus        66 ~~~~~PVF~~Gel~~~~lv~~~a~~   90 (90)
                      ...+.|+-++|++     ++|.-+|
T Consensus       193 ~WyLqP~~~~~~l-----LFfI~NR  212 (253)
T PF03260_consen  193 QWYLQPVKYNGEL-----LFFIYNR  212 (253)
T ss_dssp             -EEEEEEEETTEE-----EEEEEET
T ss_pred             EEEEEeEEeCCee-----EEEEEeh
Confidence            4688999999987     9998776


No 142
>PF02311 AraC_binding:  AraC-like ligand binding domain;  InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC. The crystal structure of the arabinose-binding and dimerization domain of the Escherichia coli gene regulatory protein AraC was determined in the presence and absence of L-arabinose. The arabinose-bound molecule shows that the protein adopts an unusual fold, binding sugar within a beta barrel and completely burying the arabinose with the amino-terminal arm of the protein. Dimer contacts in the presence of arabinose are mediated by an antiparallel coiled-coil. In the uncomplexed protein, the amino-terminal arm is disordered, uncovering the sugar-binding pocket and allowing it to serve as an oligomerization interface [].; GO: 0006355 regulation of transcription, DNA-dependent; PDB: 1XJA_B 2ARA_A 2AAC_B 2ARC_A.
Probab=20.86  E-value=51  Score=20.07  Aligned_cols=12  Identities=25%  Similarity=0.384  Sum_probs=7.5

Q ss_pred             CCCCCcEEEecC
Q psy2555          44 NFKKGSVILSNH   55 (90)
Q Consensus        44 ~l~~GDv~i~ND   55 (90)
                      .++|||+++.|-
T Consensus        44 ~l~~g~~~li~p   55 (136)
T PF02311_consen   44 PLKPGDLFLIPP   55 (136)
T ss_dssp             EE-TT-EEEE-T
T ss_pred             EEECCEEEEecC
Confidence            589999999873


No 143
>PRK08202 purine nucleoside phosphorylase; Provisional
Probab=20.82  E-value=67  Score=23.98  Aligned_cols=14  Identities=21%  Similarity=0.458  Sum_probs=12.0

Q ss_pred             CCCCCcEEEecCCC
Q psy2555          44 NFKKGSVILSNHPK   57 (90)
Q Consensus        44 ~l~~GDv~i~NDPy   57 (90)
                      ++++||+++.+|=.
T Consensus       120 ~l~~GDiVi~~d~i  133 (272)
T PRK08202        120 DFGPGDLMLISDHI  133 (272)
T ss_pred             CCCCCCEEEEchhh
Confidence            69999999999853


No 144
>PHA03200 uracil DNA glycosylase; Provisional
Probab=20.82  E-value=99  Score=23.52  Aligned_cols=20  Identities=25%  Similarity=0.238  Sum_probs=14.1

Q ss_pred             EEEecCCCCCCCCCCCeEEEE
Q psy2555          50 VILSNHPKAGGSHLPDLTVIT   70 (90)
Q Consensus        50 v~i~NDPy~GgtHl~D~~~~~   70 (90)
                      ||+-.|||.+ .+..=+++-.
T Consensus        88 VIlGQDPYh~-gqA~GLaFSV  107 (255)
T PHA03200         88 VIVGQDPYHD-GSACGLAFGT  107 (255)
T ss_pred             EEEecCCCCC-CccceEEEEe
Confidence            7899999998 5555444443


No 145
>PF08918 PhoQ_Sensor:  PhoQ Sensor;  InterPro: IPR015014 The PhoQ Sensor is required for the virulence of various Gram-negative bacteria by allowing interaction of PhoPQ with the intracellular membrane, resulting in remodelling of the bacterial cell surface and subsequent bacterial resistance to host antimicrobial peptides. The domain contains a major flat acidic surface, which binds to at least 3 calcium ions, neutralising the domain's negative charge and allowing interaction with the negatively charged membrane []. ; GO: 0004673 protein histidine kinase activity, 0005524 ATP binding, 0046872 metal ion binding, 0000160 two-component signal transduction system (phosphorelay), 0018106 peptidyl-histidine phosphorylation, 0016020 membrane; PDB: 1YAX_D 3BQA_B 3BQ8_B.
Probab=20.81  E-value=58  Score=23.59  Aligned_cols=19  Identities=16%  Similarity=0.300  Sum_probs=13.4

Q ss_pred             eEEeCCCCCeeeecCCCce
Q psy2555           7 KESFGPDGGLVSNAPHIPV   25 (90)
Q Consensus         7 ~~i~d~~G~~va~~~g~p~   25 (90)
                      +-|||.+|+++++...+|.
T Consensus        77 ~~IYD~~G~lLW~qr~vP~   95 (180)
T PF08918_consen   77 VLIYDENGKLLWRQRDVPE   95 (180)
T ss_dssp             EEEEETTS-EEEESS--HH
T ss_pred             EEEEcCCCcEEEecCccHH
Confidence            4699999999998777663


