Query         psy2574
Match_columns 115
No_of_seqs    107 out of 233
Neff          3.2 
Searched_HMMs 46136
Date          Fri Aug 16 19:39:51 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2574.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2574hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PTZ00083 40S ribosomal protein 100.0 4.5E-48 9.8E-53  271.3   7.4   79    2-80      3-81  (85)
  2 PLN00209 ribosomal protein S27 100.0 1.4E-47   3E-52  269.3   7.6   78    3-80      5-82  (86)
  3 KOG1779|consensus              100.0 2.7E-44 5.9E-49  251.4   7.2   80    1-80      1-80  (84)
  4 PF01667 Ribosomal_S27e:  Ribos 100.0   8E-34 1.7E-38  185.4   4.1   52   28-79      1-52  (55)
  5 PRK00415 rps27e 30S ribosomal  100.0 2.6E-32 5.6E-37  180.7   5.3   52   24-75      1-52  (59)
  6 COG2051 RPS27A Ribosomal prote 100.0 1.3E-29 2.9E-34  171.6   5.3   56   22-77      6-62  (67)
  7 PF08271 TF_Zn_Ribbon:  TFIIB z  97.2 0.00037 8.1E-09   42.1   2.7   31   36-66      2-32  (43)
  8 TIGR02098 MJ0042_CXXC MJ0042 f  95.7   0.014   3E-07   33.9   2.9   32   33-64      1-36  (38)
  9 PRK00423 tfb transcription ini  95.2   0.012 2.6E-07   48.0   2.2   32   35-66     12-43  (310)
 10 PRK00398 rpoP DNA-directed RNA  95.0   0.033 7.2E-07   33.9   3.1   36   33-69      2-37  (46)
 11 PF13719 zinc_ribbon_5:  zinc-r  93.1    0.11 2.4E-06   30.8   2.7   31   33-63      1-35  (37)
 12 PF13248 zf-ribbon_3:  zinc-rib  92.5   0.039 8.4E-07   30.5   0.1   26   33-63      1-26  (26)
 13 smart00834 CxxC_CXXC_SSSS Puta  91.5    0.27 5.8E-06   28.3   3.0   31   33-63      4-36  (41)
 14 PF13717 zinc_ribbon_4:  zinc-r  89.1    0.46 9.9E-06   28.1   2.6   31   33-63      1-35  (36)
 15 PF11023 DUF2614:  Protein of u  88.9    0.17 3.7E-06   37.7   0.8   34   30-66     65-98  (114)
 16 COG1405 SUA7 Transcription ini  87.9    0.42 9.1E-06   39.6   2.5   30   36-65      3-32  (285)
 17 PF01096 TFIIS_C:  Transcriptio  87.5    0.64 1.4E-05   27.8   2.5   28   35-62      1-37  (39)
 18 PRK14892 putative transcriptio  87.4    0.72 1.6E-05   33.2   3.1   29   35-63     22-52  (99)
 19 TIGR02605 CxxC_CxxC_SSSS putat  87.1    0.74 1.6E-05   28.0   2.7   29   33-61      4-34  (52)
 20 PF09723 Zn-ribbon_8:  Zinc rib  84.3     1.4 3.1E-05   26.5   3.0   30   32-61      3-34  (42)
 21 PRK03681 hypA hydrogenase nick  83.5    0.93   2E-05   32.5   2.2   37   33-72     69-106 (114)
 22 TIGR01206 lysW lysine biosynth  83.4     1.2 2.6E-05   29.0   2.4   32   33-64      1-33  (54)
 23 TIGR01384 TFS_arch transcripti  83.2     1.2 2.5E-05   30.6   2.5   29   33-61     61-98  (104)
 24 smart00659 RPOLCX RNA polymera  82.7     1.8 3.9E-05   26.8   3.0   30   33-64      1-30  (44)
 25 PF05907 DUF866:  Eukaryotic pr  82.7     1.8 3.9E-05   33.0   3.6   37   27-63     23-74  (161)
 26 PF13240 zinc_ribbon_2:  zinc-r  82.5    0.48   1E-05   25.8   0.3   23   36-63      1-23  (23)
 27 PRK12380 hydrogenase nickel in  82.0       1 2.2E-05   32.3   1.9   36   33-71     69-104 (113)
 28 smart00440 ZnF_C2C2 C2C2 Zinc   81.7     2.2 4.7E-05   25.7   3.0   27   36-62      2-37  (40)
 29 TIGR00100 hypA hydrogenase nic  81.2     1.1 2.4E-05   32.1   1.9   36   33-71     69-104 (115)
 30 PF02150 RNA_POL_M_15KD:  RNA p  81.2     1.8 3.9E-05   25.5   2.5   28   36-63      3-30  (35)
 31 PRK02935 hypothetical protein;  80.5       1 2.2E-05   33.5   1.5   36   29-67     65-100 (110)
 32 COG2888 Predicted Zn-ribbon RN  77.6       3 6.5E-05   28.3   2.9   34   27-60     20-57  (61)
 33 COG4888 Uncharacterized Zn rib  75.5     3.9 8.5E-05   30.2   3.3   28   35-62     23-55  (104)
 34 PRK00420 hypothetical protein;  75.1     2.3 5.1E-05   31.3   2.1   35   33-69     22-56  (112)
 35 PRK03824 hypA hydrogenase nick  74.7     2.5 5.5E-05   31.1   2.2   37   33-72     69-126 (135)
 36 TIGR00311 aIF-2beta translatio  74.6     3.3 7.2E-05   30.9   2.8   28   35-62     98-127 (133)
 37 PF10571 UPF0547:  Uncharacteri  73.7     1.5 3.2E-05   24.7   0.6   23   36-63      2-24  (26)
 38 smart00653 eIF2B_5 domain pres  73.2       4 8.7E-05   29.5   2.9   27   35-61     81-109 (110)
 39 TIGR01053 LSD1 zinc finger dom  72.6     2.1 4.6E-05   25.0   1.1   18   54-71      2-19  (31)
 40 PRK00432 30S ribosomal protein  72.5     3.3 7.1E-05   26.2   2.0   29   34-64     20-48  (50)
 41 PRK03988 translation initiatio  71.9     4.4 9.5E-05   30.5   2.9   28   35-62    103-132 (138)
 42 COG1594 RPB9 DNA-directed RNA   71.8     3.6 7.8E-05   29.8   2.4   29   34-62     72-109 (113)
 43 KOG1597|consensus               71.7       3 6.6E-05   35.7   2.3   42   36-82      2-45  (308)
 44 COG4416 Com Mu-like prophage p  70.1       3 6.5E-05   28.1   1.5   26   24-49     14-39  (60)
 45 PHA00626 hypothetical protein   68.0     5.2 0.00011   27.0   2.3   31   36-66      2-36  (59)
 46 PRK00564 hypA hydrogenase nick  67.9     2.6 5.7E-05   30.3   1.0   36   33-71     70-106 (117)
 47 KOG3507|consensus               67.8     5.4 0.00012   27.1   2.4   34   28-63     14-47  (62)
 48 PF14319 Zn_Tnp_IS91:  Transpos  67.8     4.8  0.0001   28.8   2.3   36   26-62     34-69  (111)
 49 PF08792 A2L_zn_ribbon:  A2L zi  67.8       9 0.00019   22.5   3.1   29   34-63      3-31  (33)
 50 PRK12336 translation initiatio  67.5     5.9 0.00013   31.0   2.9   28   35-62     99-128 (201)
 51 PF09855 DUF2082:  Nucleic-acid  66.1     5.9 0.00013   26.5   2.3    8   53-60     36-43  (64)
 52 PF03604 DNA_RNApol_7kD:  DNA d  65.4     2.1 4.5E-05   25.2   0.0   25   36-62      2-26  (32)
 53 PRK14890 putative Zn-ribbon RN  65.3     9.4  0.0002   25.6   3.2   34   27-60     18-55  (59)
 54 PRK00762 hypA hydrogenase nick  65.2     3.5 7.6E-05   29.9   1.2   39   33-72     69-111 (124)
 55 PRK08197 threonine synthase; V  64.3     5.8 0.00013   33.1   2.5   32   28-63      1-32  (394)
 56 PF13453 zf-TFIIB:  Transcripti  64.1       9  0.0002   22.6   2.6   27   36-62      1-28  (41)
 57 PF10263 SprT-like:  SprT-like   63.2      12 0.00025   26.7   3.6   35   31-65    120-155 (157)
 58 smart00531 TFIIE Transcription  62.5     5.2 0.00011   29.4   1.7   40   23-65     90-135 (147)
 59 PF03884 DUF329:  Domain of unk  61.7     5.7 0.00012   26.2   1.6   14   33-46      1-14  (57)
 60 smart00647 IBR In Between Ring  61.6     9.8 0.00021   22.9   2.6   31   35-65     19-52  (64)
 61 PRK05978 hypothetical protein;  61.4     3.2 6.9E-05   31.8   0.4   39   28-66     27-65  (148)
 62 PF12760 Zn_Tnp_IS1595:  Transp  60.7      11 0.00024   22.7   2.7   27   35-61     19-45  (46)
 63 PF08274 PhnA_Zn_Ribbon:  PhnA   60.7     7.7 0.00017   22.6   1.8   25   36-62      4-28  (30)
 64 PRK07591 threonine synthase; V  60.4     6.6 0.00014   33.3   2.2   31   30-64     14-44  (421)
 65 PHA02998 RNA polymerase subuni  59.4     7.6 0.00016   31.4   2.2   35   33-67    142-185 (195)
 66 PF05191 ADK_lid:  Adenylate ki  59.2     4.3 9.2E-05   24.2   0.6   31   35-65      2-33  (36)
 67 PF08063 PADR1:  PADR1 (NUC008)  58.9     7.8 0.00017   24.9   1.9   21   35-57     15-35  (55)
 68 PF01873 eIF-5_eIF-2B:  Domain   58.8     9.1  0.0002   28.2   2.4   28   35-62     94-123 (125)
 69 PF10122 Mu-like_Com:  Mu-like   58.8     8.6 0.00019   25.2   2.0   19   30-48     20-38  (51)
 70 PF01485 IBR:  IBR domain;  Int  57.9     4.5 9.7E-05   24.4   0.6   47   20-69      7-56  (64)
 71 PRK12496 hypothetical protein;  57.7     4.6 9.9E-05   30.7   0.7   28   35-65    128-155 (164)
 72 PF01155 HypA:  Hydrogenase exp  56.5     3.4 7.3E-05   29.4  -0.2   35   33-70     69-103 (113)
 73 COG0675 Transposase and inacti  56.4      13 0.00028   28.2   2.9   36   21-62    296-331 (364)
 74 PF09862 DUF2089:  Protein of u  56.0      13 0.00028   27.4   2.8   22   37-63      1-22  (113)
 75 PF14354 Lar_restr_allev:  Rest  56.0      15 0.00033   22.7   2.8   25   37-61      6-37  (61)
 76 smart00661 RPOL9 RNA polymeras  54.9      10 0.00022   22.6   1.8   27   37-63      3-30  (52)
 77 TIGR02443 conserved hypothetic  54.7      19 0.00041   24.1   3.2   35   35-69     10-47  (59)
 78 PF09082 DUF1922:  Domain of un  53.8      17 0.00037   24.9   2.9   29   32-64      1-30  (68)
 79 PF06827 zf-FPG_IleRS:  Zinc fi  53.7      18 0.00039   19.9   2.6   26   36-61      3-29  (30)
 80 TIGR01385 TFSII transcription   53.4      12 0.00026   31.3   2.5   28   34-61    258-294 (299)
 81 PF11781 RRN7:  RNA polymerase   52.6      15 0.00033   21.8   2.3   26   36-63     10-35  (36)
 82 PF05129 Elf1:  Transcription e  51.8      18  0.0004   24.7   2.9   39   22-63     13-56  (81)
 83 PF03811 Zn_Tnp_IS1:  InsA N-te  51.2      12 0.00025   22.5   1.6   19   33-51      4-22  (36)
 84 COG1326 Uncharacterized archae  50.4      13 0.00028   30.3   2.2   31   33-63      5-40  (201)
 85 COG3877 Uncharacterized protei  50.4      13 0.00028   28.1   2.1   29   30-63      2-30  (122)
 86 PF06943 zf-LSD1:  LSD1 zinc fi  49.5      12 0.00025   21.2   1.3   15   56-70      1-15  (25)
 87 PF07295 DUF1451:  Protein of u  49.4      11 0.00024   28.5   1.6   28   35-63    113-140 (146)
 88 PF09332 Mcm10:  Mcm10 replicat  49.0       8 0.00017   33.2   0.9   33   35-68    286-318 (344)
 89 PRK13130 H/ACA RNA-protein com  48.5      14 0.00031   24.2   1.8   22   35-63      6-27  (56)
 90 PF12773 DZR:  Double zinc ribb  48.4     8.6 0.00019   23.0   0.7   12   53-64     12-23  (50)
 91 PF08996 zf-DNA_Pol:  DNA Polym  47.7      19 0.00042   27.5   2.7   32   33-64     17-56  (188)
 92 PF13901 DUF4206:  Domain of un  47.2     9.9 0.00021   29.5   1.1   28   36-63    154-182 (202)
 93 PF09526 DUF2387:  Probable met  46.9      27 0.00058   23.7   3.0   34   35-68      9-45  (71)
 94 PF10080 DUF2318:  Predicted me  46.9      49  0.0011   23.8   4.5   30   47-78     46-75  (102)
 95 PF05180 zf-DNL:  DNL zinc fing  46.0      13 0.00029   25.1   1.4   18   32-49     27-44  (66)
 96 TIGR00319 desulf_FeS4 desulfof  45.0      28 0.00061   19.7   2.5   22   35-56      8-29  (34)
 97 cd00974 DSRD Desulforedoxin (D  44.6      28 0.00061   19.8   2.5   22   35-56      5-26  (34)
 98 PRK14873 primosome assembly pr  44.1      29 0.00062   31.9   3.7   48   22-79    370-418 (665)
 99 PF05077 DUF678:  Protein of un  44.0      18 0.00038   25.4   1.8   48   15-65      8-69  (74)
100 PF06677 Auto_anti-p27:  Sjogre  43.3      21 0.00046   21.9   1.9   26   33-60     16-41  (41)
101 PF01780 Ribosomal_L37ae:  Ribo  43.3      29 0.00062   24.9   2.9   29   35-64     36-64  (90)
102 PF03119 DNA_ligase_ZBD:  NAD-d  43.1      16 0.00034   20.6   1.2   18   55-72      1-18  (28)
103 COG1997 RPL43A Ribosomal prote  42.7      29 0.00062   25.1   2.8   30   35-65     36-65  (89)
104 PRK11032 hypothetical protein;  42.0      17 0.00037   28.1   1.7   28   35-63    125-152 (160)
105 PF15288 zf-CCHC_6:  Zinc knuck  41.7     8.8 0.00019   23.9   0.0   22   34-59      1-22  (40)
106 PF07282 OrfB_Zn_ribbon:  Putat  40.6      26 0.00056   22.1   2.1   33   30-63     24-56  (69)
107 TIGR01562 FdhE formate dehydro  39.9      21 0.00046   30.0   2.0   35   29-63    219-262 (305)
108 PF09538 FYDLN_acid:  Protein o  39.8      13 0.00027   27.0   0.6   27   36-64     11-37  (108)
109 COG3677 Transposase and inacti  39.3      24 0.00051   26.0   2.0   39   33-72     29-72  (129)
110 PRK05580 primosome assembly pr  38.5      35 0.00076   31.0   3.3   45   19-63    365-418 (679)
111 PF09272 Hepsin-SRCR:  Hepsin,   37.2      19 0.00041   26.9   1.2   18   26-43     90-107 (110)
112 PF03117 Herpes_UL49_1:  UL49 f  36.9      37 0.00081   28.2   3.0   41   24-67    126-172 (245)
113 PTZ00255 60S ribosomal protein  36.7      41 0.00089   24.1   2.8   29   35-64     37-65  (90)
114 PRK06260 threonine synthase; V  36.4      23 0.00049   29.7   1.7   28   33-63      2-29  (397)
115 PF07754 DUF1610:  Domain of un  35.6      27 0.00059   19.5   1.4   15   28-42     10-24  (24)
116 smart00746 TRASH metallochaper  35.5      34 0.00074   16.9   1.7   30   56-90      1-30  (39)
117 PRK06450 threonine synthase; V  35.2      23 0.00049   29.4   1.5   27   33-63      2-28  (338)
118 smart00132 LIM Zinc-binding do  34.3      31 0.00067   18.4   1.5    9   55-63     29-37  (39)
119 KOG2906|consensus               33.8      52  0.0011   24.4   3.0   29   36-64      3-32  (105)
120 PF12677 DUF3797:  Domain of un  33.8      21 0.00047   23.2   0.9   13   34-46     13-25  (49)
121 PF08646 Rep_fac-A_C:  Replicat  33.7      65  0.0014   23.0   3.5   35   31-67     15-51  (146)
122 PF14599 zinc_ribbon_6:  Zinc-r  33.4      40 0.00086   22.3   2.2   32   29-61     25-56  (61)
123 PF14446 Prok-RING_1:  Prokaryo  33.0      28  0.0006   22.9   1.3   32   31-65      2-33  (54)
124 PHA02893 hypothetical protein;  33.0      29 0.00063   25.0   1.5   31   35-65     35-81  (88)
125 PF05876 Terminase_GpA:  Phage   32.4      27 0.00059   31.1   1.6   34   32-65    198-241 (557)
126 PRK05654 acetyl-CoA carboxylas  32.1      13 0.00028   30.9  -0.4   31   33-63     26-56  (292)
127 smart00614 ZnF_BED BED zinc fi  32.1      42  0.0009   20.3   2.0   16   52-67     17-32  (50)
128 TIGR00280 L37a ribosomal prote  32.1      56  0.0012   23.5   2.9   29   35-64     36-64  (91)
129 PRK14714 DNA polymerase II lar  32.0      26 0.00056   35.3   1.5   23   34-63    667-689 (1337)
130 KOG1296|consensus               31.8      28  0.0006   27.5   1.4   64   27-98     23-89  (161)
131 PF09297 zf-NADH-PPase:  NADH p  31.7      45 0.00097   18.7   1.9   22   56-77      6-27  (32)
132 TIGR00320 dfx_rbo desulfoferro  31.7      48   0.001   24.4   2.6   27   35-63      8-34  (125)
133 TIGR00373 conserved hypothetic  30.7      16 0.00034   27.5  -0.1   41   22-65     99-140 (158)
134 PF11331 DUF3133:  Protein of u  30.7      26 0.00057   22.2   0.9   17   47-63     25-41  (46)
135 PRK00464 nrdR transcriptional   30.4      42  0.0009   25.7   2.1   28   36-63      2-38  (154)
136 PF01927 Mut7-C:  Mut7-C RNAse   29.6      61  0.0013   23.7   2.8   52   50-115    88-139 (147)
137 PF00236 Hormone_6:  Glycoprote  29.6      13 0.00028   27.2  -0.7   41   28-68      2-44  (96)
138 KOG2907|consensus               29.4      15 0.00032   27.7  -0.4   50    8-62     53-111 (116)
139 KOG1598|consensus               29.3      24 0.00053   32.2   0.8   36   36-71      2-43  (521)
140 PF06397 Desulfoferrod_N:  Desu  29.2      58  0.0013   19.7   2.2   22   35-56      7-28  (36)
141 PF09814 HECT_2:  HECT-like Ubi  29.1      50  0.0011   26.7   2.5   52   21-75    159-216 (354)
142 COG1996 RPC10 DNA-directed RNA  29.0      72  0.0016   20.5   2.7   34   32-66      4-38  (49)
143 PF09963 DUF2197:  Uncharacteri  28.4      19 0.00041   23.8  -0.0   35   33-67      1-45  (56)
144 PRK06266 transcription initiat  28.3      19 0.00041   27.7  -0.0   40   23-65    108-148 (178)
145 cd04476 RPA1_DBD_C RPA1_DBD_C:  28.2      63  0.0014   23.5   2.7   35   31-67     31-65  (166)
146 PRK09710 lar restriction allev  27.7      76  0.0016   21.6   2.8   26   37-62      9-36  (64)
147 PRK14559 putative protein seri  27.5      27 0.00059   32.1   0.8   24   35-63      2-25  (645)
148 PF15616 TerY-C:  TerY-C metal   27.5   1E+02  0.0023   23.2   3.8   23   36-66     79-101 (131)
149 PF08150 FerB:  FerB (NUC096) d  27.3      27 0.00058   24.3   0.6   10   40-49     43-52  (76)
150 PF02591 DUF164:  Putative zinc  27.3      34 0.00073   21.2   1.0   28   36-63     24-56  (56)
151 COG0777 AccD Acetyl-CoA carbox  27.0      30 0.00065   29.6   0.9   31   33-63     27-57  (294)
152 COG3088 CcmH Uncharacterized p  26.8      27 0.00059   27.3   0.6   37    5-51     25-61  (153)
153 PRK03564 formate dehydrogenase  26.7      48   0.001   28.1   2.1   35   29-63    221-262 (309)
154 PHA02942 putative transposase;  26.7      49  0.0011   28.2   2.1   29   33-63    324-352 (383)
155 cd00729 rubredoxin_SM Rubredox  26.5      53  0.0011   19.0   1.7   24   35-61      3-26  (34)
156 PF12172 DUF35_N:  Rubredoxin-l  26.3      63  0.0014   18.4   2.0   28   29-61      6-33  (37)
157 COG2023 RPR2 RNase P subunit R  26.2      93   0.002   22.9   3.2   33   36-68     58-97  (105)
158 TIGR03655 anti_R_Lar restricti  26.1      86  0.0019   19.3   2.7   29   36-64      3-37  (53)
159 TIGR02300 FYDLN_acid conserved  25.5      33 0.00071   26.2   0.8   26   36-63     11-36  (129)
160 PF14206 Cys_rich_CPCC:  Cystei  25.0      54  0.0012   22.7   1.7   26   35-60      2-27  (78)
161 PRK00241 nudC NADH pyrophospha  24.9      59  0.0013   26.1   2.2   27   36-63    101-127 (256)
162 COG5347 GTPase-activating prot  24.8      22 0.00047   30.2  -0.3   59   35-108    21-80  (319)
163 PF09947 DUF2180:  Uncharacteri  24.7      17 0.00037   24.9  -0.8   27   36-65      2-28  (68)
164 COG5349 Uncharacterized protei  24.2      31 0.00067   26.3   0.4   57   25-86     12-68  (126)
165 smart00336 BBOX B-Box-type zin  24.1      56  0.0012   18.1   1.5   28   35-62      4-32  (42)
166 PRK15103 paraquat-inducible me  23.9      68  0.0015   27.8   2.5   35   35-69     11-46  (419)
167 PF14353 CpXC:  CpXC protein     23.8      57  0.0012   22.9   1.7   18   29-46     33-50  (128)
168 PF02892 zf-BED:  BED zinc fing  23.6      54  0.0012   18.9   1.3   22   49-70     12-33  (45)
169 PF06221 zf-C2HC5:  Putative zi  23.1      44 0.00096   22.0   1.0   17   53-69     18-34  (57)
170 PF08209 Sgf11:  Sgf11 (transcr  23.0      73  0.0016   18.8   1.8   14   51-64      2-15  (33)
171 PF08772 NOB1_Zn_bind:  Nin one  23.0      39 0.00084   23.1   0.7   23   35-61     10-32  (73)
172 cd00021 BBOX B-Box-type zinc f  22.9      47   0.001   18.2   0.9   25   36-60      2-27  (39)
173 PF04828 GFA:  Glutathione-depe  22.6      86  0.0019   19.7   2.3   17   48-64     43-59  (92)
174 PRK12286 rpmF 50S ribosomal pr  22.6      69  0.0015   20.7   1.8   21   35-61     28-48  (57)
175 smart00547 ZnF_RBZ Zinc finger  22.4      33 0.00072   18.0   0.2   23   35-62      3-25  (26)
176 COG0375 HybF Zn finger protein  22.3      70  0.0015   23.7   2.0   36   34-72     70-105 (115)
177 TIGR03831 YgiT_finger YgiT-typ  22.1 1.3E+02  0.0028   16.9   2.8   10   56-65     35-44  (46)
178 TIGR00515 accD acetyl-CoA carb  22.1      23 0.00051   29.3  -0.6   29   33-63     25-55  (285)
179 COG0846 SIR2 NAD-dependent pro  21.9      53  0.0011   26.8   1.4   39   29-67    117-160 (250)
180 cd00674 LysRS_core_class_I cat  21.7   2E+02  0.0042   24.6   4.8   45   29-74    163-214 (353)
181 PF05280 FlhC:  Flagellar trans  21.6      67  0.0015   24.9   1.9   30   32-61    132-162 (175)
182 COG1644 RPB10 DNA-directed RNA  21.5      32  0.0007   23.4   0.1   13   52-64      3-15  (63)
183 PRK14559 putative protein seri  21.3      44 0.00096   30.8   0.9   32   36-74     29-60  (645)
184 PRK05638 threonine synthase; V  21.2      56  0.0012   27.8   1.5   26   34-64      1-26  (442)
185 cd01411 SIR2H SIR2H: Uncharact  21.0      45 0.00098   26.0   0.8   38   25-63    109-146 (225)
186 PRK07218 replication factor A;  20.7      56  0.0012   28.7   1.4   27   28-62    292-318 (423)
187 PRK07562 ribonucleotide-diphos  20.6      80  0.0017   31.7   2.5   28   33-62   1189-1216(1220)
188 PF08821 CGGC:  CGGC domain;  I  20.6      63  0.0014   23.1   1.4   13   96-108    36-48  (107)
189 PF01396 zf-C4_Topoisom:  Topoi  20.1      48   0.001   19.7   0.6   13   55-67      3-15  (39)
190 PF09845 DUF2072:  Zn-ribbon co  20.1      41 0.00088   25.6   0.4   20   55-77      3-22  (131)

