Diaphorina citri psyllid: psy2555

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MNNFVSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAGGSHLPDLTVITPVFIDSQPVEEGPVFFVANR
ccccEEEEEEcccccEEECccccccccccHHHHHHHHHHHcccccccccEEEEcccccccccccccEEEEEEECcccccccccEEEEECc
**NFVSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAGGSHLPDLTVITPVFIDSQPVEEGPVFFVANR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNFVSKESFGPDGGLVSNAPHIPVHLGSMQEAVKFQIDHRKGNFKKGSVILSNHPKAGGSHLPDLTVITPVFIDSQPVEEGPVFFVANR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
5-oxoprolinase Catalyzes the cleavage of 5-oxo-L-proline to form L-glutamate coupled to the hydrolysis of ATP to ADP and inorganic phosphate.confidentO14841
5-oxoprolinase Catalyzes the cleavage of 5-oxo-L-proline to form L-glutamate coupled to the hydrolysis of ATP to ADP and inorganic phosphate.confidentQ8K010
5-oxoprolinase Catalyzes the cleavage of 5-oxo-L-proline to form L-glutamate coupled to the hydrolysis of ATP to ADP and inorganic phosphate.confidentP97608

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0017168 [MF]5-oxoprolinase (ATP-hydrolyzing) activityprobableGO:0016812, GO:0016787, GO:0016810, GO:0003674, GO:0003824
GO:0006805 [BP]xenobiotic metabolic processprobableGO:0051716, GO:0008152, GO:0050896, GO:0009987, GO:0044763, GO:0009410, GO:0044237, GO:0071466, GO:0008150, GO:0070887, GO:0042221, GO:0044699
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006750 [BP]glutathione biosynthetic processprobableGO:0044238, GO:0042398, GO:0019752, GO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:0044283, GO:1901576, GO:0044710, GO:0044711, GO:0006520, GO:0043043, GO:0071704, GO:0019184, GO:0006749, GO:0043604, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044271, GO:0008652, GO:1901564, GO:0006575, GO:1901566, GO:0044272, GO:0046394, GO:0016053, GO:0044237, GO:0006790, GO:0043603, GO:0006518, GO:0006082
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted