Query         psy2580
Match_columns 65
No_of_seqs    40 out of 42
Neff          2.0 
Searched_HMMs 46136
Date          Fri Aug 16 19:48:13 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2580.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2580hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2723|consensus               99.0 1.7E-10 3.6E-15   83.6   0.8   34   28-61      2-35  (221)
  2 PF02214 BTB_2:  BTB/POZ domain  98.6 4.3E-08 9.4E-13   58.2   2.6   26   37-62      1-26  (94)
  3 KOG2716|consensus               97.3 0.00014   3E-09   53.2   2.3   24   33-56      3-26  (230)
  4 KOG2714|consensus               95.8  0.0074 1.6E-07   48.8   2.8   29   32-60      8-37  (465)
  5 KOG1665|consensus               95.3  0.0065 1.4E-07   47.0   0.8   30   32-61      6-36  (302)
  6 KOG3713|consensus               93.4   0.053 1.1E-06   43.8   2.1   28   34-61     30-57  (477)
  7 KOG2715|consensus               86.4    0.32 6.8E-06   36.3   0.9   26   34-59     20-45  (210)
  8 KOG1545|consensus               74.4     3.7   8E-05   33.9   3.2   31   31-61     57-87  (507)
  9 PF14008 Metallophos_C:  Iron/z  48.0      12 0.00026   21.3   1.3   10   34-43      1-10  (62)
 10 smart00225 BTB Broad-Complex,   47.7      26 0.00056   18.2   2.5   21   37-57      2-22  (90)
 11 PHA03051 Hypothetical protein;  46.6      10 0.00022   25.1   0.9   11   38-48     63-73  (88)
 12 KOG4390|consensus               46.0      16 0.00035   30.9   2.1   31   30-60     35-65  (632)
 13 KOG0680|consensus               42.6       9 0.00019   31.0   0.2   35   24-58    167-201 (400)
 14 PF00891 Methyltransf_2:  O-met  42.4      11 0.00023   25.2   0.6   25   37-61    103-127 (241)
 15 PF07758 DUF1614:  Protein of u  39.3      20 0.00044   25.3   1.6   30   20-49     25-55  (176)
 16 PF13174 TPR_6:  Tetratricopept  37.5      16 0.00035   16.7   0.6    7   53-59     27-33  (33)
 17 PF02825 WWE:  WWE domain;  Int  36.0      23  0.0005   19.8   1.2   22   36-57     40-61  (72)
 18 PF05456 eIF_4EBP:  Eukaryotic   35.4      12 0.00027   25.2   0.0   11   41-51     34-44  (116)
 19 PF12415 rpo132:  Poxvirus DNA   35.2      14 0.00029   20.5   0.1    7   59-65      5-11  (33)
 20 PF05164 ZapA:  Cell division p  34.3      38 0.00083   19.4   2.0   12   37-48      2-13  (89)
 21 TIGR01624 LRP1_Cterm LRP1 C-te  32.3      32  0.0007   20.8   1.5   10   38-47     33-42  (50)
 22 PF08784 RPA_C:  Replication pr  30.7      24 0.00052   21.2   0.7    7   42-48     92-98  (102)
 23 PF03990 DUF348:  Domain of unk  27.9      61  0.0013   17.3   2.0   12   36-47      1-12  (43)
 24 PF05142 DUF702:  Domain of unk  27.6      38 0.00082   24.2   1.4   10   38-47    134-143 (154)
 25 PF15097 Ig_J_chain:  Immunoglo  23.1      42 0.00092   23.7   0.9   35   28-63     65-99  (134)
 26 KOG0149|consensus               23.0      47   0.001   25.4   1.2   20   37-56     13-32  (247)
 27 PF08002 DUF1697:  Protein of u  21.7      35 0.00076   22.4   0.3    6   39-44     11-16  (137)
 28 PF08922 DUF1905:  Domain of un  20.8      73  0.0016   19.2   1.5   18   34-51     32-49  (80)
 29 cd02113 bact_SoxC_Moco bacteri  20.4 1.1E+02  0.0025   23.1   2.8   48   10-62      9-59  (326)

No 1  
>KOG2723|consensus
Probab=98.95  E-value=1.7e-10  Score=83.62  Aligned_cols=34  Identities=41%  Similarity=0.566  Sum_probs=31.1