No 1  
>PTZ00083 40S ribosomal protein S27; Provisional
Probab=100.00  E-value=4.5e-48  Score=271.27  Aligned_cols=79  Identities=68%  Similarity=1.118  Sum_probs=76.6

Q ss_pred             CcccccCCCCHHHHHHhhcccccccCCCCceeEEeCCCCCceeEEeeecceeEEcCCCCeeeecccCCceeeccCCCCc
Q psy2574           2 PLAKDLLHPSQAEEKRKHKLKRLVQHPNSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTILCQPTGGRARLTEDDTGD   80 (115)
Q Consensus         2 ~l~~DLl~Ps~e~ek~k~K~krLV~~PnS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PTGGKA~l~egc~f~   80 (115)
                      .|+.|||||++|+|++|||+|||||+||||||+||||+|+|||||||||||+|.|.+||++||+||||||+|+|||+|.
T Consensus         3 ~~~~DLl~p~~~~e~~khK~k~Lv~~PnS~Fm~VkCp~C~n~q~VFShA~t~V~C~~Cg~~L~~PTGGKa~l~~gc~fr   81 (85)
T PTZ00083          3 FMDVDLLYPDPESEARKHKLKRLVQGPNSYFMDVKCPGCSQITTVFSHAQTVVLCGGCSSQLCQPTGGKAKLTEGCSFR   81 (85)
T ss_pred             cchhhhcCCCHHHHHhhhhceeEecCCCCeEEEEECCCCCCeeEEEecCceEEEccccCCEeeccCCCCeEecCCceEE
Confidence            3577999999999999999999999999999999999999999999999999999999999999999999999999983


No 2  
>PLN00209 ribosomal protein S27; Provisional
Probab=100.00  E-value=1.4e-47  Score=269.32  Aligned_cols=78  Identities=67%  Similarity=1.121  Sum_probs=75.9

Q ss_pred             cccccCCCCHHHHHHhhcccccccCCCCceeEEeCCCCCceeEEeeecceeEEcCCCCeeeecccCCceeeccCCCCc
Q psy2574           3 LAKDLLHPSQAEEKRKHKLKRLVQHPNSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTILCQPTGGRARLTEDDTGD   80 (115)
Q Consensus         3 l~~DLl~Ps~e~ek~k~K~krLV~~PnS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PTGGKA~l~egc~f~   80 (115)
                      ++.|||||++|+|++|||+|||||+||||||+||||+|+|||||||||||+|.|.+||++||+||||||+|+|||+|-
T Consensus         5 ~~~DLl~P~~~~e~~khK~k~Lv~~PnS~Fm~VkCp~C~n~q~VFShA~t~V~C~~Cg~~L~~PTGGKa~l~~gc~fr   82 (86)
T PLN00209          5 NDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGSCQTVLCQPTGGKARLTEGCSFR   82 (86)
T ss_pred             cchhccCCCHHHHHhhhhceeeecCCCCEEEEEECCCCCCeeEEEecCceEEEccccCCEeeccCCCCeEecCCceEE
Confidence            467999999999999999999999999999999999999999999999999999999999999999999999999983


No 3  
>KOG1779|consensus
Probab=100.00  E-value=2.7e-44  Score=251.42  Aligned_cols=80  Identities=80%  Similarity=1.331  Sum_probs=79.0

Q ss_pred             CCcccccCCCCHHHHHHhhcccccccCCCCceeEEeCCCCCceeEEeeecceeEEcCCCCeeeecccCCceeeccCCCCc
Q psy2574           1 MPLAKDLLHPSQAEEKRKHKLKRLVQHPNSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTILCQPTGGRARLTEDDTGD   80 (115)
Q Consensus         1 m~l~~DLl~Ps~e~ek~k~K~krLV~~PnS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PTGGKA~l~egc~f~   80 (115)
                      |+|++|||||++|+|+|+||+|||||+||||||+|||++|.||++|||||||+|.|.+|+++|++||||||+++|||+|-
T Consensus         1 m~la~dllhPs~e~e~r~hK~krLvq~~nsyFm~VkC~gc~~iT~vfSHaqtvVvc~~c~~il~~~tggra~ls~~csfr   80 (84)
T KOG1779|consen    1 MPLAKDLLHPSPEKEKRKHKLKRLVQSPNSYFMDVKCPGCFKITTVFSHAQTVVVCEGCSTILCQPTGGKAKLSEGCSFR   80 (84)
T ss_pred             CccchhhcCCCHHHHhhhhhhhhheeCCCceEEEEEcCCceEEEEEeecCceEEEcCCCceEEEEecCCcEEecCCCcce
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999983


No 4  
>PF01667 Ribosomal_S27e:  Ribosomal protein S27;  InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families include mammalian, yeast, Chlamydomonas reinhardtii and Entamoeba histolytica S27, and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ0250 []. These proteins have from 62 to 87 amino acids. They contain, in their central section, a putative zinc-finger region of the type C-x(2)-C-x(14)-C-x(2)-C.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1QXF_A 3IZ6_X 2XZN_6 2XZM_6 3U5G_b 3IZB_X 3U5C_b.
Probab=100.00  E-value=8e-34  Score=185.38  Aligned_cols=52  Identities=73%  Similarity=1.252  Sum_probs=42.3

Q ss_pred             CCCceeEEeCCCCCceeEEeeecceeEEcCCCCeeeecccCCceeeccCCCC
Q psy2574          28 PNSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTILCQPTGGRARLTEDDTG   79 (115)
Q Consensus        28 PnS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PTGGKA~l~egc~f   79 (115)
                      |||||||||||+|+|+|+||||||++|.|.+||++|++||||||+|.+||.|
T Consensus         1 P~S~Fm~VkCp~C~~~q~vFSha~t~V~C~~Cg~~L~~PtGGKa~l~~~~~~   52 (55)
T PF01667_consen    1 PNSYFMDVKCPGCYNIQTVFSHAQTVVKCVVCGTVLAQPTGGKARLTEGCSF   52 (55)
T ss_dssp             -S--EEEEE-TTT-SEEEEETT-SS-EE-SSSTSEEEEE-SSSEEESSSEEE
T ss_pred             CCccEEEEECCCCCCeeEEEecCCeEEEcccCCCEecCCCCcCeEEeCCeEE
Confidence            8999999999999999999999999999999999999999999999999976


No 5  
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=99.97  E-value=2.6e-32  Score=180.75  Aligned_cols=52  Identities=46%  Similarity=0.916  Sum_probs=50.4

Q ss_pred             cccCCCCceeEEeCCCCCceeEEeeecceeEEcCCCCeeeecccCCceeecc
Q psy2574          24 LVQHPNSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTILCQPTGGRARLTE   75 (115)
Q Consensus        24 LV~~PnS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PTGGKA~l~e   75 (115)
                      |||+|||+||+||||+|+|+|+||||||++|.|.+||++|++||||||+|..
T Consensus         1 li~~p~S~F~~VkCp~C~n~q~vFsha~t~V~C~~Cg~~L~~PtGGKa~i~~   52 (59)
T PRK00415          1 LIPQPRSRFLKVKCPDCGNEQVVFSHASTVVRCLVCGKTLAEPTGGKAKIKG   52 (59)
T ss_pred             CCCCCCCeEEEEECCCCCCeEEEEecCCcEEECcccCCCcccCCCcceeeeh
Confidence            7999999999999999999999999999999999999999999999999963


No 6  
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=99.96  E-value=1.3e-29  Score=171.60  Aligned_cols=56  Identities=45%  Similarity=0.819  Sum_probs=52.2

Q ss_pred             ccccc-CCCCceeEEeCCCCCceeEEeeecceeEEcCCCCeeeecccCCceeeccCC
Q psy2574          22 KRLVQ-HPNSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTILCQPTGGRARLTEDD   77 (115)
Q Consensus        22 krLV~-~PnS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PTGGKA~l~egc   77 (115)
                      |-++| .|||+||+||||||+|+|+|||||||+|.|.+||++|++||||||+|.+..
T Consensus         6 k~~~p~~p~s~Fl~VkCpdC~N~q~vFshast~V~C~~CG~~l~~PTGGka~i~~~i   62 (67)
T COG2051           6 KVKIPKEPRSRFLRVKCPDCGNEQVVFSHASTVVTCLICGTTLAEPTGGKAKISGKI   62 (67)
T ss_pred             eeeecCCCCceEEEEECCCCCCEEEEeccCceEEEecccccEEEecCCCeEEeeeee
Confidence            44555 999999999999999999999999999999999999999999999998864


No 7  
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=97.18  E-value=0.00037  Score=42.08  Aligned_cols=31  Identities=29%  Similarity=0.752  Sum_probs=27.2

Q ss_pred             eCCCCCceeEEeeecceeEEcCCCCeeeecc
Q psy2574          36 KCPGCYKITTVFSHAQSVVICAGCSTILCQP   66 (115)
Q Consensus        36 KCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~P   66 (115)
                      +||.|+...++|.+++..+.|..||.+|-+-
T Consensus         2 ~Cp~Cg~~~~~~D~~~g~~vC~~CG~Vl~e~   32 (43)
T PF08271_consen    2 KCPNCGSKEIVFDPERGELVCPNCGLVLEEN   32 (43)
T ss_dssp             SBTTTSSSEEEEETTTTEEEETTT-BBEE-T
T ss_pred             CCcCCcCCceEEcCCCCeEECCCCCCEeecc
Confidence            7999999999999999999999999999653


No 8  
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=95.67  E-value=0.014  Score=33.88  Aligned_cols=32  Identities=25%  Similarity=0.619  Sum_probs=23.9

Q ss_pred             eEEeCCCCCceeEEee----ecceeEEcCCCCeeee
Q psy2574          33 MDVKCPGCYKITTVFS----HAQSVVICAGCSTILC   64 (115)
Q Consensus        33 m~VKCp~C~n~q~VFS----HAqt~V~C~~Cg~vL~   64 (115)
                      |+++||.|+..--|=+    .+...|.|..||+++-
T Consensus         1 M~~~CP~C~~~~~v~~~~~~~~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         1 MRIQCPNCKTSFRVVDSQLGANGGKVRCGKCGHVWY   36 (38)
T ss_pred             CEEECCCCCCEEEeCHHHcCCCCCEEECCCCCCEEE
Confidence            7899999998644432    2345799999999873


No 9  
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=95.24  E-value=0.012  Score=48.02  Aligned_cols=32  Identities=19%  Similarity=0.646  Sum_probs=29.5

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCeeeecc
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCSTILCQP   66 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~P   66 (115)
                      .+||+|+...+|+++++..+.|..||.||.+-
T Consensus        12 ~~Cp~Cg~~~iv~d~~~Ge~vC~~CG~Vl~e~   43 (310)
T PRK00423         12 LVCPECGSDKLIYDYERGEIVCADCGLVIEEN   43 (310)
T ss_pred             CcCcCCCCCCeeEECCCCeEeecccCCccccc
Confidence            47999999999999999999999999999663


No 10 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=94.97  E-value=0.033  Score=33.86  Aligned_cols=36  Identities=17%  Similarity=0.296  Sum_probs=26.5

Q ss_pred             eEEeCCCCCceeEEeeecceeEEcCCCCeeeecccCC
Q psy2574          33 MDVKCPGCYKITTVFSHAQSVVICAGCSTILCQPTGG   69 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PTGG   69 (115)
                      +..+|++|+.+..+ ....+.+.|..||..+..-..+
T Consensus         2 ~~y~C~~CG~~~~~-~~~~~~~~Cp~CG~~~~~~~~~   37 (46)
T PRK00398          2 AEYKCARCGREVEL-DEYGTGVRCPYCGYRILFKERP   37 (46)
T ss_pred             CEEECCCCCCEEEE-CCCCCceECCCCCCeEEEccCC
Confidence            56899999996554 4444589999999987654433


No 11 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=93.11  E-value=0.11  Score=30.80  Aligned_cols=31  Identities=26%  Similarity=0.577  Sum_probs=23.9

Q ss_pred             eEEeCCCCCceeEEee----ecceeEEcCCCCeee
Q psy2574          33 MDVKCPGCYKITTVFS----HAQSVVICAGCSTIL   63 (115)
Q Consensus        33 m~VKCp~C~n~q~VFS----HAqt~V~C~~Cg~vL   63 (115)
                      |.+.||.|...--|=.    -+...|+|..|+.+.
T Consensus         1 M~i~CP~C~~~f~v~~~~l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    1 MIITCPNCQTRFRVPDDKLPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             CEEECCCCCceEEcCHHHcccCCcEEECCCCCcEe
Confidence            7899999987655433    356799999999875


No 12 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=92.47  E-value=0.039  Score=30.50  Aligned_cols=26  Identities=27%  Similarity=0.680  Sum_probs=20.8

Q ss_pred             eEEeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          33 MDVKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      |.+.||.|+++     +......|..||+.|
T Consensus         1 m~~~Cp~Cg~~-----~~~~~~fC~~CG~~L   26 (26)
T PF13248_consen    1 MEMFCPNCGAE-----IDPDAKFCPNCGAKL   26 (26)
T ss_pred             CcCCCcccCCc-----CCcccccChhhCCCC
Confidence            56889999983     366778899999865


No 13 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=91.54  E-value=0.27  Score=28.27  Aligned_cols=31  Identities=13%  Similarity=0.443  Sum_probs=22.2

Q ss_pred             eEEeCCCCCcee-EEeeec-ceeEEcCCCCeee
Q psy2574          33 MDVKCPGCYKIT-TVFSHA-QSVVICAGCSTIL   63 (115)
Q Consensus        33 m~VKCp~C~n~q-~VFSHA-qt~V~C~~Cg~vL   63 (115)
                      ++-+|++|+++- +..+-+ ...+.|..||..+
T Consensus         4 Y~y~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~~~   36 (41)
T smart00834        4 YEYRCEDCGHTFEVLQKISDDPLATCPECGGDV   36 (41)
T ss_pred             EEEEcCCCCCEEEEEEecCCCCCCCCCCCCCcc
Confidence            467999999944 444333 6688899999843


No 14 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=89.13  E-value=0.46  Score=28.13  Aligned_cols=31  Identities=23%  Similarity=0.564  Sum_probs=21.3

Q ss_pred             eEEeCCCCCceeEEee----ecceeEEcCCCCeee
Q psy2574          33 MDVKCPGCYKITTVFS----HAQSVVICAGCSTIL   63 (115)
Q Consensus        33 m~VKCp~C~n~q~VFS----HAqt~V~C~~Cg~vL   63 (115)
                      |+|.||.|...--|=+    -....|.|..||.+.
T Consensus         1 M~i~Cp~C~~~y~i~d~~ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    1 MIITCPNCQAKYEIDDEKIPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             CEEECCCCCCEEeCCHHHCCCCCcEEECCCCCCEe
Confidence            7788888877654433    234578888888764


No 15 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=88.95  E-value=0.17  Score=37.75  Aligned_cols=34  Identities=26%  Similarity=0.583  Sum_probs=29.1

Q ss_pred             CceeEEeCCCCCceeEEeeecceeEEcCCCCeeeecc
Q psy2574          30 SYFMDVKCPGCYKITTVFSHAQSVVICAGCSTILCQP   66 (115)
Q Consensus        30 S~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~P   66 (115)
                      .+...|+||+|++.+-+.++.+   .|--|+++|.-.
T Consensus        65 tkav~V~CP~C~K~TKmLGr~D---~CM~C~~pLTLd   98 (114)
T PF11023_consen   65 TKAVQVECPNCGKQTKMLGRVD---ACMHCKEPLTLD   98 (114)
T ss_pred             ccceeeECCCCCChHhhhchhh---ccCcCCCcCccC
Confidence            3457899999999999999986   899999998643


No 16 
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=87.91  E-value=0.42  Score=39.58  Aligned_cols=30  Identities=23%  Similarity=0.670  Sum_probs=28.4

Q ss_pred             eCCCCCceeEEeeecceeEEcCCCCeeeec
Q psy2574          36 KCPGCYKITTVFSHAQSVVICAGCSTILCQ   65 (115)
Q Consensus        36 KCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~   65 (115)
                      .||.|+...++.++....+.|..||.+|-.
T Consensus         3 ~CpeCg~~~~~~d~~~ge~VC~~CG~Vi~~   32 (285)
T COG1405           3 SCPECGSTNIITDYERGEIVCADCGLVLED   32 (285)
T ss_pred             CCCCCCCccceeeccCCeEEeccCCEEecc
Confidence            699999999999999999999999999965


No 17 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=87.52  E-value=0.64  Score=27.80  Aligned_cols=28  Identities=32%  Similarity=0.785  Sum_probs=19.4

Q ss_pred             EeCCCCCceeEEeeecce---------eEEcCCCCee
Q psy2574          35 VKCPGCYKITTVFSHAQS---------VVICAGCSTI   62 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt---------~V~C~~Cg~v   62 (115)
                      ++||.|++..++|-..|+         ...|..||..
T Consensus         1 ~~Cp~Cg~~~a~~~~~Q~rsaDE~~T~fy~C~~C~~~   37 (39)
T PF01096_consen    1 IKCPKCGHNEAVFFQIQTRSADEPMTLFYVCCNCGHR   37 (39)
T ss_dssp             S--SSS-SSEEEEEEESSSSSSSSSEEEEEESSSTEE
T ss_pred             CCCcCCCCCeEEEEEeeccCCCCCCeEEEEeCCCCCe
Confidence            589999999999986654         4678888764


No 18 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=87.37  E-value=0.72  Score=33.18  Aligned_cols=29  Identities=21%  Similarity=0.685  Sum_probs=21.4

Q ss_pred             EeCCCCCceeE--EeeecceeEEcCCCCeee
Q psy2574          35 VKCPGCYKITT--VFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        35 VKCp~C~n~q~--VFSHAqt~V~C~~Cg~vL   63 (115)
                      +.||.|++..+  -+.+-...+.|..||.--
T Consensus        22 f~CP~Cge~~v~v~~~k~~~h~~C~~CG~y~   52 (99)
T PRK14892         22 FECPRCGKVSISVKIKKNIAIITCGNCGLYT   52 (99)
T ss_pred             eECCCCCCeEeeeecCCCcceEECCCCCCcc
Confidence            68999995322  256767789999999753


No 19 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=87.06  E-value=0.74  Score=27.99  Aligned_cols=29  Identities=14%  Similarity=0.494  Sum_probs=20.4

Q ss_pred             eEEeCCCCCcee-EEee-ecceeEEcCCCCe
Q psy2574          33 MDVKCPGCYKIT-TVFS-HAQSVVICAGCST   61 (115)
Q Consensus        33 m~VKCp~C~n~q-~VFS-HAqt~V~C~~Cg~   61 (115)
                      ++-+|++|+++- +..+ +....+.|..||.
T Consensus         4 Yey~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (52)
T TIGR02605         4 YEYRCTACGHRFEVLQKMSDDPLATCPECGG   34 (52)
T ss_pred             EEEEeCCCCCEeEEEEecCCCCCCCCCCCCC
Confidence            467999999944 4433 2235678999997


No 20 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=84.35  E-value=1.4  Score=26.50  Aligned_cols=30  Identities=20%  Similarity=0.562  Sum_probs=21.8

Q ss_pred             eeEEeCCCCCceeEEeee-cc-eeEEcCCCCe
Q psy2574          32 FMDVKCPGCYKITTVFSH-AQ-SVVICAGCST   61 (115)
Q Consensus        32 Fm~VKCp~C~n~q~VFSH-Aq-t~V~C~~Cg~   61 (115)
                      ..+-+|++|++.--++-. +. ..+.|..||.
T Consensus         3 ~Yey~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (42)
T PF09723_consen    3 IYEYRCEECGHEFEVLQSISEDDPVPCPECGS   34 (42)
T ss_pred             CEEEEeCCCCCEEEEEEEcCCCCCCcCCCCCC
Confidence            357799999955444433 33 5899999998


No 21 
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=83.47  E-value=0.93  Score=32.53  Aligned_cols=37  Identities=14%  Similarity=0.293  Sum_probs=27.1

Q ss_pred             eEEeCCCCCceeEEeeecce-eEEcCCCCeeeecccCCcee
Q psy2574          33 MDVKCPGCYKITTVFSHAQS-VVICAGCSTILCQPTGGRAR   72 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt-~V~C~~Cg~vL~~PTGGKA~   72 (115)
                      ...+|++|++   .|..... ...|+.||..-.+-.+|+--
T Consensus        69 ~~~~C~~Cg~---~~~~~~~~~~~CP~Cgs~~~~i~~G~El  106 (114)
T PRK03681         69 AECWCETCQQ---YVTLLTQRVRRCPQCHGDMLRIVADDGL  106 (114)
T ss_pred             cEEEcccCCC---eeecCCccCCcCcCcCCCCcEEccCCeE
Confidence            3589999996   4555433 36799999887788888753


No 22 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=83.42  E-value=1.2  Score=28.99  Aligned_cols=32  Identities=28%  Similarity=0.597  Sum_probs=21.9

Q ss_pred             eEEeCCCCCceeEE-eeecceeEEcCCCCeeee
Q psy2574          33 MDVKCPGCYKITTV-FSHAQSVVICAGCSTILC   64 (115)
Q Consensus        33 m~VKCp~C~n~q~V-FSHAqt~V~C~~Cg~vL~   64 (115)
                      |..+||.|+..-.+ =+..-..|.|..||..|=
T Consensus         1 ~~~~CP~CG~~iev~~~~~GeiV~Cp~CGaele   33 (54)
T TIGR01206         1 MQFECPDCGAEIELENPELGELVICDECGAELE   33 (54)
T ss_pred             CccCCCCCCCEEecCCCccCCEEeCCCCCCEEE
Confidence            35689999985433 112346889999998773


No 23 
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=83.25  E-value=1.2  Score=30.61  Aligned_cols=29  Identities=24%  Similarity=0.551  Sum_probs=22.3

Q ss_pred             eEEeCCCCCceeEEeeecce---------eEEcCCCCe
Q psy2574          33 MDVKCPGCYKITTVFSHAQS---------VVICAGCST   61 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt---------~V~C~~Cg~   61 (115)
                      .+++||.|++...+|.-.|+         .-.|..||.
T Consensus        61 ~~~~Cp~Cg~~~a~f~~~Q~RsadE~~T~fy~C~~C~~   98 (104)
T TIGR01384        61 TRVECPKCGHKEAYYWLLQTRRADEPETRFYKCTKCGY   98 (104)
T ss_pred             ccCCCCCCCCCeeEEEEeccCCCCCCcEEEEEeCCCCC
Confidence            36899999999999986654         456777764


No 24 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=82.74  E-value=1.8  Score=26.79  Aligned_cols=30  Identities=23%  Similarity=0.452  Sum_probs=23.2

Q ss_pred             eEEeCCCCCceeEEeeecceeEEcCCCCeeee
Q psy2574          33 MDVKCPGCYKITTVFSHAQSVVICAGCSTILC   64 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~   64 (115)
                      |.-+|.+|+.+..+-  ....|.|..||.-+.
T Consensus         1 ~~Y~C~~Cg~~~~~~--~~~~irC~~CG~rIl   30 (44)
T smart00659        1 MIYICGECGRENEIK--SKDVVRCRECGYRIL   30 (44)
T ss_pred             CEEECCCCCCEeecC--CCCceECCCCCceEE
Confidence            345899999987764  568899999997553


