Diaphorina citri psyllid: psy2579

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------

MFRTYIANRYYNRHIIERVAIKILDKAKLTPKARKMLIYEKTQNQLQNDKKWQHETSLGKRVALYKLQNELGRGNFSTVKMAIHEIYVPILCTYISYLAIKILDKAKLTPKARKMLSREIVSMESVHHPNIIRLYEVLETFGKIFLVVEYASGGELYNKITTEGRLSEDDAKIYFLQILLYEVLETFGKIFLVVEYASGGELYNKITTEGRLSEDDAKIYFLQILSAVKHLHDRDIIHRDIKAENVFLSVRGIVKLGDLGFSTKLQQ

cccccccccccccccEEccHHcccccccccccHHcccccHHHHHHHHcccccccccccccEEEcEEEEEECcccccEEEEEEEEEcccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHcccccEEEEEEEEEEccEEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccEEEEEEEECccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEECcccccccc

**RTYIANRYYN*************************************KKWQHETSLGKRVALYKLQNELGRGNFSTVKMAIHEIYVPILCTYISYLAIKILDKAKLTPKARKMLSREIVSMESVHHPNIIRLYEVLETFGKIFLVVEYASGGELYNKITTEGRLSEDDAKIYFLQILLYEVLETFGKIFLVVEYASGGELYNKITTEGRLSEDDAKIYFLQILSAVKHLHDRDIIHRDIKAENVFLSVRGIVKLGDLGFSTKL**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0000287 [MF]	magnesium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0004674 [MF]	protein serine/threonine kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0005938 [CC]	cell cortex	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048522 [BP]	positive regulation of cellular process	probable	GO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0051726 [BP]	regulation of cell cycle	probable	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0007243 [BP]	intracellular protein kinase cascade	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0010468 [BP]	regulation of gene expression	probable	GO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0015630 [CC]	microtubule cytoskeleton	probable	GO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0044092 [BP]	negative regulation of molecular function	probable	GO:0008150, GO:0065009, GO:0065007
GO:0044430 [CC]	cytoskeletal part	probable	GO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0046777 [BP]	protein autophosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0048699 [BP]	generation of neurons	probable	GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0050321 [MF]	tau-protein kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0042981 [BP]	regulation of apoptotic process	probable	GO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FE3, chain A
Confidence level:very confident
Coverage over the Query: 59-161,208-265
View the alignment between query and template
View the model in PyMOL

Template: 4AOJ, chain A
Confidence level:very confident
Coverage over the Query: 62-170,202-205,217-260
View the alignment between query and template
View the model in PyMOL

Template: 3QD2, chain B
Confidence level:very confident
Coverage over the Query: 62-145,180-266
View the alignment between query and template
View the model in PyMOL

Template: 3PVU, chain A
Confidence level:probable
Coverage over the Query: 2-85,97-262
View the alignment between query and template
View the model in PyMOL