No 146
>PRK06666 fliM flagellar motor switch protein FliM; Validated
Probab=20.55  E-value=86  Score=23.80  Aligned_cols=26  Identities=31%  Similarity=0.483  Sum_probs=18.7

Q ss_pred             ecchHHHHHHHHHhcCCCCCCCcEEEecCCC
Q psy2555          27 LGSMQEAVKFQIDHRKGNFKKGSVILSNHPK   57 (90)
Q Consensus        27 ~g~~~~~v~~~~~~~~~~l~~GDv~i~NDPy   57 (90)
                      +|.....++.++     +|++|||+-.|-+.
T Consensus       266 L~~~~i~l~dll-----~L~vGDVI~L~~~~  291 (337)
T PRK06666        266 LGEIKLTLSEIL-----NLKVGDVIPLEKPA  291 (337)
T ss_pred             EecceeeHHHHh-----CCCCCCEEEeCCCC
Confidence            444455555554     79999999999875


No 147
>PF00122 E1-E2_ATPase:  E1-E2 ATPase p-type cation-transporting ATPase superfamily signature H+-transporting ATPase (proton pump) signature sodium/potassium-transporting ATPase signature;  InterPro: IPR008250 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   P-ATPases (sometime known as E1-E2 ATPases) (3.6.3.- from EC) are found in bacteria and in a number of eukaryotic plasma membranes and organelles []. P-ATPases function to transport a variety of different compounds, including ions and phospholipids, across a membrane using ATP hydrolysis for energy. There are many different classes of P-ATPases, each of which transports a specific type of ion: H+, Na+, K+, Mg2+, Ca2+, Ag+ and Ag2+, Zn2+, Co2+, Pb2+, Ni2+, Cd2+, Cu+ and Cu2+. P-ATPases can be composed of one or two polypeptides, and can usually assume two main conformations called E1 and E2. This entry represents the actuator (A) domain, and some transmembrane helices found in P-type ATPases []. It contains the TGES-loop which is essential for the metal ion binding which results in tight association between the A and P (phosphorylation) domains []. It does not contain the phosphorylation site. It is thought that the large movement of the actuator domain, which is transmitted to the transmembrane helices, is essential to the long distance coupling between formation/decomposition of the acyl phosphate in the cytoplasmic P-domain and the changes in the ion-binding sites buried deep in the membranous region []. This domain has a modulatory effect on the phosphoenzyme processing steps through its nucleotide binding [],[].  P-type (or E1-E2-type) ATPases that form an aspartyl phosphate intermediate in the course of ATP hydrolysis, can be divided into 4 major groups []: (1) Ca2+-transporting ATPases; (2) Na+/K+- and gastric H+/K+-transporting ATPases; (3) plasma membrane H+-transporting ATPases (proton pumps) of plants, fungi and lower eukaryotes; and (4) all bacterial P-type ATPases, except the g2+-ATPase of Salmonella typhimurium, which is more similar to the eukaryotic sequences. However, great variety of sequence analysis methods results in diversity of classification. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0000166 nucleotide binding, 0046872 metal ion binding; PDB: 2XZB_A 1MHS_B 3TLM_A 3A3Y_A 2ZXE_A 3NAL_A 3NAM_A 3NAN_A 2YJ6_B 2IYE_A ....
Probab=20.46  E-value=57  Score=22.71  Aligned_cols=25  Identities=16%  Similarity=0.282  Sum_probs=18.3

Q ss_pred             CCCCCCcEEEecCCCCCCCCCCCeEEEE
Q psy2555          43 GNFKKGSVILSNHPKAGGSHLPDLTVIT   70 (90)
Q Consensus        43 ~~l~~GDv~i~NDPy~GgtHl~D~~~~~   70 (90)
                      .+++|||+++.+.   |-.=+.|..++.
T Consensus        50 ~~L~~GDiI~l~~---g~~vPaD~~ll~   74 (230)
T PF00122_consen   50 SELVPGDIIILKA---GDIVPADGILLE   74 (230)
T ss_dssp             GGT-TTSEEEEET---TEBESSEEEEEE
T ss_pred             hhccceeeeeccc---ccccccCcccee
Confidence            4799999999865   446677777776


No 148
>COG0791 Spr Cell wall-associated hydrolases (invasion-associated proteins) [Cell envelope biogenesis, outer membrane]
Probab=20.41  E-value=85  Score=21.67  Aligned_cols=12  Identities=17%  Similarity=0.551  Sum_probs=10.9