No 25 
>PF05907 DUF866:  Eukaryotic protein of unknown function (DUF866);  InterPro: IPR008584 This family consists of a number of hypothetical eukaryotic proteins of unknown function with an average length of around 165 residues.; PDB: 1ZSO_B.
Probab=82.72  E-value=1.8  Score=32.97  Aligned_cols=37  Identities=24%  Similarity=0.494  Sum_probs=21.9

Q ss_pred             CCCCceeEEeCCCCCcee---EEee------------ecceeEEcCCCCeee
Q psy2574          27 HPNSYFMDVKCPGCYKIT---TVFS------------HAQSVVICAGCSTIL   63 (115)
Q Consensus        27 ~PnS~Fm~VKCp~C~n~q---~VFS------------HAqt~V~C~~Cg~vL   63 (115)
                      .|-.||++|||..|+.+.   |.++            -|..+.+|..|++..
T Consensus        23 ~~~~~~fkvkCt~CgE~~~k~V~i~~~e~~e~~gsrG~aNfv~KCk~C~re~   74 (161)
T PF05907_consen   23 PDFEWFFKVKCTSCGEVHPKWVYINRFEKHEIPGSRGTANFVMKCKFCKRES   74 (161)
T ss_dssp             TT--EEEEEEETTSS--EEEEEEE-TT-BEE-TTSS-EESEEE--SSSS--E
T ss_pred             CCCEEEEEEEECCCCCccCcceEeecceEEecCCCccceEeEecCcCcCCcc
Confidence            467899999999999754   3444            467788999998743


No 26 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=82.46  E-value=0.48  Score=25.84  Aligned_cols=23  Identities=30%  Similarity=0.725  Sum_probs=15.5

Q ss_pred             eCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          36 KCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        36 KCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      +||.|+++.     ......|..||+.|
T Consensus         1 ~Cp~CG~~~-----~~~~~fC~~CG~~l   23 (23)
T PF13240_consen    1 YCPNCGAEI-----EDDAKFCPNCGTPL   23 (23)
T ss_pred             CCcccCCCC-----CCcCcchhhhCCcC
Confidence            478888764     23455588888764


No 27 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=81.98  E-value=1  Score=32.33  Aligned_cols=36  Identities=19%  Similarity=0.309  Sum_probs=26.0

Q ss_pred             eEEeCCCCCceeEEeeecceeEEcCCCCeeeecccCCce
Q psy2574          33 MDVKCPGCYKITTVFSHAQSVVICAGCSTILCQPTGGRA   71 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PTGGKA   71 (115)
                      ..++|++|++   .|........|+.||..=.+-.+|+-
T Consensus        69 ~~~~C~~Cg~---~~~~~~~~~~CP~Cgs~~~~i~~G~E  104 (113)
T PRK12380         69 AQAWCWDCSQ---VVEIHQHDAQCPHCHGERLRVDTGDS  104 (113)
T ss_pred             cEEEcccCCC---EEecCCcCccCcCCCCCCcEEccCCe
Confidence            4589999994   45555555669999987666677764


No 28 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=81.68  E-value=2.2  Score=25.68  Aligned_cols=27  Identities=26%  Similarity=0.642  Sum_probs=20.8

Q ss_pred             eCCCCCceeEEeeecc---------eeEEcCCCCee
Q psy2574          36 KCPGCYKITTVFSHAQ---------SVVICAGCSTI   62 (115)
Q Consensus        36 KCp~C~n~q~VFSHAq---------t~V~C~~Cg~v   62 (115)
                      +||.|++..++|-..|         ....|..||..
T Consensus         2 ~Cp~C~~~~a~~~q~Q~RsaDE~mT~fy~C~~C~~~   37 (40)
T smart00440        2 PCPKCGNREATFFQLQTRSADEPMTVFYVCTKCGHR   37 (40)
T ss_pred             cCCCCCCCeEEEEEEcccCCCCCCeEEEEeCCCCCE
Confidence            7999999999997554         35677777753


No 29 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=81.24  E-value=1.1  Score=32.10  Aligned_cols=36  Identities=22%  Similarity=0.559  Sum_probs=25.5

Q ss_pred             eEEeCCCCCceeEEeeecceeEEcCCCCeeeecccCCce
Q psy2574          33 MDVKCPGCYKITTVFSHAQSVVICAGCSTILCQPTGGRA   71 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PTGGKA   71 (115)
                      ...+|++|++   .|+.......|+.||..-.+-.+|+-
T Consensus        69 ~~~~C~~Cg~---~~~~~~~~~~CP~Cgs~~~~i~~G~E  104 (115)
T TIGR00100        69 VECECEDCSE---EVSPEIDLYRCPKCHGIMLQVRAGKE  104 (115)
T ss_pred             cEEEcccCCC---EEecCCcCccCcCCcCCCcEEecCCe
Confidence            3589999994   45555556789999987655566653


No 30 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=81.16  E-value=1.8  Score=25.52  Aligned_cols=28  Identities=21%  Similarity=0.414  Sum_probs=20.7

Q ss_pred             eCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          36 KCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        36 KCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      -||.|+|+=.+=......+.|..|+..-
T Consensus         3 FCp~C~nlL~p~~~~~~~~~C~~C~Y~~   30 (35)
T PF02150_consen    3 FCPECGNLLYPKEDKEKRVACRTCGYEE   30 (35)
T ss_dssp             BETTTTSBEEEEEETTTTEEESSSS-EE
T ss_pred             eCCCCCccceEcCCCccCcCCCCCCCcc
Confidence            3888988888777776666888888653


No 31 
>PRK02935 hypothetical protein; Provisional
Probab=80.50  E-value=1  Score=33.53  Aligned_cols=36  Identities=25%  Similarity=0.540  Sum_probs=29.4

Q ss_pred             CCceeEEeCCCCCceeEEeeecceeEEcCCCCeeeeccc
Q psy2574          29 NSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTILCQPT   67 (115)
Q Consensus        29 nS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PT   67 (115)
                      ..+...|.||+|++.+-+-.+..   .|--|+++|.-+.
T Consensus        65 StkavqV~CP~C~K~TKmLGrvD---~CM~C~~PLTLd~  100 (110)
T PRK02935         65 STKAVQVICPSCEKPTKMLGRVD---ACMHCNQPLTLDR  100 (110)
T ss_pred             cccceeeECCCCCchhhhcccee---ecCcCCCcCCcCc
Confidence            45678899999999998887754   8999999986543


No 32 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=77.60  E-value=3  Score=28.27  Aligned_cols=34  Identities=18%  Similarity=0.464  Sum_probs=24.8

Q ss_pred             CCCCceeEEeCCCCCceeEEeeec----ceeEEcCCCC
Q psy2574          27 HPNSYFMDVKCPGCYKITTVFSHA----QSVVICAGCS   60 (115)
Q Consensus        27 ~PnS~Fm~VKCp~C~n~q~VFSHA----qt~V~C~~Cg   60 (115)
                      .|...+..-.||+|+++.|.=.+.    ...-.|..||
T Consensus        20 ~p~e~~v~F~CPnCGe~~I~Rc~~CRk~g~~Y~Cp~CG   57 (61)
T COG2888          20 APGETAVKFPCPNCGEVEIYRCAKCRKLGNPYRCPKCG   57 (61)
T ss_pred             ccCCceeEeeCCCCCceeeehhhhHHHcCCceECCCcC
Confidence            377888899999999988875432    3455677776


No 33 
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=75.52  E-value=3.9  Score=30.22  Aligned_cols=28  Identities=18%  Similarity=0.551  Sum_probs=18.9

Q ss_pred             EeCCCCCceeEE---eee--cceeEEcCCCCee
Q psy2574          35 VKCPGCYKITTV---FSH--AQSVVICAGCSTI   62 (115)
Q Consensus        35 VKCp~C~n~q~V---FSH--Aqt~V~C~~Cg~v   62 (115)
                      -.||-|+.+.++   -..  .--.+.|.+||--
T Consensus        23 FtCp~Cghe~vs~ctvkk~~~~g~~~Cg~CGls   55 (104)
T COG4888          23 FTCPRCGHEKVSSCTVKKTVNIGTAVCGNCGLS   55 (104)
T ss_pred             EecCccCCeeeeEEEEEecCceeEEEcccCcce
Confidence            479999999887   222  2235678888753


No 34 
>PRK00420 hypothetical protein; Validated
Probab=75.14  E-value=2.3  Score=31.25  Aligned_cols=35  Identities=17%  Similarity=0.425  Sum_probs=26.4

Q ss_pred             eEEeCCCCCceeEEeeecceeEEcCCCCeeeecccCC
Q psy2574          33 MDVKCPGCYKITTVFSHAQSVVICAGCSTILCQPTGG   69 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PTGG   69 (115)
                      +.-.||.|+.  ..|.=-+..+.|+.||.++.--.|=
T Consensus        22 l~~~CP~Cg~--pLf~lk~g~~~Cp~Cg~~~~v~~~e   56 (112)
T PRK00420         22 LSKHCPVCGL--PLFELKDGEVVCPVHGKVYIVKSDE   56 (112)
T ss_pred             ccCCCCCCCC--cceecCCCceECCCCCCeeeeccHH
Confidence            5578999994  4555478899999999988654443


No 35 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=74.70  E-value=2.5  Score=31.11  Aligned_cols=37  Identities=22%  Similarity=0.436  Sum_probs=26.3

Q ss_pred             eEEeCCCCCceeEEeeec---------------------ceeEEcCCCCeeeecccCCcee
Q psy2574          33 MDVKCPGCYKITTVFSHA---------------------QSVVICAGCSTILCQPTGGRAR   72 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHA---------------------qt~V~C~~Cg~vL~~PTGGKA~   72 (115)
                      ...+|++|+.+   |+..                     .....|+.||..-.+-.+|+-.
T Consensus        69 ~~~~C~~CG~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CP~Cgs~~~~i~~G~el  126 (135)
T PRK03824         69 AVLKCRNCGNE---WSLKEVKESLDEEIREAIHFIPEVVHAFLKCPKCGSRDFEIVKGRGV  126 (135)
T ss_pred             eEEECCCCCCE---EecccccccccccccccccccccccccCcCCcCCCCCCcEEecCceE
Confidence            45899999954   4443                     4557799999876666677643


No 36 
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=74.55  E-value=3.3  Score=30.94  Aligned_cols=28  Identities=25%  Similarity=0.551  Sum_probs=22.8

Q ss_pred             EeCCCCCceeEEeeec--ceeEEcCCCCee
Q psy2574          35 VKCPGCYKITTVFSHA--QSVVICAGCSTI   62 (115)
Q Consensus        35 VKCp~C~n~q~VFSHA--qt~V~C~~Cg~v   62 (115)
                      |.|+.|++.-+.+..-  -....|..||..
T Consensus        98 VlC~~C~sPdT~l~k~~r~~~l~C~ACGa~  127 (133)
T TIGR00311        98 VICRECNRPDTRIIKEGRVSLLKCEACGAK  127 (133)
T ss_pred             EECCCCCCCCcEEEEeCCeEEEecccCCCC
Confidence            9999999998888873  334699999964


No 37 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=73.66  E-value=1.5  Score=24.67  Aligned_cols=23  Identities=26%  Similarity=0.652  Sum_probs=17.8

Q ss_pred             eCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          36 KCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        36 KCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      +||+|+.+-     +.....|..||..+
T Consensus         2 ~CP~C~~~V-----~~~~~~Cp~CG~~F   24 (26)
T PF10571_consen    2 TCPECGAEV-----PESAKFCPHCGYDF   24 (26)
T ss_pred             cCCCCcCCc-----hhhcCcCCCCCCCC
Confidence            589998765     66778898888765


No 38 
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=73.23  E-value=4  Score=29.54  Aligned_cols=27  Identities=26%  Similarity=0.560  Sum_probs=23.2

Q ss_pred             EeCCCCCceeEEeee--cceeEEcCCCCe
Q psy2574          35 VKCPGCYKITTVFSH--AQSVVICAGCST   61 (115)
Q Consensus        35 VKCp~C~n~q~VFSH--Aqt~V~C~~Cg~   61 (115)
                      |.|+.|++.-+.+..  -.....|..||.
T Consensus        81 VlC~~C~spdT~l~k~~r~~~l~C~aCGa  109 (110)
T smart00653       81 VLCPECGSPDTELIKENRLFFLKCEACGA  109 (110)
T ss_pred             EECCCCCCCCcEEEEeCCeEEEEccccCC
Confidence            999999999888886  556778999995


No 39 
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=72.57  E-value=2.1  Score=24.99  Aligned_cols=18  Identities=44%  Similarity=1.082  Sum_probs=15.7

Q ss_pred             EEcCCCCeeeecccCCce
Q psy2574          54 VICAGCSTILCQPTGGRA   71 (115)
Q Consensus        54 V~C~~Cg~vL~~PTGGKA   71 (115)
                      +.|..|++.|.-|.|-+.
T Consensus         2 ~~C~~C~t~L~yP~gA~~   19 (31)
T TIGR01053         2 VVCGGCRTLLMYPRGASS   19 (31)
T ss_pred             cCcCCCCcEeecCCCCCe
Confidence            689999999999998654


No 40 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=72.47  E-value=3.3  Score=26.22  Aligned_cols=29  Identities=21%  Similarity=0.356  Sum_probs=22.5

Q ss_pred             EEeCCCCCceeEEeeecceeEEcCCCCeeee
Q psy2574          34 DVKCPGCYKITTVFSHAQSVVICAGCSTILC   64 (115)
Q Consensus        34 ~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~   64 (115)
                      .--||.|++. +...|. ....|..||-+.-
T Consensus        20 ~~fCP~Cg~~-~m~~~~-~r~~C~~Cgyt~~   48 (50)
T PRK00432         20 NKFCPRCGSG-FMAEHL-DRWHCGKCGYTEF   48 (50)
T ss_pred             cCcCcCCCcc-hheccC-CcEECCCcCCEEe
Confidence            3479999998 777776 6778999997753


No 41 
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=71.88  E-value=4.4  Score=30.46  Aligned_cols=28  Identities=29%  Similarity=0.540  Sum_probs=23.4

Q ss_pred             EeCCCCCceeEEeee--cceeEEcCCCCee
Q psy2574          35 VKCPGCYKITTVFSH--AQSVVICAGCSTI   62 (115)
Q Consensus        35 VKCp~C~n~q~VFSH--Aqt~V~C~~Cg~v   62 (115)
                      |.|+.|++.-|.+..  -.....|..||..
T Consensus       103 VlC~~C~spdT~l~k~~r~~~l~C~ACGa~  132 (138)
T PRK03988        103 VICPECGSPDTKLIKEGRIWVLKCEACGAE  132 (138)
T ss_pred             EECCCCCCCCcEEEEcCCeEEEEcccCCCC
Confidence            999999999988876  3357899999964


No 42 
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=71.79  E-value=3.6  Score=29.77  Aligned_cols=29  Identities=24%  Similarity=0.517  Sum_probs=25.5

Q ss_pred             EEeCCCCCceeEEeeeccee---------EEcCCCCee
Q psy2574          34 DVKCPGCYKITTVFSHAQSV---------VICAGCSTI   62 (115)
Q Consensus        34 ~VKCp~C~n~q~VFSHAqt~---------V~C~~Cg~v   62 (115)
                      +++||.|++....|=-.|+-         ..|..||.+
T Consensus        72 ~~~CpkCg~~ea~y~~~QtRsaDEp~T~Fy~C~~Cg~~  109 (113)
T COG1594          72 KEKCPKCGNKEAYYWQLQTRSADEPETRFYKCTRCGYR  109 (113)
T ss_pred             cccCCCCCCceeEEEeeehhccCCCceEEEEecccCCE
Confidence            67999999999999887775         899999875


No 43 
>KOG1597|consensus
Probab=71.68  E-value=3  Score=35.66  Aligned_cols=42  Identities=21%  Similarity=0.512  Sum_probs=30.6

Q ss_pred             eCCCCCcee--EEeeecceeEEcCCCCeeeecccCCceeeccCCCCccE
Q psy2574          36 KCPGCYKIT--TVFSHAQSVVICAGCSTILCQPTGGRARLTEDDTGDSM   82 (115)
Q Consensus        36 KCp~C~n~q--~VFSHAqt~V~C~~Cg~vL~~PTGGKA~l~egc~f~s~   82 (115)
                      .|++|..-+  +|.+|...-..|..||-+|-     --.|-++-.+.|.
T Consensus         2 ~c~~C~~~~~~~V~d~~~gdtvC~~CGlVl~-----~r~Id~~sEwrtf   45 (308)
T KOG1597|consen    2 TCPDCKRHPENLVEDHSAGDTVCSECGLVLE-----DRIIDEGSEWRTF   45 (308)
T ss_pred             CCCCCCCCCCCeeeeccCCceecccCCeeec-----ccccccccccccc
Confidence            477776544  79999999999999999993     3345555555444


No 44 
>COG4416 Com Mu-like prophage protein Com [General function prediction only]
Probab=70.08  E-value=3  Score=28.13  Aligned_cols=26  Identities=19%  Similarity=0.657  Sum_probs=20.8

Q ss_pred             cccCCCCceeEEeCCCCCceeEEeee
Q psy2574          24 LVQHPNSYFMDVKCPGCYKITTVFSH   49 (115)
Q Consensus        24 LV~~PnS~Fm~VKCp~C~n~q~VFSH   49 (115)
                      |...--+.++.+|||.|..++-+++.
T Consensus        14 La~a~~~~yle~KCPrCK~vN~~~~~   39 (60)
T COG4416          14 LAEAEGQAYLEKKCPRCKEVNEFYIK   39 (60)
T ss_pred             HHhcccceeeeecCCccceeeeeecc
Confidence            44445667999999999999988875


No 45 
>PHA00626 hypothetical protein
Probab=67.98  E-value=5.2  Score=26.97  Aligned_cols=31  Identities=16%  Similarity=0.381  Sum_probs=22.8

Q ss_pred             eCCCCCceeEEeeec----ceeEEcCCCCeeeecc
Q psy2574          36 KCPGCYKITTVFSHA----QSVVICAGCSTILCQP   66 (115)
Q Consensus        36 KCp~C~n~q~VFSHA----qt~V~C~~Cg~vL~~P   66 (115)
                      +||.|+..+|+=+-.    +..-.|..||-....-
T Consensus         2 ~CP~CGS~~Ivrcg~cr~~snrYkCkdCGY~ft~~   36 (59)
T PHA00626          2 SCPKCGSGNIAKEKTMRGWSDDYVCCDCGYNDSKD   36 (59)
T ss_pred             CCCCCCCceeeeeceecccCcceEcCCCCCeechh
Confidence            699999998884321    4567899999877553


No 46 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=67.93  E-value=2.6  Score=30.34  Aligned_cols=36  Identities=19%  Similarity=0.500  Sum_probs=24.1

Q ss_pred             eEEeCCCCCceeEEeeeccee-EEcCCCCeeeecccCCce
Q psy2574          33 MDVKCPGCYKITTVFSHAQSV-VICAGCSTILCQPTGGRA   71 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt~-V~C~~Cg~vL~~PTGGKA   71 (115)
                      ..++|.+|++.   |+-.... ..|+.||..-.+-.+|+-
T Consensus        70 ~~~~C~~Cg~~---~~~~~~~~~~CP~Cgs~~~~i~~G~E  106 (117)
T PRK00564         70 VELECKDCSHV---FKPNALDYGVCEKCHSKNVIITQGNE  106 (117)
T ss_pred             CEEEhhhCCCc---cccCCccCCcCcCCCCCceEEecCCE
Confidence            45899999954   4443333 359999987766666653


No 47 
>KOG3507|consensus
Probab=67.85  E-value=5.4  Score=27.14  Aligned_cols=34  Identities=24%  Similarity=0.467  Sum_probs=28.3

Q ss_pred             CCCceeEEeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          28 PNSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        28 PnS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      |++.=|.--|.+|+.++++  .+.-+|.|..||--+
T Consensus        14 ~r~~~miYiCgdC~~en~l--k~~D~irCReCG~RI   47 (62)
T KOG3507|consen   14 PRTATMIYICGDCGQENTL--KRGDVIRCRECGYRI   47 (62)
T ss_pred             CCcccEEEEeccccccccc--cCCCcEehhhcchHH
Confidence            4677789999999999998  456799999999643


No 48 
>PF14319 Zn_Tnp_IS91:  Transposase zinc-binding domain
Probab=67.81  E-value=4.8  Score=28.80  Aligned_cols=36  Identities=17%  Similarity=0.385  Sum_probs=26.6

Q ss_pred             cCCCCceeEEeCCCCCceeEEeeecceeEEcCCCCee
Q psy2574          26 QHPNSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTI   62 (115)
Q Consensus        26 ~~PnS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~v   62 (115)
                      ....--|+...|++|+.+.+++- +=-.-.|+.||..
T Consensus        34 rt~~~G~~~~~C~~Cg~~~~~~~-SCk~R~CP~C~~~   69 (111)
T PF14319_consen   34 RTEALGFHRYRCEDCGHEKIVYN-SCKNRHCPSCQAK   69 (111)
T ss_pred             CCccCCcceeecCCCCceEEecC-cccCcCCCCCCCh
Confidence            34566799999999999996653 3333388888865


No 49 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=67.77  E-value=9  Score=22.48  Aligned_cols=29  Identities=21%  Similarity=0.366  Sum_probs=23.2

Q ss_pred             EEeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          34 DVKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        34 ~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      ..+|.+|+..-+++ -.+.--.|..||.+-
T Consensus         3 ~~~C~~C~~~~i~~-~~~~~~~C~~Cg~~~   31 (33)
T PF08792_consen    3 LKKCSKCGGNGIVN-KEDDYEVCIFCGSSF   31 (33)
T ss_pred             ceEcCCCCCCeEEE-ecCCeEEcccCCcEe
Confidence            36899999988666 667778899999864


No 50 
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=67.49  E-value=5.9  Score=30.99  Aligned_cols=28  Identities=21%  Similarity=0.431  Sum_probs=23.4

Q ss_pred             EeCCCCCceeEEeee--cceeEEcCCCCee
Q psy2574          35 VKCPGCYKITTVFSH--AQSVVICAGCSTI   62 (115)
Q Consensus        35 VKCp~C~n~q~VFSH--Aqt~V~C~~Cg~v   62 (115)
                      |.|+.|++.-|.+-.  -.....|..||..
T Consensus        99 V~C~~C~~pdT~l~k~~~~~~l~C~aCGa~  128 (201)
T PRK12336         99 VICSECGLPDTRLVKEDRVLMLRCDACGAH  128 (201)
T ss_pred             EECCCCCCCCcEEEEcCCeEEEEcccCCCC
Confidence            999999999888876  4456799999974


No 51 
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=66.13  E-value=5.9  Score=26.48  Aligned_cols=8  Identities=38%  Similarity=1.082  Sum_probs=3.6

Q ss_pred             eEEcCCCC
Q psy2574          53 VVICAGCS   60 (115)
Q Consensus        53 ~V~C~~Cg   60 (115)
                      +|.|..||
T Consensus        36 ~v~C~~CG   43 (64)
T PF09855_consen   36 TVSCTNCG   43 (64)
T ss_pred             EEECCCCC
Confidence            44444444


No 52 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=65.44  E-value=2.1  Score=25.17  Aligned_cols=25  Identities=16%  Similarity=0.384  Sum_probs=17.3

Q ss_pred             eCCCCCceeEEeeecceeEEcCCCCee
Q psy2574          36 KCPGCYKITTVFSHAQSVVICAGCSTI   62 (115)
Q Consensus        36 KCp~C~n~q~VFSHAqt~V~C~~Cg~v   62 (115)
                      +|.+|+.+..+-  +..+|.|..||.-
T Consensus         2 ~C~~Cg~~~~~~--~~~~irC~~CG~R   26 (32)
T PF03604_consen    2 ICGECGAEVELK--PGDPIRCPECGHR   26 (32)
T ss_dssp             BESSSSSSE-BS--TSSTSSBSSSS-S
T ss_pred             CCCcCCCeeEcC--CCCcEECCcCCCe
Confidence            588898887733  4567899999854


No 53 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=65.30  E-value=9.4  Score=25.59  Aligned_cols=34  Identities=18%  Similarity=0.486  Sum_probs=20.6

Q ss_pred             CCCCceeEEeCCCCCceeEEee----ecceeEEcCCCC
Q psy2574          27 HPNSYFMDVKCPGCYKITTVFS----HAQSVVICAGCS   60 (115)
Q Consensus        27 ~PnS~Fm~VKCp~C~n~q~VFS----HAqt~V~C~~Cg   60 (115)
                      .|+.++..-.||+|+++.|.=.    .-+....|..||
T Consensus        18 ~~~~~~~~F~CPnCG~~~I~RC~~CRk~~~~Y~CP~CG   55 (59)
T PRK14890         18 APREKAVKFLCPNCGEVIIYRCEKCRKQSNPYTCPKCG   55 (59)
T ss_pred             cCCCccCEeeCCCCCCeeEeechhHHhcCCceECCCCC
Confidence            4566678888999987544321    223445666665