Q ss_pred             cccccCCCcEEEeecceeEechhHHHhhccccce
Q psy2580          28 AAASRYTAPVHIDVGGTIYTSSLETLTKLYLLEI   61 (65)
Q Consensus        28 A~~~~~~apVhlnVGG~iYTTSLsTLtkyPds~l   61 (65)
                      +.+..++++|+|||||++|||+|+||++||||.|
T Consensus         2 ~~~~~~~~~v~lnvGG~~ytt~l~tL~~~~ds~L   35 (221)
T KOG2723|consen    2 MLTSEYPDVVELNVGGAIYTTRLGTLTKFPDSML   35 (221)
T ss_pred             CcccccCCceeeccCCeEEEeeccceeechHHHH
Confidence            3456899999999999999999999999999976


No 2  
>PF02214 BTB_2:  BTB/POZ domain;  InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ]. They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis [].  All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. The Kv family can be divided into several subfamilies on the basis of sequence similarity and function. Four of these subfamilies, Kv1 (Shaker), Kv2 (Shab), Kv3 (Shaw) and Kv4 (Shal), consist of pore-forming alpha subunits that associate with different types of beta subunit. Each alpha subunit comprises six hydrophobic TM domains with a P-domain between the fifth and sixth, which partially resides in the membrane. The fourth TM domain has positively charged residues at every third residue and acts as a voltage sensor, which triggers the conformational change that opens the channel pore in response to a displacement in membrane potential []. More recently, 4 new electrically-silent alpha subunits have been cloned: Kv5 (KCNF), Kv6 (KCNG), Kv8 and Kv9 (KCNS). These subunits do not themselves possess any functional activity, but appear to form heteromeric channels with Kv2 subunits, and thus modulate Shab channel activity []. When highly expressed, they inhibit channel activity, but at lower levels show more specific modulatory actions. The N-terminal, cytoplasmic tetramerization domain (T1) of voltage-gated potassium channels encodes molecular determinants for subfamily-specific assembly of alpha-subunits into functional tetrameric channels []. This domain is found in a subset of a larger group of proteins that contain the BTB/POZ domain.; GO: 0005249 voltage-gated potassium channel activity, 0006813 potassium ion transport, 0008076 voltage-gated potassium channel complex, 0016020 membrane; PDB: 1NN7_A 3KVT_A 1EXB_E 1QDV_A 1DSX_E 1QDW_F 3LUT_B 3LNM_B 2A79_B 3DRY_C ....
Probab=98.57  E-value=4.3e-08  Score=58.23  Aligned_cols=26  Identities=38%  Similarity=0.537  Sum_probs=24.3

Q ss_pred             EEEeecceeEechhHHHhhcccccee
Q psy2580          37 VHIDVGGTIYTSSLETLTKLYLLEIC   62 (65)
Q Consensus        37 VhlnVGG~iYTTSLsTLtkyPds~l~   62 (65)
                      |+|||||++|.|+.+||+++|+|.++
T Consensus         1 V~lNVGG~~f~~~~~tL~~~~~s~l~   26 (94)
T PF02214_consen    1 VRLNVGGTIFETSRSTLTRYPDSLLA   26 (94)
T ss_dssp             EEEEETTEEEEEEHHHHHTSTTSTTT
T ss_pred             CEEEECCEEEEEcHHHHhhCCCChhh
Confidence            78999999999999999999999764


No 3  
>KOG2716|consensus
Probab=97.33  E-value=0.00014  Score=53.23  Aligned_cols=24  Identities=46%  Similarity=0.760  Sum_probs=21.7

Q ss_pred             CCCcEEEeecceeEechhHHHhhc
Q psy2580          33 YTAPVHIDVGGTIYTSSLETLTKL   56 (65)
Q Consensus        33 ~~apVhlnVGG~iYTTSLsTLtky   56 (65)
                      +...|.|||||++|.||.+||||+
T Consensus         3 ~~~~vkLnvGG~~F~Tsk~TLtk~   26 (230)
T KOG2716|consen    3 MSETVKLNVGGTIFKTSKSTLTKF   26 (230)
T ss_pred             ccceEEEecCCeEEEeehhhhhhh
Confidence            456789999999999999999995


No 4  
>KOG2714|consensus
Probab=95.82  E-value=0.0074  Score=48.83  Aligned_cols=29  Identities=31%  Similarity=0.339  Sum_probs=25.5