Q ss_pred             CCCCCcEEEecC
Q psy2555          44 NFKKGSVILSNH   55 (90)
Q Consensus        44 ~l~~GDv~i~ND   55 (90)
                      ++++||+++.|.
T Consensus       138 ~~~~GDlvff~~  149 (197)
T COG0791         138 DLQPGDLVFFNT  149 (197)
T ss_pred             hCCCCCEEEEec
Confidence            589999999997


No 149
>PF00717 Peptidase_S24:  Peptidase S24-like peptidase classification. ;  InterPro: IPR019759 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ].; PDB: 1KCA_H 3BDN_A 1F39_A 1JHH_A 1JHE_B 3JSP_A 1JHF_B 1JHC_A 3JSO_B 1B12_D ....
Probab=20.33  E-value=61  Score=18.22  Aligned_cols=12  Identities=25%  Similarity=0.614  Sum_probs=9.9

Q ss_pred             CCCCCCcEEEec
Q psy2555          43 GNFKKGSVILSN   54 (90)
Q Consensus        43 ~~l~~GDv~i~N   54 (90)
                      +.+++||+++.+
T Consensus         9 P~i~~Gd~v~v~   20 (70)
T PF00717_consen    9 PTIKDGDIVLVD   20 (70)
T ss_dssp             GTSSTTEEEEEE
T ss_pred             cCeeCCCEEEEE
Confidence            468899999887


No 150
>PF02721 DUF223:  Domain of unknown function DUF223;  InterPro: IPR003871 The function of this domain has not been characterised, but may be involved in nucleic acid or nucleotide binding. 
Probab=20.30  E-value=1e+02  Score=19.05  Aligned_cols=19  Identities=32%  Similarity=0.281  Sum_probs=13.1

Q ss_pred             HHHHHhcCCCCCCCcEEEe
Q psy2555          35 KFQIDHRKGNFKKGSVILS   53 (90)
Q Consensus        35 ~~~~~~~~~~l~~GDv~i~   53 (90)
                      +..+++|...|+||.++..
T Consensus        18 ~~~~~~f~~~l~Eg~~y~i   36 (95)
T PF02721_consen   18 KELVDKFKDSLKEGSWYTI   36 (95)
T ss_pred             HHHHHHHHhhcccCCEEEe
Confidence            4455556667899998764


No 151
>PRK13261 ureE urease accessory protein UreE; Provisional
Probab=20.23  E-value=71  Score=22.03  Aligned_cols=12  Identities=17%  Similarity=0.523  Sum_probs=11.2

Q ss_pred             CCCCCcEEEecC
Q psy2555          44 NFKKGSVILSNH   55 (90)
Q Consensus        44 ~l~~GDv~i~ND   55 (90)
                      .|++||++..+|
T Consensus        55 ~L~dGDvL~~d~   66 (159)
T PRK13261         55 VLRDGDVLFLDD   66 (159)
T ss_pred             ccCCCCEEEeCC
Confidence            599999999998


No 152
>COG3971 2-keto-4-pentenoate hydratase [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=20.15  E-value=1.5e+02  Score=22.81  Aligned_cols=48  Identities=10%  Similarity=0.093  Sum_probs=26.8

Q ss_pred             EEeCCCCCeeeecC--CCceeecchHHHHHHHHHhcCCCCCCCcEEEecC
Q psy2555           8 ESFGPDGGLVSNAP--HIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNH   55 (90)
Q Consensus         8 ~i~d~~G~~va~~~--g~p~~~g~~~~~v~~~~~~~~~~l~~GDv~i~ND   55 (90)
                      ++.+++|.....+.  +++-|--.--......+..++..|+-|||+++-.
T Consensus       185 ~~l~rng~~~e~g~~aavLghP~~a~~wLAn~~a~~G~~Lk~G~IVl~Gs  234 (264)
T COG3971         185 ATLYRNGVEEETGVGAAVLGHPAAALAWLANKLAAYGVPLKAGDIVLTGS  234 (264)
T ss_pred             ceeeecCEEEEeeechhhcCCcHHHHHHHHHHHHHcCCCcccCcEEecCc
Confidence            45566776665433  3444432212222333445667899999998743


No 153
>PF11814 DUF3335:  Peptidase_C39 like family;  InterPro: IPR021770  This family of proteins are functionally uncharacterised. This family is only found in bacteria. This presumed domain is typically between 226 to 230 amino acids in length. 
Probab=20.13  E-value=74  Score=23.48  Aligned_cols=14  Identities=7%  Similarity=0.257  Sum_probs=12.4

Q ss_pred             CCCcEEEecCCCCC
Q psy2555          46 KKGSVILSNHPKAG   59 (90)
Q Consensus        46 ~~GDv~i~NDPy~G   59 (90)
                      .++|.++.||||..
T Consensus       155 ~d~~~vyihDP~~d  168 (207)
T PF11814_consen  155 VDDDFVYIHDPDVD  168 (207)
T ss_pred             ecCCEEEEeCCCCC
Confidence            47899999999986


Done!