No 54 
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=65.21  E-value=3.5  Score=29.95  Aligned_cols=39  Identities=23%  Similarity=0.434  Sum_probs=24.2

Q ss_pred             eEEeCCCCCceeEE--eeecce--eEEcCCCCeeeecccCCcee
Q psy2574          33 MDVKCPGCYKITTV--FSHAQS--VVICAGCSTILCQPTGGRAR   72 (115)
Q Consensus        33 m~VKCp~C~n~q~V--FSHAqt--~V~C~~Cg~vL~~PTGGKA~   72 (115)
                      ...+| +|+..-.+  +.....  ...|+.||..-.+-.+|+--
T Consensus        69 ~~~~C-~Cg~~~~~~~~~~~~~~~~~~CP~Cgs~~~~i~~G~El  111 (124)
T PRK00762         69 VEIEC-ECGYEGVVDEDEIDHYAAVIECPVCGNKRAHILGGREC  111 (124)
T ss_pred             eeEEe-eCcCcccccccchhccccCCcCcCCCCCCCEEecCCeE
Confidence            45899 99966222  222112  25799999777666666643


No 55 
>PRK08197 threonine synthase; Validated
Probab=64.27  E-value=5.8  Score=33.09  Aligned_cols=32  Identities=28%  Similarity=0.668  Sum_probs=23.9

Q ss_pred             CCCceeEEeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          28 PNSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        28 PnS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      |.++|...+|..|+.+   |+-......| .||-.|
T Consensus         1 ~~~~~~~~~C~~Cg~~---~~~~~~~~~C-~cg~~l   32 (394)
T PRK08197          1 PFSYVSHLECSKCGET---YDADQVHNLC-KCGKPL   32 (394)
T ss_pred             CCceeeEEEECCCCCC---CCCCCcceec-CCCCee
Confidence            4577888999999987   5555556789 797654


No 56 
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=64.05  E-value=9  Score=22.61  Aligned_cols=27  Identities=26%  Similarity=0.624  Sum_probs=12.2

Q ss_pred             eCCCCCceeEEeeec-ceeEEcCCCCee
Q psy2574          36 KCPGCYKITTVFSHA-QSVVICAGCSTI   62 (115)
Q Consensus        36 KCp~C~n~q~VFSHA-qt~V~C~~Cg~v   62 (115)
                      +||.|.+.-....-. -.+-.|..|+-+
T Consensus         1 ~CP~C~~~l~~~~~~~~~id~C~~C~G~   28 (41)
T PF13453_consen    1 KCPRCGTELEPVRLGDVEIDVCPSCGGI   28 (41)
T ss_pred             CcCCCCcccceEEECCEEEEECCCCCeE
Confidence            466666533222222 233346666543


No 57 
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=63.24  E-value=12  Score=26.67  Aligned_cols=35  Identities=20%  Similarity=0.376  Sum_probs=26.5

Q ss_pred             ceeEEeCCCCCceeEEeeecce-eEEcCCCCeeeec
Q psy2574          31 YFMDVKCPGCYKITTVFSHAQS-VVICAGCSTILCQ   65 (115)
Q Consensus        31 ~Fm~VKCp~C~n~q~VFSHAqt-~V~C~~Cg~vL~~   65 (115)
                      +-....|++|+.+......... .-.|..|+..|.+
T Consensus       120 ~~~~~~C~~C~~~~~r~~~~~~~~~~C~~C~~~l~~  155 (157)
T PF10263_consen  120 KKYVYRCPSCGREYKRHRRSKRKRYRCGRCGGPLVQ  155 (157)
T ss_pred             cceEEEcCCCCCEeeeecccchhhEECCCCCCEEEE
Confidence            5567899999998766666532 3479999998864


No 58 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=62.47  E-value=5.2  Score=29.38  Aligned_cols=40  Identities=28%  Similarity=0.634  Sum_probs=26.4

Q ss_pred             ccccCCCCceeEEeCCCCCceeEEeeeccee------EEcCCCCeeeec
Q psy2574          23 RLVQHPNSYFMDVKCPGCYKITTVFSHAQSV------VICAGCSTILCQ   65 (115)
Q Consensus        23 rLV~~PnS~Fm~VKCp~C~n~q~VFSHAqt~------V~C~~Cg~vL~~   65 (115)
                      +|-+..+..|  ..||.|+. +..|.-|...      ..|+.||..|-.
T Consensus        90 ~l~~e~~~~~--Y~Cp~C~~-~y~~~ea~~~~d~~~~f~Cp~Cg~~l~~  135 (147)
T smart00531       90 KLEDETNNAY--YKCPNCQS-KYTFLEANQLLDMDGTFTCPRCGEELEE  135 (147)
T ss_pred             HHhcccCCcE--EECcCCCC-EeeHHHHHHhcCCCCcEECCCCCCEEEE
Confidence            4555555554  57999974 4445444332      899999999854


No 59 
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=61.74  E-value=5.7  Score=26.15  Aligned_cols=14  Identities=50%  Similarity=0.736  Sum_probs=6.5

Q ss_pred             eEEeCCCCCceeEE
Q psy2574          33 MDVKCPGCYKITTV   46 (115)
Q Consensus        33 m~VKCp~C~n~q~V   46 (115)
                      |.|+||.|++....
T Consensus         1 m~v~CP~C~k~~~~   14 (57)
T PF03884_consen    1 MTVKCPICGKPVEW   14 (57)
T ss_dssp             -EEE-TTT--EEE-
T ss_pred             CcccCCCCCCeecc
Confidence            67888888776544


No 60 
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=61.60  E-value=9.8  Score=22.93  Aligned_cols=31  Identities=26%  Similarity=0.563  Sum_probs=22.8

Q ss_pred             EeCC--CCCceeEEee-ecceeEEcCCCCeeeec
Q psy2574          35 VKCP--GCYKITTVFS-HAQSVVICAGCSTILCQ   65 (115)
Q Consensus        35 VKCp--~C~n~q~VFS-HAqt~V~C~~Cg~vL~~   65 (115)
                      .-||  +|..+....+ -....|.|..|+...+-
T Consensus        19 ~~CP~~~C~~~~~~~~~~~~~~v~C~~C~~~fC~   52 (64)
T smart00647       19 KWCPAPDCSAAIIVTEEEGCNRVTCPKCGFSFCF   52 (64)
T ss_pred             cCCCCCCCcceEEecCCCCCCeeECCCCCCeECC
Confidence            4699  9988776652 24568999999887764


No 61 
>PRK05978 hypothetical protein; Provisional
Probab=61.37  E-value=3.2  Score=31.79  Aligned_cols=39  Identities=18%  Similarity=0.275  Sum_probs=29.6

Q ss_pred             CCCceeEEeCCCCCceeEEeeecceeEEcCCCCeeeecc
Q psy2574          28 PNSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTILCQP   66 (115)
Q Consensus        28 PnS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~P   66 (115)
                      |=.+=++-|||.|++-.+-=+--...-.|..||..+-.=
T Consensus        27 ~~~rGl~grCP~CG~G~LF~g~Lkv~~~C~~CG~~~~~~   65 (148)
T PRK05978         27 AMWRGFRGRCPACGEGKLFRAFLKPVDHCAACGEDFTHH   65 (148)
T ss_pred             HHHHHHcCcCCCCCCCcccccccccCCCccccCCccccC
Confidence            333446789999999887666667888999999887543


No 62 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=60.71  E-value=11  Score=22.73  Aligned_cols=27  Identities=19%  Similarity=0.459  Sum_probs=20.1

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCe
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCST   61 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~   61 (115)
                      +.||.|++..+.+=.....-.|..|+.
T Consensus        19 ~~CP~Cg~~~~~~~~~~~~~~C~~C~~   45 (46)
T PF12760_consen   19 FVCPHCGSTKHYRLKTRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCeeeEEeCCCCeEECCCCCC
Confidence            559999999444444448889999975


No 63 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=60.69  E-value=7.7  Score=22.59  Aligned_cols=25  Identities=28%  Similarity=0.643  Sum_probs=13.0

Q ss_pred             eCCCCCceeEEeeecceeEEcCCCCee
Q psy2574          36 KCPGCYKITTVFSHAQSVVICAGCSTI   62 (115)
Q Consensus        36 KCp~C~n~q~VFSHAqt~V~C~~Cg~v   62 (115)
                      |||.|+.+.+.  +-.....|..|+..
T Consensus         4 ~Cp~C~se~~y--~D~~~~vCp~C~~e   28 (30)
T PF08274_consen    4 KCPLCGSEYTY--EDGELLVCPECGHE   28 (30)
T ss_dssp             --TTT-----E--E-SSSEEETTTTEE
T ss_pred             CCCCCCCccee--ccCCEEeCCccccc
Confidence            79999999888  55566778888864


No 64 
>PRK07591 threonine synthase; Validated
Probab=60.45  E-value=6.6  Score=33.33  Aligned_cols=31  Identities=19%  Similarity=0.382  Sum_probs=24.0

Q ss_pred             CceeEEeCCCCCceeEEeeecceeEEcCCCCeeee
Q psy2574          30 SYFMDVKCPGCYKITTVFSHAQSVVICAGCSTILC   64 (115)
Q Consensus        30 S~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~   64 (115)
                      ++|...+|..|+.+   |.-... ..|..||..|-
T Consensus        14 ~~~~~l~C~~Cg~~---~~~~~~-~~C~~cg~~l~   44 (421)
T PRK07591         14 GPAVALKCRECGAE---YPLGPI-HVCEECFGPLE   44 (421)
T ss_pred             cceeEEEeCCCCCc---CCCCCC-ccCCCCCCeEE
Confidence            77889999999987   443344 88999987663


No 65 
>PHA02998 RNA polymerase subunit; Provisional
Probab=59.41  E-value=7.6  Score=31.43  Aligned_cols=35  Identities=23%  Similarity=0.483  Sum_probs=28.9

Q ss_pred             eEEeCCCCCceeEEeeecce---------eEEcCCCCeeeeccc
Q psy2574          33 MDVKCPGCYKITTVFSHAQS---------VVICAGCSTILCQPT   67 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt---------~V~C~~Cg~vL~~PT   67 (115)
                      .+++||.|++....|-.-|+         -..|..||...-.|.
T Consensus       142 t~v~CPkCg~~~A~f~qlQTRSADEPmT~FYkC~~CG~~wkppk  185 (195)
T PHA02998        142 YNTPCPNCKSKNTTPMMIQTRAADEPPLVRHACRDCKKHFKPPK  185 (195)
T ss_pred             cCCCCCCCCCCceEEEEEeeccCCCCceEEEEcCCCCCccCCcc
Confidence            45899999999999987665         468999999887664


No 66 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=59.24  E-value=4.3  Score=24.20  Aligned_cols=31  Identities=29%  Similarity=0.655  Sum_probs=23.5

Q ss_pred             EeCCCCCceeEE-eeecceeEEcCCCCeeeec
Q psy2574          35 VKCPGCYKITTV-FSHAQSVVICAGCSTILCQ   65 (115)
Q Consensus        35 VKCp~C~n~q~V-FSHAqt~V~C~~Cg~vL~~   65 (115)
                      .-|+.|+.+--+ |.-+...-.|..||..|.|
T Consensus         2 r~C~~Cg~~Yh~~~~pP~~~~~Cd~cg~~L~q   33 (36)
T PF05191_consen    2 RICPKCGRIYHIEFNPPKVEGVCDNCGGELVQ   33 (36)
T ss_dssp             EEETTTTEEEETTTB--SSTTBCTTTTEBEBE
T ss_pred             cCcCCCCCccccccCCCCCCCccCCCCCeeEe
Confidence            468999987544 7777888999999998875


No 67 
>PF08063 PADR1:  PADR1 (NUC008) domain;  InterPro: IPR012982 This domain is found in poly(ADP-ribose)-synthetases []. The function of this domain is unknown.; GO: 0003950 NAD+ ADP-ribosyltransferase activity, 0005634 nucleus; PDB: 2JVN_A 4DQY_E 2RIQ_A.
Probab=58.93  E-value=7.8  Score=24.94  Aligned_cols=21  Identities=24%  Similarity=0.472  Sum_probs=13.8

Q ss_pred             EeCCCCCceeEEeeecceeEEcC
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICA   57 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~   57 (115)
                      -+||.|.+-|++|+..  ...|.
T Consensus        15 ~~Cp~C~~~~l~~~~~--~Y~C~   35 (55)
T PF08063_consen   15 EPCPKCKGGQLYFDGS--GYKCT   35 (55)
T ss_dssp             ---SSSSE-EEEEETT--EEEEE
T ss_pred             CCCCCCCCCeEEecCC--ccEeC
Confidence            4799999999999877  45554


No 68 
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=58.77  E-value=9.1  Score=28.23  Aligned_cols=28  Identities=25%  Similarity=0.502  Sum_probs=23.4

Q ss_pred             EeCCCCCceeEEee--ecceeEEcCCCCee
Q psy2574          35 VKCPGCYKITTVFS--HAQSVVICAGCSTI   62 (115)
Q Consensus        35 VKCp~C~n~q~VFS--HAqt~V~C~~Cg~v   62 (115)
                      |.|+.|++..+.+.  --.....|..||..
T Consensus        94 VlC~~C~spdT~l~k~~r~~~l~C~aCGa~  123 (125)
T PF01873_consen   94 VLCPECGSPDTELIKEGRLIFLKCKACGAS  123 (125)
T ss_dssp             SSCTSTSSSSEEEEEETTCCEEEETTTSCE
T ss_pred             EEcCCCCCCccEEEEcCCEEEEEecccCCc
Confidence            89999999888876  35677899999964


No 69 
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=58.76  E-value=8.6  Score=25.16  Aligned_cols=19  Identities=32%  Similarity=0.690  Sum_probs=15.0

Q ss_pred             CceeEEeCCCCCceeEEee
Q psy2574          30 SYFMDVKCPGCYKITTVFS   48 (115)
Q Consensus        30 S~Fm~VKCp~C~n~q~VFS   48 (115)
                      -..+.+|||.|+.++.|=+
T Consensus        20 ~~~leIKCpRC~tiN~~~a   38 (51)
T PF10122_consen   20 VIELEIKCPRCKTINHVRA   38 (51)
T ss_pred             ccEEEEECCCCCccceEec
Confidence            3458999999999987743


No 70 
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=57.94  E-value=4.5  Score=24.39  Aligned_cols=47  Identities=30%  Similarity=0.515  Sum_probs=23.7

Q ss_pred             cccccccCCCCceeEEeCCC--CCceeEEeeeccee-EEcCCCCeeeecccCC
Q psy2574          20 KLKRLVQHPNSYFMDVKCPG--CYKITTVFSHAQSV-VICAGCSTILCQPTGG   69 (115)
Q Consensus        20 K~krLV~~PnS~Fm~VKCp~--C~n~q~VFSHAqt~-V~C~~Cg~vL~~PTGG   69 (115)
                      +.++.|....+.   ..||.  |.....+-+..... |.|..|+...|-==++
T Consensus         7 ~~~~~~~~~~~~---~~Cp~~~C~~~~~~~~~~~~~~~~C~~C~~~fC~~C~~   56 (64)
T PF01485_consen    7 LLKRYLESDPNI---RWCPNPDCEYIIEKDDGCNSPIVTCPSCGTEFCFKCGE   56 (64)
T ss_dssp             CCHS---S---C---C--TTSST---ECS-SSTTS--CCTTSCCSEECSSSTS
T ss_pred             HHHHHHHCCCCc---cCCCCCCCcccEEecCCCCCCeeECCCCCCcCccccCc
Confidence            345555433333   38977  99988877777764 9999999988754433


No 71 
>PRK12496 hypothetical protein; Provisional
Probab=57.70  E-value=4.6  Score=30.67  Aligned_cols=28  Identities=21%  Similarity=0.530  Sum_probs=20.2

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCeeeec
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCSTILCQ   65 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~   65 (115)
                      -.|++|+++   |...-..-.|.+||..|-+
T Consensus       128 ~~C~gC~~~---~~~~~~~~~C~~CG~~~~r  155 (164)
T PRK12496        128 KVCKGCKKK---YPEDYPDDVCEICGSPVKR  155 (164)
T ss_pred             EECCCCCcc---ccCCCCCCcCCCCCChhhh
Confidence            459999964   5544444579999998743


No 72 
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=56.55  E-value=3.4  Score=29.40  Aligned_cols=35  Identities=17%  Similarity=0.347  Sum_probs=21.2

Q ss_pred             eEEeCCCCCceeEEeeecceeEEcCCCCeeeecccCCc
Q psy2574          33 MDVKCPGCYKITTVFSHAQSVVICAGCSTILCQPTGGR   70 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PTGGK   70 (115)
                      ..++|.+|+.+--   -......|+.||..-.+=.+|+
T Consensus        69 ~~~~C~~Cg~~~~---~~~~~~~CP~Cgs~~~~i~~G~  103 (113)
T PF01155_consen   69 ARARCRDCGHEFE---PDEFDFSCPRCGSPDVEIISGR  103 (113)
T ss_dssp             -EEEETTTS-EEE---CHHCCHH-SSSSSS-EEEEESS
T ss_pred             CcEECCCCCCEEe---cCCCCCCCcCCcCCCcEEccCC
Confidence            4689999998644   3334466999998765555554


No 73 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=56.38  E-value=13  Score=28.18  Aligned_cols=36  Identities=19%  Similarity=0.485  Sum_probs=27.1

Q ss_pred             ccccccCCCCceeEEeCCCCCceeEEeeecceeEEcCCCCee
Q psy2574          21 LKRLVQHPNSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTI   62 (115)
Q Consensus        21 ~krLV~~PnS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~v   62 (115)
                      -..+|-..+.++-...|+-|+.      -+.....|..||.+
T Consensus       296 ~~~~v~~~~~~~tS~~C~~cg~------~~~r~~~C~~cg~~  331 (364)
T COG0675         296 GGIVVKVVPPYYTSKTCPCCGH------LSGRLFKCPRCGFV  331 (364)
T ss_pred             CCeEEEECCCCCCcccccccCC------ccceeEECCCCCCe
Confidence            4455555566666789999999      34678899999986


No 74 
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=56.00  E-value=13  Score=27.41  Aligned_cols=22  Identities=32%  Similarity=0.720  Sum_probs=19.4

Q ss_pred             CCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          37 CPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        37 Cp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      ||-|++.-+|     |...|..|++.+
T Consensus         1 CPvCg~~l~v-----t~l~C~~C~t~i   22 (113)
T PF09862_consen    1 CPVCGGELVV-----TRLKCPSCGTEI   22 (113)
T ss_pred             CCCCCCceEE-----EEEEcCCCCCEE
Confidence            8999988776     789999999987


No 75 
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=55.96  E-value=15  Score=22.67  Aligned_cols=25  Identities=24%  Similarity=0.644  Sum_probs=18.8

Q ss_pred             CCCCCceeEEeeecc-------eeEEcCCCCe
Q psy2574          37 CPGCYKITTVFSHAQ-------SVVICAGCST   61 (115)
Q Consensus        37 Cp~C~n~q~VFSHAq-------t~V~C~~Cg~   61 (115)
                      ||=|+...+......       ..|.|..||.
T Consensus         6 CPFCG~~~~~~~~~~~~~~~~~~~V~C~~Cga   37 (61)
T PF14354_consen    6 CPFCGSADVLIRQDEGFDYGMYYYVECTDCGA   37 (61)
T ss_pred             CCCCCCcceEeecccCCCCCCEEEEEcCCCCC
Confidence            888877776666533       5688999988


No 76 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=54.88  E-value=10  Score=22.57  Aligned_cols=27  Identities=19%  Similarity=0.460  Sum_probs=14.7

Q ss_pred             CCCCCceeEEeeecc-eeEEcCCCCeee
Q psy2574          37 CPGCYKITTVFSHAQ-SVVICAGCSTIL   63 (115)
Q Consensus        37 Cp~C~n~q~VFSHAq-t~V~C~~Cg~vL   63 (115)
                      ||.|++.-..=.-.+ ....|..||...
T Consensus         3 Cp~Cg~~l~~~~~~~~~~~vC~~Cg~~~   30 (52)
T smart00661        3 CPKCGNMLIPKEGKEKRRFVCRKCGYEE   30 (52)
T ss_pred             CCCCCCccccccCCCCCEEECCcCCCeE
Confidence            777877332211222 256688887654


No 77 
>TIGR02443 conserved hypothetical metal-binding protein. Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N-terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various Proteobacteria.
Probab=54.67  E-value=19  Score=24.13  Aligned_cols=35  Identities=23%  Similarity=0.373  Sum_probs=28.2

Q ss_pred             EeCCCCCceeE---EeeecceeEEcCCCCeeeecccCC
Q psy2574          35 VKCPGCYKITT---VFSHAQSVVICAGCSTILCQPTGG   69 (115)
Q Consensus        35 VKCp~C~n~q~---VFSHAqt~V~C~~Cg~vL~~PTGG   69 (115)
                      .+||.|...-.   ...+-.-.|.|..||-.-.+|+.+
T Consensus        10 A~CP~C~~~Dtl~~~~e~~~e~vECv~Cg~~~~~~~~~   47 (59)
T TIGR02443        10 AVCPACSAQDTLAMWKENNIELVECVECGYQEQQKDQS   47 (59)
T ss_pred             ccCCCCcCccEEEEEEeCCceEEEeccCCCccccCCcc
Confidence            68999987544   345667789999999999999876


No 78 
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=53.84  E-value=17  Score=24.95  Aligned_cols=29  Identities=17%  Similarity=0.615  Sum_probs=18.0

Q ss_pred             eeEEeCCCCCceeEEeeec-ceeEEcCCCCeeee
Q psy2574          32 FMDVKCPGCYKITTVFSHA-QSVVICAGCSTILC   64 (115)
Q Consensus        32 Fm~VKCp~C~n~q~VFSHA-qt~V~C~~Cg~vL~   64 (115)
                      |+-.+| +|++.  ++++- +-.-.| .||++|-
T Consensus         1 ylifrC-~Cgr~--lya~e~~kTkkC-~CG~~l~   30 (68)
T PF09082_consen    1 YLIFRC-DCGRY--LYAKEGAKTKKC-VCGKTLK   30 (68)
T ss_dssp             EEEEEE-TTS----EEEETT-SEEEE-TTTEEEE
T ss_pred             CEEEEe-cCCCE--EEecCCcceeEe-cCCCeee
Confidence            466789 89875  44543 344578 9999874


No 79 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=53.69  E-value=18  Score=19.91  Aligned_cols=26  Identities=27%  Similarity=0.783  Sum_probs=16.0

Q ss_pred             eCCCCCceeEEeee-cceeEEcCCCCe
Q psy2574          36 KCPGCYKITTVFSH-AQSVVICAGCST   61 (115)
Q Consensus        36 KCp~C~n~q~VFSH-Aqt~V~C~~Cg~   61 (115)
                      +|+-|.+...-... ......|..|..
T Consensus         3 ~C~rC~~~~~~~~~~~r~~~~C~rCq~   29 (30)
T PF06827_consen    3 KCPRCWNYIEDIGINGRSTYLCPRCQK   29 (30)
T ss_dssp             B-TTT--BBEEEEETTEEEEE-TTTCC
T ss_pred             cCccCCCcceEeEecCCCCeECcCCcC
Confidence            68999987665554 667788888864


No 80 
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=53.42  E-value=12  Score=31.32  Aligned_cols=28  Identities=21%  Similarity=0.558  Sum_probs=22.6

Q ss_pred             EEeCCCCCceeEEeeecc---------eeEEcCCCCe
Q psy2574          34 DVKCPGCYKITTVFSHAQ---------SVVICAGCST   61 (115)
Q Consensus        34 ~VKCp~C~n~q~VFSHAq---------t~V~C~~Cg~   61 (115)
                      .++|+.|++..++|-..|         +.+.|..||.
T Consensus       258 ~~~C~~C~~~~~~~~q~QtrsaDEpmT~f~~C~~Cg~  294 (299)
T TIGR01385       258 LFTCGKCKQKKCTYYQLQTRSADEPMTTFVTCEECGN  294 (299)
T ss_pred             cccCCCCCCccceEEEecccCCCCCCeEEEEcCCCCC
Confidence            489999999999998765         4567888774


No 81 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=52.62  E-value=15  Score=21.77  Aligned_cols=26  Identities=23%  Similarity=0.511  Sum_probs=21.3