Q ss_pred             cCCCcEEEeecceeEechhHHHhhcc-ccc
Q psy2580          32 RYTAPVHIDVGGTIYTSSLETLTKLY-LLE   60 (65)
Q Consensus        32 ~~~apVhlnVGG~iYTTSLsTLtkyP-ds~   60 (65)
                      .....|+|||||.||.||-.||+-=| ||=
T Consensus         8 ~~~~~V~lNVGGriF~Ts~qTL~~~~~DSf   37 (465)
T KOG2714|consen    8 SSGDRVKLNVGGRIFETSAQTLTWIPRDSF   37 (465)
T ss_pred             CCCceEEEecCceEEecchhhhhcCCcchH
Confidence            34688999999999999999999888 763


No 5  
>KOG1665|consensus
Probab=95.31  E-value=0.0065  Score=46.99  Aligned_cols=30  Identities=17%  Similarity=0.389  Sum_probs=25.9

Q ss_pred             cCCCcEEEeecceeEechhHHHh-hccccce
Q psy2580          32 RYTAPVHIDVGGTIYTSSLETLT-KLYLLEI   61 (65)
Q Consensus        32 ~~~apVhlnVGG~iYTTSLsTLt-kyPds~l   61 (65)
                      ..+.-|.||+||..|+|+++||+ |=|||-|
T Consensus         6 ~~~~~vrlnigGk~f~TTidTlv~rEPDSML   36 (302)
T KOG1665|consen    6 NLSSMVRLNIGGKKFCTTIDTLVIREPDSML   36 (302)
T ss_pred             ChhhhheeecCCeEEEEeehhhcccCchHHH
Confidence            34556999999999999999998 8899865


No 6  
>KOG3713|consensus
Probab=93.41  E-value=0.053  Score=43.82  Aligned_cols=28  Identities=29%  Similarity=0.376  Sum_probs=25.3

Q ss_pred             CCcEEEeecceeEechhHHHhhccccce
Q psy2580          34 TAPVHIDVGGTIYTSSLETLTKLYLLEI   61 (65)
Q Consensus        34 ~apVhlnVGG~iYTTSLsTLtkyPds~l   61 (65)
                      ..-|.|||||+-|-+.-+||.|+|..+|
T Consensus        30 ~~~i~lNVGG~r~~l~~~tL~~~P~TRL   57 (477)
T KOG3713|consen   30 DRRVRLNVGGTRHELYWSTLKRFPLTRL   57 (477)
T ss_pred             CcEEEEeeCCeeEEehHHHHhhCchhHH
Confidence            3479999999999999999999998776


No 7  
>KOG2715|consensus
Probab=86.43  E-value=0.32  Score=36.33  Aligned_cols=26  Identities=27%  Similarity=0.374  Sum_probs=23.2

Q ss_pred             CCcEEEeecceeEechhHHHhhcccc
Q psy2580          34 TAPVHIDVGGTIYTSSLETLTKLYLL   59 (65)
Q Consensus        34 ~apVhlnVGG~iYTTSLsTLtkyPds   59 (65)
                      +.-|.|||||+.|-|.-.||-|=|.|
T Consensus        20 s~wVRlNVGGt~f~TtktTl~rdp~s   45 (210)
T KOG2715|consen   20 SLWVRLNVGGTVFLTTKTTLPRDPKS   45 (210)
T ss_pred             eEEEEEecCCEEEEeeeeccccCcHH
Confidence            57899999999999999999988843


No 8  
>KOG1545|consensus
Probab=74.44  E-value=3.7  Score=33.93  Aligned_cols=31  Identities=23%  Similarity=0.294  Sum_probs=26.9

Q ss_pred             ccCCCcEEEeecceeEechhHHHhhccccce
Q psy2580          31 SRYTAPVHIDVGGTIYTSSLETLTKLYLLEI   61 (65)
Q Consensus        31 ~~~~apVhlnVGG~iYTTSLsTLtkyPds~l   61 (65)
                      ..-..-|+|||-|--|-|-|.||.+||+.-|
T Consensus        57 ~~~~ervvINisGlRFeTql~TL~qfP~TLL   87 (507)
T KOG1545|consen   57 SCCCERVVINISGLRFETQLKTLAQFPNTLL   87 (507)
T ss_pred             cccccEEEEEeccceehHHHHHHhhCchhhc
Confidence            3345789999999999999999999999754


