Diaphorina citri psyllid: psy2576

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MPCLGSNLCSPVYQVIVLAPLYKLSPQFLCSYDQDTFNNFISPEKVLSYEHRDLVSKVQVFNPEYDYVPPELVSLFISNT
ccccHHHHccccccEEEEcccccccccccccccccccEEccccccccccccccccccEEEEcccccccccccEEEEEEcc
**CLGSNLCSPVYQVIVLAPLYKLSPQFLCSYDQDTFNNFISPEKVLSYEHRDLVSKVQVFNPEYDYVPPELVSLFISNT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPCLGSNLCSPVYQVIVLAPLYKLSPQFLCSYDQDTFNNFISPEKVLSYEHRDLVSKVQVFNPEYDYVPPELVSLFISNT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Translation initiation factor eIF-2B subunit beta Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.confidentQ54EY2
Translation initiation factor eIF-2B subunit beta Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.confidentQ62818
Translation initiation factor eIF-2B subunit beta Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.confidentQ99LD9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0043434 [BP]response to peptide hormone stimulusprobableGO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0010033
GO:0005851 [CC]eukaryotic translation initiation factor 2B complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0003743 [MF]translation initiation factor activityprobableGO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0009749 [BP]response to glucose stimulusprobableGO:0009746, GO:1901700, GO:0009743, GO:0034284, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0009408 [BP]response to heatprobableGO:0009628, GO:0006950, GO:0008150, GO:0050896, GO:0009266

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VB5, chain A
Confidence level:very confident
Coverage over the Query: 3-45,56-80
View the alignment between query and template
View the model in PyMOL