Q ss_pred             eCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          36 KCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        36 KCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      .|+.|++.  .|.-..-...|..||++.
T Consensus        10 ~C~~C~~~--~~~~~dG~~yC~~cG~~~   35 (36)
T PF11781_consen   10 PCPVCGSR--WFYSDDGFYYCDRCGHQS   35 (36)
T ss_pred             cCCCCCCe--EeEccCCEEEhhhCceEc
Confidence            49999988  777788888898888764


No 82 
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=51.84  E-value=18  Score=24.73  Aligned_cols=39  Identities=18%  Similarity=0.432  Sum_probs=16.9

Q ss_pred             cccccCCCCceeEEeCCCCCce---eEEeeec--ceeEEcCCCCeee
Q psy2574          22 KRLVQHPNSYFMDVKCPGCYKI---TTVFSHA--QSVVICAGCSTIL   63 (115)
Q Consensus        22 krLV~~PnS~Fm~VKCp~C~n~---q~VFSHA--qt~V~C~~Cg~vL   63 (115)
                      ++..+.....|   .||-|+++   .+.++..  ...+.|..||..-
T Consensus        13 kk~~~~l~~~F---~CPfC~~~~sV~v~idkk~~~~~~~C~~Cg~~~   56 (81)
T PF05129_consen   13 KKKKPKLPKVF---DCPFCNHEKSVSVKIDKKEGIGILSCRVCGESF   56 (81)
T ss_dssp             -------SS-------TTT--SS-EEEEEETTTTEEEEEESSS--EE
T ss_pred             cCcCCCCCceE---cCCcCCCCCeEEEEEEccCCEEEEEecCCCCeE
Confidence            34445555665   79999954   4445543  6789999997654


No 83 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=51.20  E-value=12  Score=22.45  Aligned_cols=19  Identities=32%  Similarity=0.716  Sum_probs=14.5

Q ss_pred             eEEeCCCCCceeEEeeecc
Q psy2574          33 MDVKCPGCYKITTVFSHAQ   51 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAq   51 (115)
                      ++|+||-|...+-|.-|-.
T Consensus         4 i~v~CP~C~s~~~v~k~G~   22 (36)
T PF03811_consen    4 IDVHCPRCQSTEGVKKNGK   22 (36)
T ss_pred             EeeeCCCCCCCCcceeCCC
Confidence            6899999999885555543


No 84 
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=50.44  E-value=13  Score=30.27  Aligned_cols=31  Identities=23%  Similarity=0.557  Sum_probs=21.4

Q ss_pred             eEEeCCCCCceeE-----EeeecceeEEcCCCCeee
Q psy2574          33 MDVKCPGCYKITT-----VFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        33 m~VKCp~C~n~q~-----VFSHAqt~V~C~~Cg~vL   63 (115)
                      +...||.|+.+.+     -+---.-.|.|..||++-
T Consensus         5 iy~~Cp~Cg~eev~hEVik~~g~~~lvrC~eCG~V~   40 (201)
T COG1326           5 IYIECPSCGSEEVSHEVIKERGREPLVRCEECGTVH   40 (201)
T ss_pred             EEEECCCCCcchhhHHHHHhcCCceEEEccCCCcEe
Confidence            4578999995544     121223689999999976


No 85 
>COG3877 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=50.42  E-value=13  Score=28.12  Aligned_cols=29  Identities=31%  Similarity=0.668  Sum_probs=24.3

Q ss_pred             CceeEEeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          30 SYFMDVKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        30 S~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      ||=|--+||.|+..-+|     |...|..|++++
T Consensus         2 ~~~~~~~cPvcg~~~iV-----TeL~c~~~etTV   30 (122)
T COG3877           2 SYKVINRCPVCGRKLIV-----TELKCSNCETTV   30 (122)
T ss_pred             CCCCCCCCCccccccee-----EEEecCCCCceE
Confidence            34456789999999987     788999999987


No 86 
>PF06943 zf-LSD1:  LSD1 zinc finger;  InterPro: IPR005735 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC []. This domain may play a role in the regulation of transcription, via either repression of a prodeath pathway or activation of an antideath pathway, in response to signals emanating from cells undergoing pathogen-induced hypersensitive cell death. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].
Probab=49.54  E-value=12  Score=21.22  Aligned_cols=15  Identities=47%  Similarity=1.114  Sum_probs=13.0

Q ss_pred             cCCCCeeeecccCCc
Q psy2574          56 CAGCSTILCQPTGGR   70 (115)
Q Consensus        56 C~~Cg~vL~~PTGGK   70 (115)
                      |.+|.++|.-|.|-.
T Consensus         1 C~~Cr~~L~yp~GA~   15 (25)
T PF06943_consen    1 CGGCRTLLMYPRGAP   15 (25)
T ss_pred             CCCCCceEEcCCCCC
Confidence            789999999999854


No 87 
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=49.43  E-value=11  Score=28.54  Aligned_cols=28  Identities=18%  Similarity=0.529  Sum_probs=22.6

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      -.|..|+.... |.|+...-.|+.||..-
T Consensus       113 l~C~~Cg~~~~-~~~~~~l~~Cp~C~~~~  140 (146)
T PF07295_consen  113 LVCENCGHEVE-LTHPERLPPCPKCGHTE  140 (146)
T ss_pred             EecccCCCEEE-ecCCCcCCCCCCCCCCe
Confidence            47999987655 56899999999999753


No 88 
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=49.03  E-value=8  Score=33.23  Aligned_cols=33  Identities=24%  Similarity=0.491  Sum_probs=17.1

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCeeeecccC
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCSTILCQPTG   68 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PTG   68 (115)
                      .+|++|++-+|.|.. =-...|..||..--+.+|
T Consensus       286 FkC~~C~~Rt~sl~r-~P~~~C~~Cg~~~wer~~  318 (344)
T PF09332_consen  286 FKCKDCGNRTISLER-LPKKHCSNCGSSKWERTG  318 (344)
T ss_dssp             EE-T-TS-EEEESSS-S--S--TTT-S---EEE-
T ss_pred             EECCCCCCeeeeccc-CCCCCCCcCCcCceeehh
Confidence            489999999999954 345899999987776664


No 89 
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=48.48  E-value=14  Score=24.22  Aligned_cols=22  Identities=36%  Similarity=0.634  Sum_probs=16.4

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      .+|+.|+.-++       .-.|..||..+
T Consensus         6 r~C~~CgvYTL-------k~~CP~CG~~t   27 (56)
T PRK13130          6 RKCPKCGVYTL-------KEICPVCGGKT   27 (56)
T ss_pred             eECCCCCCEEc-------cccCcCCCCCC
Confidence            57888887776       55688888765


No 90 
>PF12773 DZR:  Double zinc ribbon
Probab=48.43  E-value=8.6  Score=22.97  Aligned_cols=12  Identities=33%  Similarity=0.625  Sum_probs=5.5

Q ss_pred             eEEcCCCCeeee
Q psy2574          53 VVICAGCSTILC   64 (115)
Q Consensus        53 ~V~C~~Cg~vL~   64 (115)
                      ...|..||+.|.
T Consensus        12 ~~fC~~CG~~l~   23 (50)
T PF12773_consen   12 AKFCPHCGTPLP   23 (50)
T ss_pred             ccCChhhcCChh
Confidence            444444444443


No 91 
>PF08996 zf-DNA_Pol:  DNA Polymerase alpha zinc finger;  InterPro: IPR015088 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNA Polymerase alpha zinc finger domain adopts an alpha-helix-like structure, followed by three turns, all of which involve proline. The resulting motif is a helix-turn-helix motif, in contrast to other zinc finger domains, which show anti-parallel sheet and helix conformation. Zinc binding occurs due to the presence of four cysteine residues positioned to bind the metal centre in a tetrahedral coordination geometry. The function of this domain is uncertain: it has been proposed that the zinc finger motif may be an essential part of the DNA binding domain [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0001882 nucleoside binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 3FLO_D 1N5G_A 1K0P_A 1K18_A.
Probab=47.73  E-value=19  Score=27.50  Aligned_cols=32  Identities=31%  Similarity=0.648  Sum_probs=17.7

Q ss_pred             eEEeCCCCCceeEE---ee-----ecceeEEcCCCCeeee
Q psy2574          33 MDVKCPGCYKITTV---FS-----HAQSVVICAGCSTILC   64 (115)
Q Consensus        33 m~VKCp~C~n~q~V---FS-----HAqt~V~C~~Cg~vL~   64 (115)
                      +.++||.|+.+...   |.     ....-..|..|+..+.
T Consensus        17 l~~~C~~C~~~~~f~g~~~~~~~~~~~~~~~C~~C~~~~~   56 (188)
T PF08996_consen   17 LKLTCPSCGTEFEFPGVFEEDGDDVSPSGLQCPNCSTPLS   56 (188)
T ss_dssp             EEEE-TTT--EEEE-SSS--SSEEEETTEEEETTT--B--
T ss_pred             eEeECCCCCCCccccccccCCccccccCcCcCCCCCCcCC
Confidence            67999999988765   44     3455788999988553


No 92 
>PF13901 DUF4206:  Domain of unknown function (DUF4206)
Probab=47.16  E-value=9.9  Score=29.52  Aligned_cols=28  Identities=21%  Similarity=0.594  Sum_probs=25.1

Q ss_pred             eCCCCCceeEEeeecc-eeEEcCCCCeee
Q psy2574          36 KCPGCYKITTVFSHAQ-SVVICAGCSTIL   63 (115)
Q Consensus        36 KCp~C~n~q~VFSHAq-t~V~C~~Cg~vL   63 (115)
                      -|.-|.+..+||.--. +++.|..|+++.
T Consensus       154 iCe~C~~~~~IfPF~~~~~~~C~~C~~v~  182 (202)
T PF13901_consen  154 ICEICNSDDIIFPFQIDTTVRCPKCKSVF  182 (202)
T ss_pred             CCccCCCCCCCCCCCCCCeeeCCcCcccc
Confidence            5888999999999877 999999999875


No 93 
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=46.88  E-value=27  Score=23.67  Aligned_cols=34  Identities=26%  Similarity=0.544  Sum_probs=28.6

Q ss_pred             EeCCCCCceeEE---eeecceeEEcCCCCeeeecccC
Q psy2574          35 VKCPGCYKITTV---FSHAQSVVICAGCSTILCQPTG   68 (115)
Q Consensus        35 VKCp~C~n~q~V---FSHAqt~V~C~~Cg~vL~~PTG   68 (115)
                      ..||.|...-.|   ..+-.-.|.|..||-.-.+|.-
T Consensus         9 a~CP~C~~~D~i~~~~e~~ve~vECV~CGy~e~~~~~   45 (71)
T PF09526_consen    9 AVCPKCQAMDTIMMWRENGVEYVECVECGYTERQPDQ   45 (71)
T ss_pred             ccCCCCcCccEEEEEEeCCceEEEecCCCCeeccCCc
Confidence            689999976544   4677889999999999999986


No 94 
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=46.86  E-value=49  Score=23.79  Aligned_cols=30  Identities=17%  Similarity=0.380  Sum_probs=23.9

Q ss_pred             eeecceeEEcCCCCeeeecccCCceeeccCCC
Q psy2574          47 FSHAQSVVICAGCSTILCQPTGGRARLTEDDT   78 (115)
Q Consensus        47 FSHAqt~V~C~~Cg~vL~~PTGGKA~l~egc~   78 (115)
                      |...--.+.|..|++.+..+|=|  .+.-||.
T Consensus        46 Y~q~g~~lvC~~C~~~~~~~~ig--~~~GGCN   75 (102)
T PF10080_consen   46 YYQEGDQLVCKNCGVRFNLPTIG--GKSGGCN   75 (102)
T ss_pred             eEEECCEEEEecCCCEEehhhcc--cccCCCC
Confidence            33677889999999999999966  4566884


No 95 
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=46.00  E-value=13  Score=25.12  Aligned_cols=18  Identities=28%  Similarity=0.689  Sum_probs=10.2

Q ss_pred             eeEEeCCCCCceeEEeee
Q psy2574          32 FMDVKCPGCYKITTVFSH   49 (115)
Q Consensus        32 Fm~VKCp~C~n~q~VFSH   49 (115)
                      -+-|+||+|.|.-.|=+|
T Consensus        27 vViv~C~gC~~~HlIaDn   44 (66)
T PF05180_consen   27 VVIVQCPGCKNRHLIADN   44 (66)
T ss_dssp             EEEEE-TTS--EEES--S
T ss_pred             eEEEECCCCcceeeehhh
Confidence            367999999998777555


No 96 
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=45.02  E-value=28  Score=19.70  Aligned_cols=22  Identities=27%  Similarity=0.625  Sum_probs=15.0

Q ss_pred             EeCCCCCceeEEeeecceeEEc
Q psy2574          35 VKCPGCYKITTVFSHAQSVVIC   56 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C   56 (115)
                      -||..|+|+-.+..-+...+.|
T Consensus         8 ykC~~Cgniv~v~~~~~~~l~C   29 (34)
T TIGR00319         8 YKCEVCGNIVEVLHAGGGQLVC   29 (34)
T ss_pred             EEcCCCCcEEEEEECCCcceec
Confidence            4788888888777644444544


No 97 
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=44.56  E-value=28  Score=19.77  Aligned_cols=22  Identities=27%  Similarity=0.628  Sum_probs=15.1

Q ss_pred             EeCCCCCceeEEeeecceeEEc
Q psy2574          35 VKCPGCYKITTVFSHAQSVVIC   56 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C   56 (115)
                      -||..|+|+-.+..-+...+.|
T Consensus         5 ykC~~CGniv~v~~~~~~~l~C   26 (34)
T cd00974           5 YKCEICGNIVEVLNVGGGTLVC   26 (34)
T ss_pred             EEcCCCCcEEEEEECCCcceee
Confidence            4788888888777655445555


No 98 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=44.14  E-value=29  Score=31.92  Aligned_cols=48  Identities=25%  Similarity=0.411  Sum_probs=31.0

Q ss_pred             cccccCC-CCceeEEeCCCCCceeEEeeecceeEEcCCCCeeeecccCCceeeccCCCC
Q psy2574          22 KRLVQHP-NSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTILCQPTGGRARLTEDDTG   79 (115)
Q Consensus        22 krLV~~P-nS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PTGGKA~l~egc~f   79 (115)
                      ..|+.-| +.|.=-+.|.+|+.          ++.|..|+-.|.....+..-.--.|.+
T Consensus       370 qvll~lnRrGyap~l~C~~Cg~----------~~~C~~C~~~L~~h~~~~~l~Ch~CG~  418 (665)
T PRK14873        370 PVLVQVPRRGYVPSLACARCRT----------PARCRHCTGPLGLPSAGGTPRCRWCGR  418 (665)
T ss_pred             cEEEEecCCCCCCeeEhhhCcC----------eeECCCCCCceeEecCCCeeECCCCcC
Confidence            6777766 55555668888885          466777777777665544444455544


No 99 
>PF05077 DUF678:  Protein of unknown function (DUF678);  InterPro: IPR007769 This family contains poxvirus proteins belonging to the A19 family. The proteins are of unknown function.
Probab=43.99  E-value=18  Score=25.40  Aligned_cols=48  Identities=25%  Similarity=0.508  Sum_probs=33.8

Q ss_pred             HHHhhcccccccCC-CCceeEEeCCCCCceeEEeee-------------cceeEEcCCCCeeeec
Q psy2574          15 EKRKHKLKRLVQHP-NSYFMDVKCPGCYKITTVFSH-------------AQSVVICAGCSTILCQ   65 (115)
Q Consensus        15 ek~k~K~krLV~~P-nS~Fm~VKCp~C~n~q~VFSH-------------Aqt~V~C~~Cg~vL~~   65 (115)
                      .+||+|-+.-|+.+ ...   +-|.-|+..-+-||-             ......|..||..|..
T Consensus         8 Krrkrk~~t~v~~~~d~c---~tCSsC~SkLV~~Sdvtk~sl~~~~~~g~~~tLsCsACGS~L~~   69 (74)
T PF05077_consen    8 KRRKRKPKTTVDDEEDDC---TTCSSCQSKLVKFSDVTKVSLDEYKVAGKGNTLSCSACGSELRP   69 (74)
T ss_pred             hhcccCCCceeecCCCCc---cchhhhhhheeeeecccceehhhhcccCCCCeEeehhcccccee
Confidence            34555556667776 333   778899998888883             2466789999988864


No 100
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=43.33  E-value=21  Score=21.90  Aligned_cols=26  Identities=27%  Similarity=0.828  Sum_probs=12.6

Q ss_pred             eEEeCCCCCceeEEeeecceeEEcCCCC
Q psy2574          33 MDVKCPGCYKITTVFSHAQSVVICAGCS   60 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt~V~C~~Cg   60 (115)
                      ++-.||.|+  ...|---+..+.|+.|+
T Consensus        16 L~~~Cp~C~--~PL~~~k~g~~~Cv~C~   41 (41)
T PF06677_consen   16 LDEHCPDCG--TPLMRDKDGKIYCVSCG   41 (41)
T ss_pred             hcCccCCCC--CeeEEecCCCEECCCCC
Confidence            344566663  33444334455566553


No 101
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=43.25  E-value=29  Score=24.86  Aligned_cols=29  Identities=28%  Similarity=0.529  Sum_probs=24.9

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCeeee
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCSTILC   64 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~   64 (115)
                      -.||-|++.. |=-.+.-.-.|..|+.+++
T Consensus        36 y~Cp~Cgk~~-vkR~a~GIW~C~~C~~~~A   64 (90)
T PF01780_consen   36 YTCPFCGKTS-VKRVATGIWKCKKCGKKFA   64 (90)
T ss_dssp             BEESSSSSSE-EEEEETTEEEETTTTEEEE
T ss_pred             CcCCCCCCce-eEEeeeEEeecCCCCCEEe
Confidence            4799999998 6677788899999999985


No 102
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=43.12  E-value=16  Score=20.61  Aligned_cols=18  Identities=22%  Similarity=0.468  Sum_probs=10.3

Q ss_pred             EcCCCCeeeecccCCcee
Q psy2574          55 ICAGCSTILCQPTGGRAR   72 (115)
Q Consensus        55 ~C~~Cg~vL~~PTGGKA~   72 (115)
                      .|.+||+.|.+.-|+.+.
T Consensus         1 ~CP~C~s~l~~~~~ev~~   18 (28)
T PF03119_consen    1 TCPVCGSKLVREEGEVDI   18 (28)
T ss_dssp             B-TTT--BEEE-CCTTCE
T ss_pred             CcCCCCCEeEcCCCCEeE
Confidence            488899999887776654


No 103
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=42.69  E-value=29  Score=25.07  Aligned_cols=30  Identities=27%  Similarity=0.477  Sum_probs=24.7

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCeeeec
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCSTILCQ   65 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~   65 (115)
                      -.||.|+.. +|=-=+.-.-.|..||.+++-
T Consensus        36 ~~Cp~C~~~-~VkR~a~GIW~C~kCg~~fAG   65 (89)
T COG1997          36 HVCPFCGRT-TVKRIATGIWKCRKCGAKFAG   65 (89)
T ss_pred             CcCCCCCCc-ceeeeccCeEEcCCCCCeecc
Confidence            479999999 666667778899999999863


No 104
>PRK11032 hypothetical protein; Provisional
Probab=41.97  E-value=17  Score=28.14  Aligned_cols=28  Identities=18%  Similarity=0.501  Sum_probs=23.7

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      ..|..|+... .|.|+...-.|+.||..-
T Consensus       125 LvC~~Cg~~~-~~~~p~~i~pCp~C~~~~  152 (160)
T PRK11032        125 LVCEKCHHHL-AFYTPEVLPLCPKCGHDQ  152 (160)
T ss_pred             EEecCCCCEE-EecCCCcCCCCCCCCCCe
Confidence            5799999876 569999999999999754


No 105
>PF15288 zf-CCHC_6:  Zinc knuckle
Probab=41.71  E-value=8.8  Score=23.91  Aligned_cols=22  Identities=32%  Similarity=0.647  Sum_probs=18.2

Q ss_pred             EEeCCCCCceeEEeeecceeEEcCCC
Q psy2574          34 DVKCPGCYKITTVFSHAQSVVICAGC   59 (115)
Q Consensus        34 ~VKCp~C~n~q~VFSHAqt~V~C~~C   59 (115)
                      +|||..|+.    |.|..+.-.|..=
T Consensus         1 k~kC~~CG~----~GH~~t~k~CP~~   22 (40)
T PF15288_consen    1 KVKCKNCGA----FGHMRTNKRCPMY   22 (40)
T ss_pred             Ccccccccc----ccccccCccCCCC
Confidence            489999996    7899999888753


No 106
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=40.63  E-value=26  Score=22.06  Aligned_cols=33  Identities=18%  Similarity=0.501  Sum_probs=24.7

Q ss_pred             CceeEEeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          30 SYFMDVKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        30 S~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      .+|-.-.||.|+....- .-......|..||...
T Consensus        24 ~~~TSq~C~~CG~~~~~-~~~~r~~~C~~Cg~~~   56 (69)
T PF07282_consen   24 EAYTSQTCPRCGHRNKK-RRSGRVFTCPNCGFEM   56 (69)
T ss_pred             CCCCccCccCccccccc-ccccceEEcCCCCCEE
Confidence            33356779999887776 6677788899998764


No 107
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=39.88  E-value=21  Score=30.05  Aligned_cols=35  Identities=23%  Similarity=0.502  Sum_probs=22.3

Q ss_pred             CCceeEEeCCCCCceeEE--eeec-------ceeEEcCCCCeee
Q psy2574          29 NSYFMDVKCPGCYKITTV--FSHA-------QSVVICAGCSTIL   63 (115)
Q Consensus        29 nS~Fm~VKCp~C~n~q~V--FSHA-------qt~V~C~~Cg~vL   63 (115)
                      .=+|.+++|+.|+|..-+  |+-.       --+-.|..|++=|
T Consensus       219 eW~~~R~~C~~Cg~~~~l~y~~~e~~~~~~~~r~e~C~~C~~Yl  262 (305)
T TIGR01562       219 EWHYVRVKCSHCEESKHLAYLSLEHDAEKAVLKAETCDSCQGYL  262 (305)
T ss_pred             cccccCccCCCCCCCCceeeEeecCCCCCcceEEeeccccccch
Confidence            446788999999987644  3211       1344688887654


No 108
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=39.79  E-value=13  Score=26.99  Aligned_cols=27  Identities=22%  Similarity=0.661  Sum_probs=16.3

Q ss_pred             eCCCCCceeEEeeecceeEEcCCCCeeee
Q psy2574          36 KCPGCYKITTVFSHAQSVVICAGCSTILC   64 (115)
Q Consensus        36 KCp~C~n~q~VFSHAqt~V~C~~Cg~vL~   64 (115)
                      .||.|+.-=  |.=-..+|.|..||+..-
T Consensus        11 ~Cp~CG~kF--YDLnk~PivCP~CG~~~~   37 (108)
T PF09538_consen   11 TCPSCGAKF--YDLNKDPIVCPKCGTEFP   37 (108)
T ss_pred             cCCCCcchh--ccCCCCCccCCCCCCccC
Confidence            466666543  333336777888887653


No 109
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=39.32  E-value=24  Score=26.00  Aligned_cols=39  Identities=23%  Similarity=0.466  Sum_probs=29.4

Q ss_pred             eEEeCCCCCceeEEeeecceeE-----EcCCCCeeeecccCCcee
Q psy2574          33 MDVKCPGCYKITTVFSHAQSVV-----ICAGCSTILCQPTGGRAR   72 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt~V-----~C~~Cg~vL~~PTGGKA~   72 (115)
                      .++.||-|.... ++-+.....     +|..|+.+...=+|+-+.
T Consensus        29 ~~~~cP~C~s~~-~~k~g~~~~~~qRyrC~~C~~tf~~~~~~~~~   72 (129)
T COG3677          29 TKVNCPRCKSSN-VVKIGGIRRGHQRYKCKSCGSTFTVETGSPLS   72 (129)
T ss_pred             ccCcCCCCCccc-eeeECCccccccccccCCcCcceeeeccCccc
Confidence            458899999988 666555544     799999998877776543


No 110
>PRK05580 primosome assembly protein PriA; Validated
Probab=38.49  E-value=35  Score=30.98  Aligned_cols=45  Identities=16%  Similarity=0.211  Sum_probs=26.8