No 9  
>PF14008 Metallophos_C:  Iron/zinc purple acid phosphatase-like protein C; PDB: 3KBP_B 1KBP_B 4KBP_C 2QFP_B 2QFR_A 1XZW_B.
Probab=48.03  E-value=12  Score=21.27  Aligned_cols=10  Identities=70%  Similarity=1.036  Sum_probs=6.1

Q ss_pred             CCcEEEeecc
Q psy2580          34 TAPVHIDVGG   43 (65)
Q Consensus        34 ~apVhlnVGG   43 (65)
                      .|||||-+|+
T Consensus         1 kapVhiv~G~   10 (62)
T PF14008_consen    1 KAPVHIVVGA   10 (62)
T ss_dssp             TS-EEEEE--
T ss_pred             CCCEEEEECc
Confidence            4899999974


No 10 
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac. Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures.
Probab=47.71  E-value=26  Score=18.20  Aligned_cols=21  Identities=24%  Similarity=0.357  Sum_probs=17.8

Q ss_pred             EEEeecceeEechhHHHhhcc
Q psy2580          37 VHIDVGGTIYTSSLETLTKLY   57 (65)
Q Consensus        37 VhlnVGG~iYTTSLsTLtkyP   57 (65)
                      |.|.|||..|-.....|....
T Consensus         2 v~i~v~~~~~~~h~~iL~~~s   22 (90)
T smart00225        2 VTLVVGGKKFKAHKAVLAACS   22 (90)
T ss_pred             eEEEECCEEEehHHHHHhhcC
Confidence            569999999999888888764


No 11 
>PHA03051 Hypothetical protein; Provisional
Probab=46.57  E-value=10  Score=25.11  Aligned_cols=11  Identities=45%  Similarity=0.863  Sum_probs=9.4

Q ss_pred             EEeecceeEec
Q psy2580          38 HIDVGGTIYTS   48 (65)
Q Consensus        38 hlnVGG~iYTT   48 (65)
                      -||.|||.||+
T Consensus        63 cin~g~~hf~s   73 (88)
T PHA03051         63 CINIGGHHFTS   73 (88)
T ss_pred             eEEecCceech
Confidence            36899999987


No 12 
>KOG4390|consensus
Probab=45.98  E-value=16  Score=30.85  Aligned_cols=31  Identities=19%  Similarity=0.171  Sum_probs=27.3

Q ss_pred             cccCCCcEEEeecceeEechhHHHhhccccc
Q psy2580          30 ASRYTAPVHIDVGGTIYTSSLETLTKLYLLE   60 (65)
Q Consensus        30 ~~~~~apVhlnVGG~iYTTSLsTLtkyPds~   60 (65)
                      ..+-.+.+-|||.|.-|-|=-.||.||||--
T Consensus        35 ~~r~De~lvlNvSGrRFeTWknTLeryPdTL   65 (632)
T KOG4390|consen   35 AKRQDELLVLNVSGRRFETWKNTLERYPDTL   65 (632)
T ss_pred             hhccCcEEEEeccccchhHHHhHHHhCchhh
Confidence            4457788999999999999999999999964


No 13 
>KOG0680|consensus
Probab=42.59  E-value=9  Score=31.04  Aligned_cols=35  Identities=34%  Similarity=0.436  Sum_probs=28.1

Q ss_pred             CCcccccccCCCcEEEeecceeEechhHHHhhccc
Q psy2580          24 IPCVAAASRYTAPVHIDVGGTIYTSSLETLTKLYL   58 (65)
Q Consensus        24 iP~~A~~~~~~apVhlnVGG~iYTTSLsTLtkyPd   58 (65)
                      ||.+-.-..+.|...|||||...|--|.-+-.|..
T Consensus       167 ip~v~g~~~~qaV~RiDvGGK~LTn~LKE~iSyR~  201 (400)
T KOG0680|consen  167 IPVVKGIPYYQAVKRIDVGGKALTNLLKETISYRH  201 (400)
T ss_pred             ehhhcCcchhhceEEeecchHHHHHHHHHHhhhhh
Confidence            46666666788999999999999998887777754