Q ss_pred             hcccccccCCC-CceeEEeCCCCCce--------eEEeeecceeEEcCCCCeee
Q psy2574          19 HKLKRLVQHPN-SYFMDVKCPGCYKI--------TTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        19 ~K~krLV~~Pn-S~Fm~VKCp~C~n~--------q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      ++++.|+.-|+ .|.-.+.|..|+..        ..+|........|.-||..-
T Consensus       365 ~g~qvll~~nrrGy~~~~~C~~Cg~~~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~  418 (679)
T PRK05580        365 RGEQVLLFLNRRGYAPFLLCRDCGWVAECPHCDASLTLHRFQRRLRCHHCGYQE  418 (679)
T ss_pred             cCCeEEEEEcCCCCCCceEhhhCcCccCCCCCCCceeEECCCCeEECCCCcCCC
Confidence            34456777664 44445666666654        45565556666666666554


No 111
>PF09272 Hepsin-SRCR:  Hepsin, SRCR;  InterPro: IPR015352 This entry represents the extracellular domain of the serine protease hepsin. The domain is formed primarily by three elements of regular secondary structure: a 12-residue alpha helix, a twisted five-stranded antiparallel beta sheet, and a second, two-stranded, antiparallel sheet. The two beta-sheets lie at roughly right angles to each other, with the helix nestled between the two, adopting an SRCR fold. The exact function of this domain has not been identified, though it probably may serve to orient the protease domain or place it in the vicinity of its substrate []. ; GO: 0004252 serine-type endopeptidase activity, 0070008 serine-type exopeptidase activity; PDB: 3T2N_B 1Z8G_A 1P57_A 1O5E_L 1O5F_L.
Probab=37.15  E-value=19  Score=26.91  Aligned_cols=18  Identities=22%  Similarity=0.606  Sum_probs=9.7

Q ss_pred             cCCCCceeEEeCCCCCce
Q psy2574          26 QHPNSYFMDVKCPGCYKI   43 (115)
Q Consensus        26 ~~PnS~Fm~VKCp~C~n~   43 (115)
                      -=|+.+|+.+.|.||+.-
T Consensus        90 dCp~G~fLat~CQDCGRR  107 (110)
T PF09272_consen   90 DCPRGRFLATICQDCGRR  107 (110)
T ss_dssp             --TT-EEEEEEE---S--
T ss_pred             eCCCCceeehhhhhhCcc
Confidence            459999999999999864


No 112
>PF03117 Herpes_UL49_1:  UL49 family;  InterPro: IPR004339 UL49 proteins are present in the viral tegument at the surface of the nucleocapsid []. Many of the nonconserved tegument proteins of alpha-herpes viruses play important roles during different steps of the viral replication cycle, such as the shutoff of host cell functions by the vhs protein encoded by UL41 and the transcriptional activation of viral immediate-early genes by the UL48 gene product, VP16. UL49 of Human herpesvirus 1 (HHV-1) has been shown to directly interact with VP16. The UL49 gene products of HHV-1 and Bovine herpesvirus 1 exhibit virus-independent intercellular trafficking of unknown biological function but are dispensable for productive viral replication.  Envelope glycoprotein M (gM) and the complex formed by glycoproteins E (gE) and I (gI) are involved in the secondary envelopment of Suid herpesvirus 1 (Pseudorabies virus, PrV) particles in the cytoplasm of infected cells. In the absence of the gE-gI complex and gM, envelopment is blocked and capsids surrounded by tegument proteins accumulate in the cytoplasm. The cytoplasmic domains of gE and gM specifically interact with the C-terminal part of the UL49 gene product of PrV suggesting a role for the protein in secondary envelopment during herpesvirus virion maturation [].; GO: 0016032 viral reproduction, 0019033 viral tegument
Probab=36.87  E-value=37  Score=28.25  Aligned_cols=41  Identities=15%  Similarity=0.259  Sum_probs=33.5

Q ss_pred             cccCCCCceeEEeCCCCCceeEEeeecceeEEcCCCCe------eeeccc
Q psy2574          24 LVQHPNSYFMDVKCPGCYKITTVFSHAQSVVICAGCST------ILCQPT   67 (115)
Q Consensus        24 LV~~PnS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~------vL~~PT   67 (115)
                      ..=+|||-|.   |.|=.+.|++|++++-.|-|.-||.      .|.++.
T Consensus       126 ~~F~pts~FY---~RDqkEK~v~~c~~tgriyCS~CGS~~l~~~~l~e~~  172 (245)
T PF03117_consen  126 QNFPPTSMFY---YRDQKEKQVIYCATTGRIYCSLCGSQRLRKERLYEMY  172 (245)
T ss_pred             cCcCCcceeE---eccccceeEEEeccCCCEEEccCCCCeeEEEeeeecc
Confidence            4456888876   6777889999999999999999996      466666


No 113
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=36.72  E-value=41  Score=24.08  Aligned_cols=29  Identities=31%  Similarity=0.577  Sum_probs=24.5

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCeeee
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCSTILC   64 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~   64 (115)
                      -.||-|+... +--.+.-...|..|+.+++
T Consensus        37 y~CpfCgk~~-vkR~a~GIW~C~~C~~~~A   65 (90)
T PTZ00255         37 YFCPFCGKHA-VKRQAVGIWRCKGCKKTVA   65 (90)
T ss_pred             ccCCCCCCCc-eeeeeeEEEEcCCCCCEEe
Confidence            4799999755 6778889999999999984


No 114
>PRK06260 threonine synthase; Validated
Probab=36.40  E-value=23  Score=29.65  Aligned_cols=28  Identities=25%  Similarity=0.593  Sum_probs=20.8

Q ss_pred             eEEeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          33 MDVKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      +..+|..|+.+   |+-......|..||..|
T Consensus         2 ~~~~C~~cg~~---~~~~~~~~~Cp~cg~~l   29 (397)
T PRK06260          2 YWLKCIECGKE---YDPDEIIYTCPECGGLL   29 (397)
T ss_pred             CEEEECCCCCC---CCCCCccccCCCCCCeE
Confidence            45789999976   55555667899998654


No 115
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=35.65  E-value=27  Score=19.51  Aligned_cols=15  Identities=27%  Similarity=0.627  Sum_probs=10.9

Q ss_pred             CCCceeEEeCCCCCc
Q psy2574          28 PNSYFMDVKCPGCYK   42 (115)
Q Consensus        28 PnS~Fm~VKCp~C~n   42 (115)
                      |+.+...-+||+|+.
T Consensus        10 ~r~~~v~f~CPnCG~   24 (24)
T PF07754_consen   10 PREQAVPFPCPNCGF   24 (24)
T ss_pred             CcccCceEeCCCCCC
Confidence            556667778888874


No 116
>smart00746 TRASH metallochaperone-like domain.
Probab=35.46  E-value=34  Score=16.87  Aligned_cols=30  Identities=17%  Similarity=0.371  Sum_probs=17.9

Q ss_pred             cCCCCeeeecccCCceeeccCCCCccEEEEEeecC
Q psy2574          56 CAGCSTILCQPTGGRARLTEDDTGDSMTVRGCALD   90 (115)
Q Consensus        56 C~~Cg~vL~~PTGGKA~l~egc~f~s~~~~~ca~d   90 (115)
                      |..||..+..|+.+.....+|     -...+|+..
T Consensus         1 c~~C~~~~~~~~~~~~~~~~g-----~~~~FCs~~   30 (39)
T smart00746        1 CSFCGKDIYNPGTGIMVVNDG-----KVFYFCSSK   30 (39)
T ss_pred             CCCCCCCccCCCCceEEEECC-----EEEEEeCHH
Confidence            778888887666555443444     333556543


No 117
>PRK06450 threonine synthase; Validated
Probab=35.15  E-value=23  Score=29.40  Aligned_cols=27  Identities=19%  Similarity=0.328  Sum_probs=19.0

Q ss_pred             eEEeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          33 MDVKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      ++.+|..|+.+   |+. .....|..||-.|
T Consensus         2 ~~~~C~~Cg~~---~~~-~~~~~C~~cg~~l   28 (338)
T PRK06450          2 VKEVCMKCGKE---RES-IYEIRCKKCGGPF   28 (338)
T ss_pred             ceeEECCcCCc---CCC-cccccCCcCCCEe
Confidence            35789999987   333 4456899998654


No 118
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=34.35  E-value=31  Score=18.37  Aligned_cols=9  Identities=33%  Similarity=0.844  Sum_probs=4.9

Q ss_pred             EcCCCCeee
Q psy2574          55 ICAGCSTIL   63 (115)
Q Consensus        55 ~C~~Cg~vL   63 (115)
                      .|..|+..|
T Consensus        29 ~C~~C~~~L   37 (39)
T smart00132       29 KCSKCGKPL   37 (39)
T ss_pred             CCcccCCcC
Confidence            455555555


No 119
>KOG2906|consensus
Probab=33.83  E-value=52  Score=24.45  Aligned_cols=29  Identities=24%  Similarity=0.496  Sum_probs=24.9

Q ss_pred             eCCCCCceeEEeeecc-eeEEcCCCCeeee
Q psy2574          36 KCPGCYKITTVFSHAQ-SVVICAGCSTILC   64 (115)
Q Consensus        36 KCp~C~n~q~VFSHAq-t~V~C~~Cg~vL~   64 (115)
                      -||.|+|.-+|=+-++ ..-.|..|.-+..
T Consensus         3 FCP~Cgn~Live~g~~~~rf~C~tCpY~~~   32 (105)
T KOG2906|consen    3 FCPTCGNMLIVESGESCNRFSCRTCPYVFP   32 (105)
T ss_pred             ccCCCCCEEEEecCCeEeeEEcCCCCceee
Confidence            4999999999999888 7888999987654


No 120
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=33.79  E-value=21  Score=23.22  Aligned_cols=13  Identities=31%  Similarity=0.506  Sum_probs=9.8

Q ss_pred             EEeCCCCCceeEE
Q psy2574          34 DVKCPGCYKITTV   46 (115)
Q Consensus        34 ~VKCp~C~n~q~V   46 (115)
                      .++||.|+|..|-
T Consensus        13 Y~~Cp~CGN~~vG   25 (49)
T PF12677_consen   13 YCKCPKCGNDKVG   25 (49)
T ss_pred             hccCcccCCcEee
Confidence            3789999887653


No 121
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=33.70  E-value=65  Score=23.00  Aligned_cols=35  Identities=20%  Similarity=0.477  Sum_probs=24.9

Q ss_pred             ceeEEeCC--CCCceeEEeeecceeEEcCCCCeeeeccc
Q psy2574          31 YFMDVKCP--GCYKITTVFSHAQSVVICAGCSTILCQPT   67 (115)
Q Consensus        31 ~Fm~VKCp--~C~n~q~VFSHAqt~V~C~~Cg~vL~~PT   67 (115)
                      .|.-.-||  .|.+- +... ....-.|..|+....+|.
T Consensus        15 ~~~Y~aC~~~~C~kK-v~~~-~~~~y~C~~C~~~~~~~~   51 (146)
T PF08646_consen   15 NWYYPACPNEKCNKK-VTEN-GDGSYRCEKCNKTVENPK   51 (146)
T ss_dssp             TTEEEE-TSTTTS-B--EEE-TTTEEEETTTTEEESS-E
T ss_pred             CcEECCCCCccCCCE-eecC-CCcEEECCCCCCcCCCee
Confidence            67778999  99974 5555 667789999999987665


No 122
>PF14599 zinc_ribbon_6:  Zinc-ribbon; PDB: 2K2D_A.
Probab=33.37  E-value=40  Score=22.33  Aligned_cols=32  Identities=19%  Similarity=0.304  Sum_probs=17.3

Q ss_pred             CCceeEEeCCCCCceeEEeeecceeEEcCCCCe
Q psy2574          29 NSYFMDVKCPGCYKITTVFSHAQSVVICAGCST   61 (115)
Q Consensus        29 nS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~   61 (115)
                      +.....|.|.||++...++-|-- -.+|..||.
T Consensus        25 ~~~~v~IlCNDC~~~s~v~fH~l-g~KC~~C~S   56 (61)
T PF14599_consen   25 RNKKVWILCNDCNAKSEVPFHFL-GHKCSHCGS   56 (61)
T ss_dssp             ---EEEEEESSS--EEEEE--TT-----TTTS-
T ss_pred             hCCEEEEECCCCCCccceeeeHh-hhcCCCCCC
Confidence            55678999999999999998864 357888874


No 123
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=33.04  E-value=28  Score=22.88  Aligned_cols=32  Identities=28%  Similarity=0.724  Sum_probs=23.0

Q ss_pred             ceeEEeCCCCCceeEEeeecceeEEcCCCCeeeec
Q psy2574          31 YFMDVKCPGCYKITTVFSHAQSVVICAGCSTILCQ   65 (115)
Q Consensus        31 ~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~   65 (115)
                      +|+..+|+.|+..   |-----.|.|..||++-=+
T Consensus         2 ~~~~~~C~~Cg~~---~~~~dDiVvCp~CgapyHR   33 (54)
T PF14446_consen    2 NYEGCKCPVCGKK---FKDGDDIVVCPECGAPYHR   33 (54)
T ss_pred             CccCccChhhCCc---ccCCCCEEECCCCCCcccH
Confidence            4667889999874   4445567889999987643


No 124
>PHA02893 hypothetical protein; Provisional
Probab=32.99  E-value=29  Score=25.03  Aligned_cols=31  Identities=29%  Similarity=0.700  Sum_probs=24.0

Q ss_pred             EeCCCCCceeEEeee----------------cceeEEcCCCCeeeec
Q psy2574          35 VKCPGCYKITTVFSH----------------AQSVVICAGCSTILCQ   65 (115)
Q Consensus        35 VKCp~C~n~q~VFSH----------------Aqt~V~C~~Cg~vL~~   65 (115)
                      +-|.-|+..-+-||-                +.....|..||..|+.
T Consensus        35 ~TCSsC~SKLV~~Sdvtk~sl~~~~~~Gk~~~~~tL~CaACGS~L~~   81 (88)
T PHA02893         35 TTCQICQSKLVMFSGVNKYKLKDYLNIGKAFSNSNIKCIACGSSLCH   81 (88)
T ss_pred             cchhhhhcceeeeeccchhhhHHHHhccccCCCCceeehhhchhhhh
Confidence            578888888888883                2567788999988864


No 125
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=32.42  E-value=27  Score=31.05  Aligned_cols=34  Identities=18%  Similarity=0.479  Sum_probs=24.3

Q ss_pred             eeEEeCCCCCceeEE-eee---------cceeEEcCCCCeeeec
Q psy2574          32 FMDVKCPGCYKITTV-FSH---------AQSVVICAGCSTILCQ   65 (115)
Q Consensus        32 Fm~VKCp~C~n~q~V-FSH---------Aqt~V~C~~Cg~vL~~   65 (115)
                      ..-|.||.|+..|+. |++         ......|..||..+-+
T Consensus       198 ~~~vpCPhCg~~~~l~~~~l~w~~~~~~~~a~y~C~~Cg~~i~e  241 (557)
T PF05876_consen  198 RYYVPCPHCGEEQVLEWENLKWDKGEAPETARYVCPHCGCEIEE  241 (557)
T ss_pred             EEEccCCCCCCCccccccceeecCCCCccceEEECCCCcCCCCH
Confidence            457999999998864 232         2456678888887743


No 126
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=32.10  E-value=13  Score=30.87  Aligned_cols=31  Identities=19%  Similarity=0.522  Sum_probs=20.5

Q ss_pred             eEEeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          33 MDVKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      +-+|||.|+++--.=.-....-.|..||.-+
T Consensus        26 ~~~~c~~c~~~~~~~~l~~~~~vc~~c~~h~   56 (292)
T PRK05654         26 LWTKCPSCGQVLYRKELEANLNVCPKCGHHM   56 (292)
T ss_pred             CeeECCCccchhhHHHHHhcCCCCCCCCCCe
Confidence            6799999997533222222335799998865


No 127
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=32.09  E-value=42  Score=20.35  Aligned_cols=16  Identities=19%  Similarity=0.432  Sum_probs=13.8

Q ss_pred             eeEEcCCCCeeeeccc
Q psy2574          52 SVVICAGCSTILCQPT   67 (115)
Q Consensus        52 t~V~C~~Cg~vL~~PT   67 (115)
                      ..+.|.-|+.+|..++
T Consensus        17 ~~a~C~~C~~~l~~~~   32 (50)
T smart00614       17 QRAKCKYCGKKLSRSS   32 (50)
T ss_pred             eEEEecCCCCEeeeCC
Confidence            5789999999998775


No 128
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=32.06  E-value=56  Score=23.46  Aligned_cols=29  Identities=28%  Similarity=0.516  Sum_probs=24.1

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCeeee
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCSTILC   64 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~   64 (115)
                      -.||-|++.. |=-.+.-.-.|..|+.+++
T Consensus        36 y~CpfCgk~~-vkR~a~GIW~C~~C~~~~A   64 (91)
T TIGR00280        36 YVCPFCGKKT-VKRGSTGIWTCRKCGAKFA   64 (91)
T ss_pred             ccCCCCCCCc-eEEEeeEEEEcCCCCCEEe
Confidence            4799999766 5677888899999999984


No 129
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=32.04  E-value=26  Score=35.31  Aligned_cols=23  Identities=30%  Similarity=0.736  Sum_probs=16.6

Q ss_pred             EEeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          34 DVKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        34 ~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      ..+||.|+.+.  |+     ..|..||..+
T Consensus       667 ~rkCPkCG~~t--~~-----~fCP~CGs~t  689 (1337)
T PRK14714        667 RRRCPSCGTET--YE-----NRCPDCGTHT  689 (1337)
T ss_pred             EEECCCCCCcc--cc-----ccCcccCCcC
Confidence            46899999964  32     2788888776


No 130
>KOG1296|consensus
Probab=31.83  E-value=28  Score=27.54  Aligned_cols=64  Identities=16%  Similarity=0.187  Sum_probs=38.4

Q ss_pred             CCCCceeEEeCCCCCceeEEeeecceeEEcCCCCeeeeccc-CCceeeccCCCCc--cEEEEEeecCCCCCCccc
Q psy2574          27 HPNSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTILCQPT-GGRARLTEDDTGD--SMTVRGCALDSGTPTTDT   98 (115)
Q Consensus        27 ~PnS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PT-GGKA~l~egc~f~--s~~~~~ca~ds~~~~~d~   98 (115)
                      .+-|+||+.||..|+.+.       -.-.|+.=...++.|. -|-|.+..-|.|=  --+|+-|+ ..+.|.|++
T Consensus        23 ~~~rf~~kLkCtnCgE~~-------dkw~~I~l~E~~~~pg~Rgta~~v~KCK~C~Rensv~iv~-~~~~pyt~e   89 (161)
T KOG1296|consen   23 PDFRFYLKLKCTNCGELS-------DKWQYITLNEEVAMPGSRGTASFVMKCKFCSRENSVTIVA-FEDKPYTAE   89 (161)
T ss_pred             CCceeEEEeccccccccC-------CceEEEEeeeeecCCCCcchhhHhhhhhhhcccCcEEEec-CCCCccccc
Confidence            456789999999999864       1222333355666666 3677777777771  22333333 445555544


No 131
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=31.68  E-value=45  Score=18.67  Aligned_cols=22  Identities=27%  Similarity=0.453  Sum_probs=7.4

Q ss_pred             cCCCCeeeecccCCceeeccCC
Q psy2574          56 CAGCSTILCQPTGGRARLTEDD   77 (115)
Q Consensus        56 C~~Cg~vL~~PTGGKA~l~egc   77 (115)
                      |..||..+..=.+|.++.=+.|
T Consensus         6 C~~CG~~t~~~~~g~~r~C~~C   27 (32)
T PF09297_consen    6 CGRCGAPTKPAPGGWARRCPSC   27 (32)
T ss_dssp             -TTT--BEEE-SSSS-EEESSS
T ss_pred             cCcCCccccCCCCcCEeECCCC
Confidence            4444444444444444443333


No 132
>TIGR00320 dfx_rbo desulfoferrodoxin. This protein is described in some articles as rubredoxin oxidoreductase (rbo), and its gene shares an operon with the rubredoxin gene in Desulfovibrio vulgaris Hildenborough.
Probab=31.67  E-value=48  Score=24.37  Aligned_cols=27  Identities=26%  Similarity=0.667  Sum_probs=20.5

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      -+|+.|+|+-.+.+-....+.|  ||..|
T Consensus         8 YkC~~CGniv~v~~~g~~~l~C--Cge~m   34 (125)
T TIGR00320         8 YKCEVCGNIVEVLNAGIGQLVC--CNQPM   34 (125)
T ss_pred             EECCCCCcEEEEEECCCcceee--CCccc
Confidence            5899999999888767777777  45533


No 133
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=30.73  E-value=16  Score=27.48  Aligned_cols=41  Identities=24%  Similarity=0.517  Sum_probs=26.0

Q ss_pred             cccccCCCCceeEEeCCCCCceeEEeeecc-eeEEcCCCCeeeec
Q psy2574          22 KRLVQHPNSYFMDVKCPGCYKITTVFSHAQ-SVVICAGCSTILCQ   65 (115)
Q Consensus        22 krLV~~PnS~Fm~VKCp~C~n~q~VFSHAq-t~V~C~~Cg~vL~~   65 (115)
                      ++|-+.-+..|.  .||.|. ...-|.-|. ..-.|+.||.+|-.
T Consensus        99 ~~l~~e~~~~~Y--~Cp~c~-~r~tf~eA~~~~F~Cp~Cg~~L~~  140 (158)
T TIGR00373        99 EKLEFETNNMFF--ICPNMC-VRFTFNEAMELNFTCPRCGAMLDY  140 (158)
T ss_pred             HHHhhccCCCeE--ECCCCC-cEeeHHHHHHcCCcCCCCCCEeee
Confidence            334444444443  599998 445555443 35689999999854


No 134
>PF11331 DUF3133:  Protein of unknown function (DUF3133);  InterPro: IPR021480  This eukaryotic family of proteins has no known function. 
Probab=30.70  E-value=26  Score=22.24  Aligned_cols=17  Identities=29%  Similarity=0.616  Sum_probs=10.0

Q ss_pred             eeecceeEEcCCCCeee
Q psy2574          47 FSHAQSVVICAGCSTIL   63 (115)
Q Consensus        47 FSHAqt~V~C~~Cg~vL   63 (115)
                      ..+-+..+.|-.|+.+|
T Consensus        25 ~~k~~~klrCGaCs~vl   41 (46)
T PF11331_consen   25 SKKNQQKLRCGACSEVL   41 (46)
T ss_pred             CccceeEEeCCCCceeE
Confidence            33445566666666665


No 135
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=30.36  E-value=42  Score=25.67  Aligned_cols=28  Identities=21%  Similarity=0.519  Sum_probs=18.4

Q ss_pred             eCCCCCce--eEEeeeccee---E----EcCCCCeee
Q psy2574          36 KCPGCYKI--TTVFSHAQSV---V----ICAGCSTIL   63 (115)
Q Consensus        36 KCp~C~n~--q~VFSHAqt~---V----~C~~Cg~vL   63 (115)
                      |||-|++.  +++=|..-..   |    .|..||...
T Consensus         2 ~cp~c~~~~~~~~~s~~~~~~~~~~~~~~c~~c~~~f   38 (154)
T PRK00464          2 RCPFCGHPDTRVIDSRPAEDGNAIRRRRECLACGKRF   38 (154)
T ss_pred             cCCCCCCCCCEeEeccccCCCCceeeeeeccccCCcc
Confidence            79999963  5666663333   3    488888654


No 136
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=29.62  E-value=61  Score=23.70  Aligned_cols=52  Identities=19%  Similarity=0.378  Sum_probs=35.5

Q ss_pred             cceeEEcCCCCeeeecccCCceeeccCCCCccEEEEEeecCCCCCCccceeEEeecccceeecCCC
Q psy2574          50 AQSVVICAGCSTILCQPTGGRARLTEDDTGDSMTVRGCALDSGTPTTDTELIRMSHCGGFYFDDSQ  115 (115)
Q Consensus        50 Aqt~V~C~~Cg~vL~~PTGGKA~l~egc~f~s~~~~~ca~ds~~~~~d~~~~~~~~~~~~~~~~~~  115 (115)
                      ....-+|..|+..|..-+  |..+.+-            .|-+.+-..+|.-|=..||-.|+.|++
T Consensus        88 ~~~~sRC~~CN~~L~~v~--~~~v~~~------------vp~~v~~~~~~f~~C~~C~kiyW~GsH  139 (147)
T PF01927_consen   88 DPIFSRCPKCNGPLRPVS--KEEVKDR------------VPPYVYETYDEFWRCPGCGKIYWEGSH  139 (147)
T ss_pred             CCCCCccCCCCcEeeech--hhccccc------------cCccccccCCeEEECCCCCCEeccccc
Confidence            333457888988775543  2322222            566677777788889999999999864


No 137
>PF00236 Hormone_6:  Glycoprotein hormone;  InterPro: IPR000476 Glycoprotein hormones [, ] (or gonadotropins) are a family of proteins, which include the mammalian hormones follitropin (FSH), lutropin (LSH), thyrotropin (TSH) placental chorionic gonadotropins hCG and eCG [] and chorionic gonadotropin (CG), as well as at least two forms of fish gonadotropins. These hormones are central to the complex endocrine system that regulates normal growth, sexual development, and reproductive function []. The hormones LH, FSH and TSH are secreted by the anterior pituitary gland, while hCG and eCG are secreted by the placenta []. All these hormones consist of two glycosylated chains (alpha and beta). The alpha subunit is common to each protein dimer (well conserved within species, but differing between them []), and a unique beta subunit, which confers biological specificity []. The alpha chains are highly conserved proteins of about 100 amino acid residues which contain ten conserved cysteines all involved in disulphide bonds [], as shown in the following schematic representation.  +---------------------------+ +----------+| +-------------|--+ | || | | | xxxxCxCxxxxxxCxCCxxxxxxxxxxxxxCCxxxxxxxxxxCxCxxCx | | | | +------|-----------------+ | | | +----------------------------+ 'C': conserved cysteine involved in a disulphide bond.  Intracellular levels of free alpha subunits are greater than those of the mature glycoprotein, implying that hormone assembly is limited by the appearance of the specific beta subunits, and hence that synthesis of alpha and beta is independently regulated [].; GO: 0005179 hormone activity, 0005576 extracellular region; PDB: 1HD4_A 1QFW_A 1XWD_D 1DZ7_A 1HCN_A 1E9J_A 1HRP_A 1FL7_A.
Probab=29.58  E-value=13  Score=27.20  Aligned_cols=41  Identities=34%  Similarity=0.681  Sum_probs=27.3

Q ss_pred             CCCceeEEeCCCCC-ceeEEeee-cceeEEcCCCCeeeecccC
Q psy2574          28 PNSYFMDVKCPGCY-KITTVFSH-AQSVVICAGCSTILCQPTG   68 (115)
Q Consensus        28 PnS~Fm~VKCp~C~-n~q~VFSH-Aqt~V~C~~Cg~vL~~PTG   68 (115)
                      ||..|+..-|++|. +++..||+ -.-+-.|.+|----|-||-
T Consensus         2 p~~d~~~~gC~eC~L~~N~~fs~~~~piyQC~GCCFSrAYPTP   44 (96)
T PF00236_consen    2 PNGDFSNQGCPECKLKENKFFSRLGAPIYQCMGCCFSRAYPTP   44 (96)
T ss_dssp             -------TBS-BSEEEEETTTEBTTBEEEEEEEEEEEEEEE-S
T ss_pred             cccccccCCCCccCcccCccccCCCCceeEeeeeeeccccCCc
Confidence            78889999999995 78889999 5666789999998898984


No 138
>KOG2907|consensus
Probab=29.41  E-value=15  Score=27.65  Aligned_cols=50  Identities=20%  Similarity=0.341  Sum_probs=32.3

Q ss_pred             CCCCHHHHHHhhcccccccCCCCceeEEeCCCCCceeEEeeecce---------eEEcCCCCee
Q psy2574           8 LHPSQAEEKRKHKLKRLVQHPNSYFMDVKCPGCYKITTVFSHAQS---------VVICAGCSTI   62 (115)
Q Consensus         8 l~Ps~e~ek~k~K~krLV~~PnS~Fm~VKCp~C~n~q~VFSHAqt---------~V~C~~Cg~v   62 (115)
                      .+|++..++...-.+.     ..-=++-|||.|+++...|.-.|+         --.|..|+.-
T Consensus        53 ~~~~A~~~~ve~~~~~-----~ga~I~~kCpkCghe~m~Y~T~QlRSADEGQTVFYTC~kC~~k  111 (116)
T KOG2907|consen   53 EFTSALAEKVENESSA-----DGAVIKHKCPKCGHEEMSYHTLQLRSADEGQTVFYTCPKCKYK  111 (116)
T ss_pred             ccchhhhhhhcccccc-----cccchhccCcccCCchhhhhhhhcccccCCceEEEEcCcccee
Confidence            4566666653221111     345688999999999999985553         2468888753


No 139
>KOG1598|consensus
Probab=29.33  E-value=24  Score=32.18  Aligned_cols=36  Identities=22%  Similarity=0.366  Sum_probs=29.7

Q ss_pred             eCCCCCceeEEeeecceeEEcCCCCeee------ecccCCce
Q psy2574          36 KCPGCYKITTVFSHAQSVVICAGCSTIL------CQPTGGRA   71 (115)
Q Consensus        36 KCp~C~n~q~VFSHAqt~V~C~~Cg~vL------~~PTGGKA   71 (115)
                      -|++|+...+-=.-|+-...|..||++|      ++=|+++.
T Consensus         2 ~C~~C~~s~fe~d~a~g~~~C~~CG~v~E~~~ivsev~F~e~   43 (521)
T KOG1598|consen    2 VCKNCGGSNFERDEATGNLYCTACGTVLEYNNIVAEVTFVEG   43 (521)
T ss_pred             cCCCCCCCCcccccccCCceeccccceeeccceeEEeeeecc
Confidence            5999999888888899999999999987      44555554


No 140
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=29.21  E-value=58  Score=19.66  Aligned_cols=22  Identities=27%  Similarity=0.638  Sum_probs=10.8

Q ss_pred             EeCCCCCceeEEeeecceeEEc
Q psy2574          35 VKCPGCYKITTVFSHAQSVVIC   56 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C   56 (115)
                      -||..|+|+--|..-..-...|
T Consensus         7 YkC~~CGniVev~~~g~g~lvC   28 (36)
T PF06397_consen    7 YKCEHCGNIVEVVHDGGGPLVC   28 (36)
T ss_dssp             EE-TTT--EEEEEE--SS-EEE
T ss_pred             EEccCCCCEEEEEECCCCCEEe
Confidence            4788888887766655555555


No 141
>PF09814 HECT_2:  HECT-like Ubiquitin-conjugating enzyme (E2)-binding;  InterPro: IPR019193 This entry consists of E3 ubiquitin-protein ligases which accept ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfer it to substrates, generally promoting their degradation by the proteasome [].
Probab=29.11  E-value=50  Score=26.68  Aligned_cols=52  Identities=15%  Similarity=0.183  Sum_probs=34.7

Q ss_pred             ccccccCCCCceeEEeC-----CCCCceeEEeeecceeEEcCCCCeeee-cccCCceeecc
Q psy2574          21 LKRLVQHPNSYFMDVKC-----PGCYKITTVFSHAQSVVICAGCSTILC-QPTGGRARLTE   75 (115)
Q Consensus        21 ~krLV~~PnS~Fm~VKC-----p~C~n~q~VFSHAqt~V~C~~Cg~vL~-~PTGGKA~l~e   75 (115)
                      ...+.|.++.-|+..--     .+|.+..+...   ..|.|..|+..|. .+.++-.+|-.
T Consensus       159 ~~~l~p~~~~~lvg~~~~l~~~~~~~~~~~~~~---~~v~C~~C~~~LG~~~~~~~~rL~K  216 (354)
T PF09814_consen  159 NNSLKPREGDILVGDSYFLLHESDLQGDVIRIE---RIVRCKRCSSQLGEKFSDNTVRLYK  216 (354)
T ss_pred             ccccccCCCcEEEechhheecchhcccccccCC---cEEEeCCCCceeCCCccCCeEEEEe
Confidence            37788888876655432     33444444444   7899999999998 66655555544


No 142
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=28.97  E-value=72  Score=20.53  Aligned_cols=34  Identities=24%  Similarity=0.571  Sum_probs=22.5

Q ss_pred             eeEEeCCCCCceeEEeeecceeEEcCCCCe-eeecc
Q psy2574          32 FMDVKCPGCYKITTVFSHAQSVVICAGCST-ILCQP   66 (115)
Q Consensus        32 Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~-vL~~P   66 (115)
                      -|.-+|..|+.+- --.-....|.|.-||. +|..|
T Consensus         4 ~~~Y~C~~Cg~~~-~~~~~~~~irCp~Cg~rIl~K~   38 (49)
T COG1996           4 MMEYKCARCGREV-ELDQETRGIRCPYCGSRILVKE   38 (49)
T ss_pred             eEEEEhhhcCCee-ehhhccCceeCCCCCcEEEEec
Confidence            3566888888875 2234667888998875 44444


No 143
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=28.42  E-value=19  Score=23.84  Aligned_cols=35  Identities=26%  Similarity=0.453  Sum_probs=26.0

Q ss_pred             eEEeCCCCCceeEEee----------ecceeEEcCCCCeeeeccc
Q psy2574          33 MDVKCPGCYKITTVFS----------HAQSVVICAGCSTILCQPT   67 (115)
Q Consensus        33 m~VKCp~C~n~q~VFS----------HAqt~V~C~~Cg~vL~~PT   67 (115)
                      |+|+|.=|.++-.|=.          ++-..--|.-|..-|..+|
T Consensus         1 m~vkC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~RI~~~t   45 (56)
T PF09963_consen    1 MRVKCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKERIREET   45 (56)
T ss_pred             CeeEEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHHHHhHHH
Confidence            6788888888877765          5556667888877777666


No 144
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=28.34  E-value=19  Score=27.72  Aligned_cols=40  Identities=28%  Similarity=0.562  Sum_probs=25.2

Q ss_pred             ccccCCCCceeEEeCCCCCceeEEeeecc-eeEEcCCCCeeeec
Q psy2574          23 RLVQHPNSYFMDVKCPGCYKITTVFSHAQ-SVVICAGCSTILCQ   65 (115)
Q Consensus        23 rLV~~PnS~Fm~VKCp~C~n~q~VFSHAq-t~V~C~~Cg~vL~~   65 (115)
                      +|-+.-+..|  -.||.|+. ...|.-|- ..-.|..||.+|.+
T Consensus       108 ~l~~e~~~~~--Y~Cp~C~~-rytf~eA~~~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        108 QLEEEENNMF--FFCPNCHI-RFTFDEAMEYGFRCPQCGEMLEE  148 (178)
T ss_pred             HhhhccCCCE--EECCCCCc-EEeHHHHhhcCCcCCCCCCCCee
Confidence            3444444444  36999983 44444333 35789999999965


No 145
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=28.15  E-value=63  Score=23.51  Aligned_cols=35  Identities=26%  Similarity=0.602  Sum_probs=25.7

Q ss_pred             ceeEEeCCCCCceeEEeeecceeEEcCCCCeeeeccc
Q psy2574          31 YFMDVKCPGCYKITTVFSHAQSVVICAGCSTILCQPT   67 (115)
Q Consensus        31 ~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PT   67 (115)
                      .|...-||.|.+- ++ ......-.|..|+....+|.
T Consensus        31 ~~~Y~aC~~C~kk-v~-~~~~~~~~C~~C~~~~~~~~   65 (166)
T cd04476          31 NWWYPACPGCNKK-VV-EEGNGTYRCEKCNKSVPNPE   65 (166)
T ss_pred             CeEEccccccCcc-cE-eCCCCcEECCCCCCcCCCcc
Confidence            6888999999885 33 33337788999998875554


No 146
>PRK09710 lar restriction alleviation and modification protein; Reviewed
Probab=27.74  E-value=76  Score=21.58  Aligned_cols=26  Identities=23%  Similarity=0.530  Sum_probs=18.7

Q ss_pred             CCCCCceeEEeeecce--eEEcCCCCee
Q psy2574          37 CPGCYKITTVFSHAQS--VVICAGCSTI   62 (115)
Q Consensus        37 Cp~C~n~q~VFSHAqt--~V~C~~Cg~v   62 (115)
                      ||-|+...+..-|...  .|.|.+|+..
T Consensus         9 CPFCG~~~~~v~~~~g~~~v~C~~CgA~   36 (64)
T PRK09710          9 CPFCGCPSVTVKAISGYYRAKCNGCESR   36 (64)
T ss_pred             CCCCCCceeEEEecCceEEEEcCCCCcC
Confidence            8888887777776543  3678888873


No 147
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=27.49  E-value=27  Score=32.15  Aligned_cols=24  Identities=29%  Similarity=0.661  Sum_probs=12.3

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      ++||.|+.+.     +.....|..||+.|
T Consensus         2 ~~Cp~Cg~~n-----~~~akFC~~CG~~l   25 (645)
T PRK14559          2 LICPQCQFEN-----PNNNRFCQKCGTSL   25 (645)
T ss_pred             CcCCCCCCcC-----CCCCccccccCCCC
Confidence            3566666542     34444555555555


No 148
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=27.45  E-value=1e+02  Score=23.23  Aligned_cols=23  Identities=30%  Similarity=1.003  Sum_probs=13.7

Q ss_pred             eCCCCCceeEEeeecceeEEcCCCCeeeecc
Q psy2574          36 KCPGCYKITTVFSHAQSVVICAGCSTILCQP   66 (115)
Q Consensus        36 KCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~P   66 (115)
                      -||-|+|..       -.+.| .||+++|--
T Consensus        79 gCP~CGn~~-------~fa~C-~CGkl~Ci~  101 (131)
T PF15616_consen   79 GCPHCGNQY-------AFAVC-GCGKLFCID  101 (131)
T ss_pred             CCCCCcChh-------cEEEe-cCCCEEEeC
Confidence            488888752       34555 566666643


No 149
>PF08150 FerB:  FerB (NUC096) domain;  InterPro: IPR012561  The ferlin gene family are characterised by multiple tandem C2 domains and a C-terminal transmembrane domain. They are found in a wide range of species and their function remains unknown, however, mutations in its two most well-characterised members, dysferlin and otoferlin, have been implicated in human disease []. This is central domain B in proteins of the Ferlin family [].; GO: 0016021 integral to membrane
Probab=27.27  E-value=27  Score=24.27  Aligned_cols=10  Identities=50%  Similarity=0.816  Sum_probs=8.2

Q ss_pred             CCceeEEeee
Q psy2574          40 CYKITTVFSH   49 (115)
Q Consensus        40 C~n~q~VFSH   49 (115)
                      |+++|++|=.
T Consensus        43 CGk~qt~flk   52 (76)
T PF08150_consen   43 CGKIQTLFLK   52 (76)
T ss_pred             cCeeEEEEEE
Confidence            8899988854


No 150
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=27.26  E-value=34  Score=21.23  Aligned_cols=28  Identities=29%  Similarity=0.763  Sum_probs=17.3

Q ss_pred             eCCCCCceeE--Ee---eecceeEEcCCCCeee
Q psy2574          36 KCPGCYKITT--VF---SHAQSVVICAGCSTIL   63 (115)
Q Consensus        36 KCp~C~n~q~--VF---SHAqt~V~C~~Cg~vL   63 (115)
                      .|.+|+-.=-  .+   -.....+.|..||..|
T Consensus        24 ~C~gC~~~l~~~~~~~i~~~~~i~~Cp~CgRiL   56 (56)
T PF02591_consen   24 TCSGCHMELPPQELNEIRKGDEIVFCPNCGRIL   56 (56)
T ss_pred             ccCCCCEEcCHHHHHHHHcCCCeEECcCCCccC
Confidence            7888863210  01   1224789999999876


No 151
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]
Probab=27.03  E-value=30  Score=29.61  Aligned_cols=31  Identities=19%  Similarity=0.522  Sum_probs=20.5

Q ss_pred             eEEeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          33 MDVKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      +-+|||.|+..---=.=-+..-.|..|+.-.
T Consensus        27 lw~KCp~c~~~~y~~eL~~n~~vcp~c~~h~   57 (294)
T COG0777          27 LWTKCPSCGEMLYRKELESNLKVCPKCGHHM   57 (294)
T ss_pred             ceeECCCccceeeHHHHHhhhhcccccCccc
Confidence            5589999986432222345567799998765


No 152
>COG3088 CcmH Uncharacterized protein involved in biosynthesis of c-type cytochromes [Posttranslational modification, protein turnover, chaperones]
Probab=26.82  E-value=27  Score=27.31  Aligned_cols=37  Identities=24%  Similarity=0.438  Sum_probs=27.7

Q ss_pred             cccCCCCHHHHHHhhcccccccCCCCceeEEeCCCCCceeEEeeecc
Q psy2574           5 KDLLHPSQAEEKRKHKLKRLVQHPNSYFMDVKCPGCYKITTVFSHAQ   51 (115)
Q Consensus         5 ~DLl~Ps~e~ek~k~K~krLV~~PnS~Fm~VKCp~C~n~q~VFSHAq   51 (115)
                      .+....++++|+|.+-.-          =..+||.|.|..|.=|.|.
T Consensus        25 d~~~f~~~~qe~ra~~Lt----------~~LRCp~CQNqsIadSnA~   61 (153)
T COG3088          25 DTEQFADPAQEQRARALT----------EELRCPQCQNQSIADSNAP   61 (153)
T ss_pred             CcccCCCHHHHHHHHHHH----------HhcCCCcCCCCChhhhccH
Confidence            366778899998877321          2378999999999877764


No 153
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=26.74  E-value=48  Score=28.09  Aligned_cols=35  Identities=29%  Similarity=0.535  Sum_probs=19.2

Q ss_pred             CCceeEEeCCCCCceeEE--eee-----cceeEEcCCCCeee
Q psy2574          29 NSYFMDVKCPGCYKITTV--FSH-----AQSVVICAGCSTIL   63 (115)
Q Consensus        29 nS~Fm~VKCp~C~n~q~V--FSH-----Aqt~V~C~~Cg~vL   63 (115)
                      .=+|.+++|+.|++..-+  |+-     +--+-.|..|++=|
T Consensus       221 eW~~~R~~C~~Cg~~~~l~y~~~~~~~~~~r~e~C~~C~~Yl  262 (309)
T PRK03564        221 EWHVVRVKCSNCEQSGKLHYWSLDSEQAAVKAESCGDCGTYL  262 (309)
T ss_pred             cccccCccCCCCCCCCceeeeeecCCCcceEeeecccccccc
Confidence            345778888888875322  211     11334566666544


No 154
>PHA02942 putative transposase; Provisional
Probab=26.68  E-value=49  Score=28.20  Aligned_cols=29  Identities=24%  Similarity=0.469  Sum_probs=20.2

Q ss_pred             eEEeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          33 MDVKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      =.-.||.|+.+..  +.+.-...|..||..+
T Consensus       324 TSq~Cs~CG~~~~--~l~~r~f~C~~CG~~~  352 (383)
T PHA02942        324 SSVSCPKCGHKMV--EIAHRYFHCPSCGYEN  352 (383)
T ss_pred             CCccCCCCCCccC--cCCCCEEECCCCCCEe
Confidence            4567888887653  3345578888888764


No 155
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=26.51  E-value=53  Score=19.02  Aligned_cols=24  Identities=25%  Similarity=0.473  Sum_probs=15.0

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCe
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCST   61 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~   61 (115)
                      -+|+.|+.+-.-   ....-.|.+||.
T Consensus         3 ~~C~~CG~i~~g---~~~p~~CP~Cg~   26 (34)
T cd00729           3 WVCPVCGYIHEG---EEAPEKCPICGA   26 (34)
T ss_pred             EECCCCCCEeEC---CcCCCcCcCCCC
Confidence            468888876332   223457888876


No 156
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=26.31  E-value=63  Score=18.38  Aligned_cols=28  Identities=14%  Similarity=0.603  Sum_probs=14.0

Q ss_pred             CCceeEEeCCCCCceeEEeeecceeEEcCCCCe
Q psy2574          29 NSYFMDVKCPGCYKITTVFSHAQSVVICAGCST   61 (115)
Q Consensus        29 nS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~   61 (115)
                      +..++--+|.+|+.++.    .- ...|..|+.
T Consensus         6 ~~~l~~~rC~~Cg~~~~----pP-r~~Cp~C~s   33 (37)
T PF12172_consen    6 EGRLLGQRCRDCGRVQF----PP-RPVCPHCGS   33 (37)
T ss_dssp             TT-EEEEE-TTT--EEE----S---SEETTTT-
T ss_pred             CCEEEEEEcCCCCCEec----CC-CcCCCCcCc
Confidence            45678888999987732    21 255677764


No 157
>COG2023 RPR2 RNase P subunit RPR2 [Translation, ribosomal structure and biogenesis]
Probab=26.20  E-value=93  Score=22.94  Aligned_cols=33  Identities=33%  Similarity=0.667  Sum_probs=24.7

Q ss_pred             eCCCCCce-------eEEeeecceeEEcCCCCeeeecccC
Q psy2574          36 KCPGCYKI-------TTVFSHAQSVVICAGCSTILCQPTG   68 (115)
Q Consensus        36 KCp~C~n~-------q~VFSHAqt~V~C~~Cg~vL~~PTG   68 (115)
                      -|.+|+..       .+-+--...+|.|..||...--|-|
T Consensus        58 ~CkkC~t~Lvpg~n~rvR~~~~~v~vtC~~CG~~~R~p~~   97 (105)
T COG2023          58 ICKKCYTPLVPGKNARVRLRKGRVVVTCLECGTIRRYPYG   97 (105)
T ss_pred             hccccCcccccCcceEEEEcCCeEEEEecCCCcEEEeccc
Confidence            48888763       4555555688999999998877776


No 158
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=26.12  E-value=86  Score=19.32  Aligned_cols=29  Identities=17%  Similarity=0.344  Sum_probs=17.3

Q ss_pred             eCCCCCceeEEee------ecceeEEcCCCCeeee
Q psy2574          36 KCPGCYKITTVFS------HAQSVVICAGCSTILC   64 (115)
Q Consensus        36 KCp~C~n~q~VFS------HAqt~V~C~~Cg~vL~   64 (115)
                      -||-|+.....|-      .-...+.|..||....
T Consensus         3 PCPfCGg~~~~~~~~~~~~~~~~~~~C~~Cga~~~   37 (53)
T TIGR03655         3 PCPFCGGADVYLRRGFDPLDLSHYFECSTCGASGP   37 (53)
T ss_pred             CCCCCCCcceeeEeccCCCCCEEEEECCCCCCCcc
Confidence            3788887666342      2233447888877643


No 159
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=25.49  E-value=33  Score=26.19  Aligned_cols=26  Identities=8%  Similarity=0.144  Sum_probs=15.2

Q ss_pred             eCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          36 KCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        36 KCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      .||.|+..-  |.-...++.|..||++.
T Consensus        11 ~Cp~cg~kF--YDLnk~p~vcP~cg~~~   36 (129)
T TIGR02300        11 ICPNTGSKF--YDLNRRPAVSPYTGEQF   36 (129)
T ss_pred             cCCCcCccc--cccCCCCccCCCcCCcc
Confidence            366665432  33344677777777764


No 160
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=25.05  E-value=54  Score=22.73  Aligned_cols=26  Identities=27%  Similarity=0.406  Sum_probs=13.5

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCC
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCS   60 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg   60 (115)
                      ++||=|+..++-=.-..+--.|.+|+
T Consensus         2 ~~CPCCg~~Tl~~~~~~~ydIC~VC~   27 (78)
T PF14206_consen    2 YPCPCCGYYTLEERGEGTYDICPVCF   27 (78)
T ss_pred             ccCCCCCcEEeccCCCcCceECCCCC
Confidence            46776666554322222344566664


No 161
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=24.93  E-value=59  Score=26.11  Aligned_cols=27  Identities=19%  Similarity=0.383  Sum_probs=18.2

Q ss_pred             eCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          36 KCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        36 KCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      -|+.|+....+ .+....-.|..||...
T Consensus       101 fC~~CG~~~~~-~~~~~~~~C~~c~~~~  127 (256)
T PRK00241        101 FCGYCGHPMHP-SKTEWAMLCPHCRERY  127 (256)
T ss_pred             cccccCCCCee-cCCceeEECCCCCCEE
Confidence            48888876544 4566777788887544


No 162
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=24.84  E-value=22  Score=30.23  Aligned_cols=59  Identities=29%  Similarity=0.498  Sum_probs=41.2

Q ss_pred             EeCCCCCceeEEeeec-ceeEEcCCCCeeeecccCCceeeccCCCCccEEEEEeecCCCCCCccceeEEeecccc
Q psy2574          35 VKCPGCYKITTVFSHA-QSVVICAGCSTILCQPTGGRARLTEDDTGDSMTVRGCALDSGTPTTDTELIRMSHCGG  108 (115)
Q Consensus        35 VKCp~C~n~q~VFSHA-qt~V~C~~Cg~vL~~PTGGKA~l~egc~f~s~~~~~ca~ds~~~~~d~~~~~~~~~~~  108 (115)
                      -+|-||++....+.-- =-++.|..|..+.-       .|+-.-    --++.-.+|.   |+.+||.||-| ||
T Consensus        21 k~CaDCga~~P~W~S~nlGvfiCi~CagvHR-------sLGvhi----S~VKSitLD~---wt~~~l~~m~~-gG   80 (319)
T COG5347          21 KKCADCGAPNPTWASVNLGVFLCIDCAGVHR-------SLGVHI----SKVKSLTLDN---WTEEELRRMEV-GG   80 (319)
T ss_pred             CccccCCCCCCceEecccCeEEEeecchhhh-------ccccce----eeeeeeeccc---CCHHHHHHHHH-hc
Confidence            4799999998777543 34778999988761       122221    2255556665   99999999998 65


No 163
>PF09947 DUF2180:  Uncharacterized protein conserved in archaea (DUF2180);  InterPro: IPR017211 This group represents a predicted zinc finger protein, AF1427 type.
Probab=24.70  E-value=17  Score=24.89  Aligned_cols=27  Identities=30%  Similarity=0.716  Sum_probs=20.8

Q ss_pred             eCCCCCceeEEeeecceeEEcCCCCeeeec
Q psy2574          36 KCPGCYKITTVFSHAQSVVICAGCSTILCQ   65 (115)
Q Consensus        36 KCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~   65 (115)
                      ||-+|..+..   -+..+-.|.+||.-||.
T Consensus         2 kCY~Ca~~gk---dt~AVavCivCG~GlC~   28 (68)
T PF09947_consen    2 KCYDCAEEGK---DTDAVAVCIVCGAGLCM   28 (68)
T ss_pred             cchhhhhcCC---CccceehHHhcCchhhH
Confidence            6777777766   34677889999998874


No 164
>COG5349 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.17  E-value=31  Score=26.31  Aligned_cols=57  Identities=19%  Similarity=0.263  Sum_probs=39.1

Q ss_pred             ccCCCCceeEEeCCCCCceeEEeeecceeEEcCCCCeeeecccCCceeeccCCCCccEEEEE
Q psy2574          25 VQHPNSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTILCQPTGGRARLTEDDTGDSMTVRG   86 (115)
Q Consensus        25 V~~PnS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PTGGKA~l~egc~f~s~~~~~   86 (115)
                      +..|=..=++-.||.|++=..-=.--..+-.|..||.-+     |.++-.+|=.|-++.|.|
T Consensus        12 ~~~pi~~Gl~grCP~CGeGrLF~gFLK~~p~C~aCG~dy-----g~~~a~DgPa~fvI~IvG   68 (126)
T COG5349          12 VVTPIKRGLRGRCPRCGEGRLFRGFLKVVPACEACGLDY-----GFADADDGPAYFVILIVG   68 (126)
T ss_pred             cCcHHHHHhcCCCCCCCCchhhhhhcccCchhhhccccc-----cCCcccCCCcEEEEEeec
Confidence            334444446788999998655433445567899999887     667777777777776655


No 165
>smart00336 BBOX B-Box-type zinc finger.
Probab=24.07  E-value=56  Score=18.10  Aligned_cols=28  Identities=18%  Similarity=0.449  Sum_probs=20.2

Q ss_pred             EeCCCCC-ceeEEeeecceeEEcCCCCee
Q psy2574          35 VKCPGCY-KITTVFSHAQSVVICAGCSTI   62 (115)
Q Consensus        35 VKCp~C~-n~q~VFSHAqt~V~C~~Cg~v   62 (115)
                      ..|+.+. +.-.+|...-..+.|..|-..
T Consensus         4 ~~C~~h~~~~~~~~C~~c~~~iC~~C~~~   32 (42)
T smart00336        4 PKCDSHGDEPAEFFCEECGALLCRTCDEA   32 (42)
T ss_pred             CcCCCCCCCceEEECCCCCcccccccChh
Confidence            4588887 555778888777888887643


No 166
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=23.88  E-value=68  Score=27.83  Aligned_cols=35  Identities=20%  Similarity=0.434  Sum_probs=24.1

Q ss_pred             EeCCCCCceeEEee-ecceeEEcCCCCeeeecccCC
Q psy2574          35 VKCPGCYKITTVFS-HAQSVVICAGCSTILCQPTGG   69 (115)
Q Consensus        35 VKCp~C~n~q~VFS-HAqt~V~C~~Cg~vL~~PTGG   69 (115)
                      +-|++|....-+=. .......|.-||.+|.+...+
T Consensus        11 ~~C~~Cd~l~~~~~l~~g~~a~CpRCg~~L~~~~~~   46 (419)
T PRK15103         11 ILCPQCDMLVALPRLEHGQKAACPRCGTTLTVRWDE   46 (419)
T ss_pred             ccCCCCCceeecCCCCCCCeeECCCCCCCCcCCCCC
Confidence            66999998754332 223357799999999766543


No 167
>PF14353 CpXC:  CpXC protein
Probab=23.79  E-value=57  Score=22.93  Aligned_cols=18  Identities=17%  Similarity=0.554  Sum_probs=14.6

Q ss_pred             CCceeEEeCCCCCceeEE
Q psy2574          29 NSYFMDVKCPGCYKITTV   46 (115)
Q Consensus        29 nS~Fm~VKCp~C~n~q~V   46 (115)
                      +..|..+.||.|+....+
T Consensus        33 ~g~l~~~~CP~Cg~~~~~   50 (128)
T PF14353_consen   33 DGSLFSFTCPSCGHKFRL   50 (128)
T ss_pred             cCCcCEEECCCCCCceec
Confidence            778888999999987643


No 168
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=23.63  E-value=54  Score=18.93  Aligned_cols=22  Identities=18%  Similarity=0.480  Sum_probs=12.4

Q ss_pred             ecceeEEcCCCCeeeecccCCc
Q psy2574          49 HAQSVVICAGCSTILCQPTGGR   70 (115)
Q Consensus        49 HAqt~V~C~~Cg~vL~~PTGGK   70 (115)
                      .....+.|..|+.++....||-
T Consensus        12 ~~~~~a~C~~C~~~~~~~~~~t   33 (45)
T PF02892_consen   12 GDKKKAKCKYCGKVIKYSSGGT   33 (45)
T ss_dssp             GCSS-EEETTTTEE-----SST
T ss_pred             CCcCeEEeCCCCeEEeeCCCcH
Confidence            4567889999999998875554


No 169
>PF06221 zf-C2HC5:  Putative zinc finger motif, C2HC5-type;  InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=23.09  E-value=44  Score=21.96  Aligned_cols=17  Identities=29%  Similarity=0.841  Sum_probs=13.2

Q ss_pred             eEEcCCCCeeeecccCC
Q psy2574          53 VVICAGCSTILCQPTGG   69 (115)
Q Consensus        53 ~V~C~~Cg~vL~~PTGG   69 (115)
                      .-+|..||+++|.--|.
T Consensus        18 ~~NCl~CGkIiC~~Eg~   34 (57)
T PF06221_consen   18 APNCLNCGKIICEQEGP   34 (57)
T ss_pred             cccccccChhhcccccC
Confidence            45788888888887764


No 170
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=22.98  E-value=73  Score=18.82  Aligned_cols=14  Identities=21%  Similarity=0.567  Sum_probs=8.2

Q ss_pred             ceeEEcCCCCeeee
Q psy2574          51 QSVVICAGCSTILC   64 (115)
Q Consensus        51 qt~V~C~~Cg~vL~   64 (115)
                      +..+.|..|+..++
T Consensus         2 ~~~~~C~nC~R~v~   15 (33)
T PF08209_consen    2 SPYVECPNCGRPVA   15 (33)
T ss_dssp             S-EEE-TTTSSEEE
T ss_pred             CCeEECCCCcCCcc
Confidence            34577777777764


No 171
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=22.96  E-value=39  Score=23.12  Aligned_cols=23  Identities=30%  Similarity=0.911  Sum_probs=10.9

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCe
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCST   61 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~   61 (115)
                      .+|-.|++++-    -.+.+.|..||.
T Consensus        10 lrC~aCf~~t~----~~~k~FCp~CGn   32 (73)
T PF08772_consen   10 LRCHACFKITK----DMTKQFCPKCGN   32 (73)
T ss_dssp             EE-SSS--EES-----SS--S-SSS--
T ss_pred             EEccccccCcC----CCCceeCcccCC
Confidence            57888988775    457788999985


No 172
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction.
Probab=22.85  E-value=47  Score=18.20  Aligned_cols=25  Identities=16%  Similarity=0.539  Sum_probs=18.4

Q ss_pred             eCCCCCc-eeEEeeecceeEEcCCCC
Q psy2574          36 KCPGCYK-ITTVFSHAQSVVICAGCS   60 (115)
Q Consensus        36 KCp~C~n-~q~VFSHAqt~V~C~~Cg   60 (115)
                      .|+.+.+ .-.+|..+-....|..|.
T Consensus         2 ~C~~H~~~~~~~fC~~~~~~iC~~C~   27 (39)
T cd00021           2 LCDEHGEEPLSLFCETDRALLCVDCD   27 (39)
T ss_pred             CCCccCCcceEEEeCccChhhhhhcC
Confidence            5777866 557787777777777775


No 173
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=22.63  E-value=86  Score=19.65  Aligned_cols=17  Identities=18%  Similarity=0.448  Sum_probs=12.0

Q ss_pred             eecceeEEcCCCCeeee
Q psy2574          48 SHAQSVVICAGCSTILC   64 (115)
Q Consensus        48 SHAqt~V~C~~Cg~vL~   64 (115)
                      +.......|..||+.|.
T Consensus        43 ~~~~~r~FC~~CGs~l~   59 (92)
T PF04828_consen   43 GKGVERYFCPTCGSPLF   59 (92)
T ss_dssp             TSSCEEEEETTT--EEE
T ss_pred             CCcCcCcccCCCCCeee
Confidence            45556788999999998


No 174
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=22.59  E-value=69  Score=20.75  Aligned_cols=21  Identities=29%  Similarity=0.805  Sum_probs=16.0

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCe
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCST   61 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~   61 (115)
                      +.||.|++...      .-..|..||.
T Consensus        28 ~~C~~CG~~~~------~H~vC~~CG~   48 (57)
T PRK12286         28 VECPNCGEPKL------PHRVCPSCGY   48 (57)
T ss_pred             eECCCCCCccC------CeEECCCCCc
Confidence            78999998653      3467888884


No 175
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=22.39  E-value=33  Score=17.97  Aligned_cols=23  Identities=26%  Similarity=0.609  Sum_probs=14.6

Q ss_pred             EeCCCCCceeEEeeecceeEEcCCCCee
Q psy2574          35 VKCPGCYKITTVFSHAQSVVICAGCSTI   62 (115)
Q Consensus        35 VKCp~C~n~q~VFSHAqt~V~C~~Cg~v   62 (115)
                      ..|+.|...+     ......|..|++.
T Consensus         3 W~C~~C~~~N-----~~~~~~C~~C~~p   25 (26)
T smart00547        3 WECPACTFLN-----FASRSKCFACGAP   25 (26)
T ss_pred             ccCCCCCCcC-----hhhhccccccCCc
Confidence            4688887544     2344578888764


No 176
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only]
Probab=22.34  E-value=70  Score=23.73  Aligned_cols=36  Identities=19%  Similarity=0.362  Sum_probs=23.0

Q ss_pred             EEeCCCCCceeEEeeecceeEEcCCCCeeeecccCCcee
Q psy2574          34 DVKCPGCYKITTVFSHAQSVVICAGCSTILCQPTGGRAR   72 (115)
Q Consensus        34 ~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PTGGKA~   72 (115)
                      ..+|.+|...   |.--.....|+.||..-.+=.+|+.-
T Consensus        70 ~~~C~~C~~~---~~~e~~~~~CP~C~s~~~~i~~G~el  105 (115)
T COG0375          70 ECWCLDCGQE---VELEELDYRCPKCGSINLRIIGGDEL  105 (115)
T ss_pred             EEEeccCCCe---ecchhheeECCCCCCCceEEecCCee
Confidence            5789999433   23223334499999877666666643


No 177
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=22.13  E-value=1.3e+02  Score=16.95  Aligned_cols=10  Identities=20%  Similarity=0.644  Sum_probs=5.6

Q ss_pred             cCCCCeeeec
Q psy2574          56 CAGCSTILCQ   65 (115)
Q Consensus        56 C~~Cg~vL~~   65 (115)
                      |..||..+..
T Consensus        35 C~~CGE~~~~   44 (46)
T TIGR03831        35 CPQCGEEYLD   44 (46)
T ss_pred             cccCCCEeeC
Confidence            6666665543


No 178
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=22.12  E-value=23  Score=29.34  Aligned_cols=29  Identities=21%  Similarity=0.771  Sum_probs=20.7

Q ss_pred             eEEeCCCCCceeEEeee--cceeEEcCCCCeee
Q psy2574          33 MDVKCPGCYKITTVFSH--AQSVVICAGCSTIL   63 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSH--Aqt~V~C~~Cg~vL   63 (115)
                      +-+|||.|+++  +|..  ...--.|..||.-+
T Consensus        25 ~~~~c~~c~~~--~~~~~l~~~~~vc~~c~~h~   55 (285)
T TIGR00515        25 VWTKCPKCGQV--LYTKELERNLEVCPKCDHHM   55 (285)
T ss_pred             CeeECCCCcch--hhHHHHHhhCCCCCCCCCcC
Confidence            67999999975  4443  23446799999864


No 179
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=21.85  E-value=53  Score=26.82  Aligned_cols=39  Identities=18%  Similarity=0.405  Sum_probs=26.9

Q ss_pred             CCceeEEeCCCCCceeE-----EeeecceeEEcCCCCeeeeccc
Q psy2574          29 NSYFMDVKCPGCYKITT-----VFSHAQSVVICAGCSTILCQPT   67 (115)
Q Consensus        29 nS~Fm~VKCp~C~n~q~-----VFSHAqt~V~C~~Cg~vL~~PT   67 (115)
                      ...+..+.|..|++..-     .+-+..-+..|..||..+.+|.
T Consensus       117 HGsl~~~~C~~C~~~~~~~~~~~~~~~~~~p~C~~Cg~~~lrP~  160 (250)
T COG0846         117 HGSLKRVRCSKCGNQYYDEDVIKFIEDGLIPRCPKCGGPVLRPD  160 (250)
T ss_pred             ccceeeeEeCCCcCccchhhhhhhcccCCCCcCccCCCccccCC
Confidence            35678899999986543     2333334678999999655664


No 180
>cd00674 LysRS_core_class_I catalytic core domain of  class I lysyl tRNA synthetase. Class I lysyl tRNA synthetase (LysRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The class I LysRS is found only in archaea and some bacteria and has evolved separately from class II LysRS, as the two do not share structural or sequence similarity.
Probab=21.68  E-value=2e+02  Score=24.61  Aligned_cols=45  Identities=24%  Similarity=0.405  Sum_probs=26.4

Q ss_pred             CCce-eEEeCCCCCceeEEe-eec----ceeEEcCCCCeeeec-ccCCceeec
Q psy2574          29 NSYF-MDVKCPGCYKITTVF-SHA----QSVVICAGCSTILCQ-PTGGRARLT   74 (115)
Q Consensus        29 nS~F-m~VKCp~C~n~q~VF-SHA----qt~V~C~~Cg~vL~~-PTGGKA~l~   74 (115)
                      ..++ ..+.|+.|+.+|+.- +.-    ...-.| .||..-.. +++|+++|.
T Consensus       163 ~~~~P~~p~c~~cg~~~~~v~~~d~~~~~v~y~c-~cG~~g~~~~~~g~~KL~  214 (353)
T cd00674         163 ETWYPFMPYCEKCGKDTTTVEAYDAKAGTVTYKC-ECGHEETVDIRTGRGKLT  214 (353)
T ss_pred             CCceeeeeecCCcCcceeEEEEEeCCCCeEEEEc-CCCCEEEEeecCCCcccC
Confidence            4333 578999999775432 332    223345 48866544 567776664


No 181
>PF05280 FlhC:  Flagellar transcriptional activator (FlhC);  InterPro: IPR007944 This family consists of several bacterial flagellar transcriptional activator (FlhC) proteins. FlhC combines with FlhD to form a regulatory complex in Escherichia coli, this complex has been shown to be a global regulator involved in many cellular processes as well as a flagellar transcriptional activator [].; GO: 0003677 DNA binding, 0030092 regulation of flagellum assembly, 0045893 positive regulation of transcription, DNA-dependent; PDB: 2AVU_E.
Probab=21.61  E-value=67  Score=24.92  Aligned_cols=30  Identities=17%  Similarity=0.409  Sum_probs=15.5

Q ss_pred             eeEEeCCCCCceeEEeeec-ceeEEcCCCCe
Q psy2574          32 FMDVKCPGCYKITTVFSHA-QSVVICAGCST   61 (115)
Q Consensus        32 Fm~VKCp~C~n~q~VFSHA-qt~V~C~~Cg~   61 (115)
                      ..-..|..|+..-|+-.|. ...+.|..|..
T Consensus       132 l~l~~C~~C~~~fv~~~~~~~~~~~Cp~C~~  162 (175)
T PF05280_consen  132 LQLAPCRRCGGHFVTHAHDPRHSFVCPFCQP  162 (175)
T ss_dssp             EEEEE-TTT--EEEEESS--SS----TT---
T ss_pred             ccccCCCCCCCCeECcCCCCCcCcCCCCCCC
Confidence            4567899999999987776 67899999994


No 182
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=21.50  E-value=32  Score=23.45  Aligned_cols=13  Identities=23%  Similarity=0.588  Sum_probs=10.9

Q ss_pred             eeEEcCCCCeeee
Q psy2574          52 SVVICAGCSTILC   64 (115)
Q Consensus        52 t~V~C~~Cg~vL~   64 (115)
                      .+|+|-.||++++
T Consensus         3 iPiRCFsCGkvi~   15 (63)
T COG1644           3 IPVRCFSCGKVIG   15 (63)
T ss_pred             CceEeecCCCCHH
Confidence            4789999999885


No 183
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=21.32  E-value=44  Score=30.82  Aligned_cols=32  Identities=19%  Similarity=0.310  Sum_probs=19.3

Q ss_pred             eCCCCCceeEEeeecceeEEcCCCCeeeecccCCceeec
Q psy2574          36 KCPGCYKITTVFSHAQSVVICAGCSTILCQPTGGRARLT   74 (115)
Q Consensus        36 KCp~C~n~q~VFSHAqt~V~C~~Cg~vL~~PTGGKA~l~   74 (115)
                      +||.|+.+     -+...-.|..||+.+.++  ..|.|+
T Consensus        29 ~Cp~CG~~-----~~~~~~fC~~CG~~~~~~--~~~~~~   60 (645)
T PRK14559         29 PCPQCGTE-----VPVDEAHCPNCGAETGTI--WWAIIA   60 (645)
T ss_pred             cCCCCCCC-----CCcccccccccCCcccch--hhhhcc
Confidence            47777666     234445677777776555  555554


No 184
>PRK05638 threonine synthase; Validated
Probab=21.23  E-value=56  Score=27.81  Aligned_cols=26  Identities=27%  Similarity=0.697  Sum_probs=17.8

Q ss_pred             EEeCCCCCceeEEeeecceeEEcCCCCeeee
Q psy2574          34 DVKCPGCYKITTVFSHAQSVVICAGCSTILC   64 (115)
Q Consensus        34 ~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL~   64 (115)
                      +.+|..|+.+   |+ ......| .||-.|-
T Consensus         1 ~l~C~~Cg~~---~~-~~~~~~C-~c~~~l~   26 (442)
T PRK05638          1 KMKCPKCGRE---YN-SYIPPFC-ICGELLE   26 (442)
T ss_pred             CeEeCCCCCC---CC-CCCceec-CCCCcEE
Confidence            3689999987   44 3334789 7986653


No 185
>cd01411 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=21.00  E-value=45  Score=25.99  Aligned_cols=38  Identities=16%  Similarity=0.264  Sum_probs=22.5

Q ss_pred             ccCCCCceeEEeCCCCCceeEEeeecceeEEcCCCCeee
Q psy2574          25 VQHPNSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTIL   63 (115)
Q Consensus        25 V~~PnS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~vL   63 (115)
                      |=+.-..+..++|..|.... .+.-...+-.|..||.+|
T Consensus       109 v~elHG~~~~~~C~~C~~~~-~~~~~~~~p~C~~Cgg~l  146 (225)
T cd01411         109 VVEFHGSLYRIYCTVCGKTV-DWEEYLKSPYHAKCGGVI  146 (225)
T ss_pred             EEEeCCCcCeeEeCCCCCcc-chhhcCCCCCCCCCCCEe
Confidence            33455667778999996542 222222346798897543


No 186
>PRK07218 replication factor A; Provisional
Probab=20.73  E-value=56  Score=28.70  Aligned_cols=27  Identities=19%  Similarity=0.571  Sum_probs=17.4

Q ss_pred             CCCceeEEeCCCCCceeEEeeecceeEEcCCCCee
Q psy2574          28 PNSYFMDVKCPGCYKITTVFSHAQSVVICAGCSTI   62 (115)
Q Consensus        28 PnS~Fm~VKCp~C~n~q~VFSHAqt~V~C~~Cg~v   62 (115)
                      +.|-|++ +||.|.+.-       ..-.|..||.+
T Consensus       292 ~gsgli~-rCP~C~r~v-------~~~~C~~hG~v  318 (423)
T PRK07218        292 DGSGLIE-RCPECGRVI-------QKGQCRSHGAV  318 (423)
T ss_pred             cCCccee-cCcCccccc-------cCCcCCCCCCc
Confidence            3445443 788887754       22578888876


No 187
>PRK07562 ribonucleotide-diphosphate reductase subunit alpha; Validated
Probab=20.59  E-value=80  Score=31.72  Aligned_cols=28  Identities=21%  Similarity=0.544  Sum_probs=23.2

Q ss_pred             eEEeCCCCCceeEEeeecceeEEcCCCCee
Q psy2574          33 MDVKCPGCYKITTVFSHAQSVVICAGCSTI   62 (115)
Q Consensus        33 m~VKCp~C~n~q~VFSHAqt~V~C~~Cg~v   62 (115)
                      .-.-|+.|+|.++|  +--|-..|..||.+
T Consensus      1189 ~g~~c~~cg~~~~v--rngtc~~c~~cg~t 1216 (1220)
T PRK07562       1189 TGEACSECGNFTLV--RNGTCLKCDTCGST 1216 (1220)
T ss_pred             CCCcCCCcCCeEEE--eCCeeeeccccCCC
Confidence            55669999999987  66788889999975


No 188
>PF08821 CGGC:  CGGC domain;  InterPro: IPR014925 Proteins in this entry are a quite highly conserved sequence of CGGC in its central region. The region has many conserved cysteines and histidines suggestive of a zinc binding function. 
Probab=20.56  E-value=63  Score=23.12  Aligned_cols=13  Identities=46%  Similarity=0.961  Sum_probs=11.7

Q ss_pred             ccceeEEeecccc
Q psy2574          96 TDTELIRMSHCGG  108 (115)
Q Consensus        96 ~d~~~~~~~~~~~  108 (115)
                      .|.|||=|.+|||
T Consensus        36 ~~~elvgf~~CgG   48 (107)
T PF08821_consen   36 EDVELVGFFTCGG   48 (107)
T ss_pred             CCeEEEEEeeCCC
Confidence            4799999999998


No 189
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=20.15  E-value=48  Score=19.66  Aligned_cols=13  Identities=23%  Similarity=0.465  Sum_probs=6.1

Q ss_pred             EcCCCCeeeeccc
Q psy2574          55 ICAGCSTILCQPT   67 (115)
Q Consensus        55 ~C~~Cg~vL~~PT   67 (115)
                      .|..||..|.+=+
T Consensus         3 ~CP~Cg~~lv~r~   15 (39)
T PF01396_consen    3 KCPKCGGPLVLRR   15 (39)
T ss_pred             CCCCCCceeEEEE
Confidence            4445554444444


No 190
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=20.10  E-value=41  Score=25.64  Aligned_cols=20  Identities=15%  Similarity=0.562  Sum_probs=12.9

Q ss_pred             EcCCCCeeeecccCCceeeccCC
Q psy2574          55 ICAGCSTILCQPTGGRARLTEDD   77 (115)
Q Consensus        55 ~C~~Cg~vL~~PTGGKA~l~egc   77 (115)
                      .|..||+++  +.|-+- |..||
T Consensus         3 ~Ct~Cg~~f--~dgs~e-il~GC   22 (131)
T PF09845_consen    3 QCTKCGRVF--EDGSKE-ILSGC   22 (131)
T ss_pred             ccCcCCCCc--CCCcHH-HHccC
Confidence            477777777  554443 67777


Done!