No 14 
>PF00891 Methyltransf_2:  O-methyltransferase;  InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalysed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order []. Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI []), shared by other AdoMet-Mtases [], is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments [], although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases [, , , ]. The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences []. This domain includes a range of O-methyltransferases some of which utilise S-adenosyl methionine as substrate []. In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes. In eukaryotes, DNA methylation has been implicated in the control of several cellular processes, including differentiation, gene regulation, and embryonic development. O-methyltransferases have a common catalytic domain structure, which might be universal among S-adenosyl-L-methionine (AdoMet)-dependent methyltransferases [].  Comparative analysis of the predicted amino acid sequences of a number of plant O-methyltransferase cDNA clones show that they share some 32-71% sequence identity, and can be grouped according to the different compounds they utilise as substrates [].; GO: 0008171 O-methyltransferase activity; PDB: 1FPQ_A 1FP1_D 3P9K_B 3P9I_D 3P9C_A 3I53_A 3I5U_A 3I64_A 3I58_A 1ZG3_A ....
Probab=42.38  E-value=11  Score=25.22  Aligned_cols=25  Identities=20%  Similarity=0.145  Sum_probs=20.8

Q ss_pred             EEEeecceeEechhHHHhhccccce
Q psy2580          37 VHIDVGGTIYTSSLETLTKLYLLEI   61 (65)
Q Consensus        37 VhlnVGG~iYTTSLsTLtkyPds~l   61 (65)
                      --+||||-.=.-+.+-+.+||+++.
T Consensus       103 ~vvDvGGG~G~~~~~l~~~~P~l~~  127 (241)
T PF00891_consen  103 TVVDVGGGSGHFAIALARAYPNLRA  127 (241)
T ss_dssp             EEEEET-TTSHHHHHHHHHSTTSEE
T ss_pred             EEEeccCcchHHHHHHHHHCCCCcc
Confidence            3689999988889999999999874


No 15 
>PF07758 DUF1614:  Protein of unknown function (DUF1614);  InterPro: IPR011672 This is a family of sequences coming from hypothetical proteins found in both bacterial and archaeal species.
Probab=39.29  E-value=20  Score=25.34  Aligned_cols=30  Identities=20%  Similarity=0.394  Sum_probs=22.1

Q ss_pred             CCCCCCcccc-cccCCCcEEEeecceeEech
Q psy2580          20 KITGIPCVAA-ASRYTAPVHIDVGGTIYTSS   49 (65)
Q Consensus        20 ~~~giP~~A~-~~~~~apVhlnVGG~iYTTS   49 (65)
                      ...|+|..-. ....+..|.+||||.+-=-.
T Consensus        25 ~~~g~~~~~p~~~~~~t~vavNvGG~lIP~~   55 (176)
T PF07758_consen   25 RFFGMPYPIPVRRSRRTVVAVNVGGALIPVL   55 (176)
T ss_pred             eEcceeeeeeeccccceEEEEECcccHHHHH
Confidence            6677776654 67778899999999875433


No 16 
>PF13174 TPR_6:  Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A.
Probab=37.45  E-value=16  Score=16.71  Aligned_cols=7  Identities=0%  Similarity=-0.169  Sum_probs=4.9

Q ss_pred             Hhhcccc
Q psy2580          53 LTKLYLL   59 (65)
Q Consensus        53 LtkyPds   59 (65)
                      +.+||+|
T Consensus        27 ~~~~P~s   33 (33)
T PF13174_consen   27 IKRYPDS   33 (33)
T ss_dssp             HHHSTTS
T ss_pred             HHHCcCC
Confidence            5678876


No 17 
>PF02825 WWE:  WWE domain;  InterPro: IPR004170 The WWE domain is named after three of its conserved residues and is predicted to mediate specific protein-protein interactions in ubiquitin and ADP ribose conjugation systems. This domain is found as a tandem repeat at the N-terminal of Deltex, a cytosolic effector of Notch signalling thought to bind the N-terminal of the Notch receptor []. It is also found as an interaction module in protein ubiquination and ADP ribosylation proteins [].; PDB: 2A90_A 1UJR_A 2DK6_A 3V3L_B.
Probab=36.04  E-value=23  Score=19.78  Aligned_cols=22  Identities=23%  Similarity=0.611  Sum_probs=18.7

Q ss_pred             cEEEeecceeEechhHHHhhcc
Q psy2580          36 PVHIDVGGTIYTSSLETLTKLY   57 (65)
Q Consensus        36 pVhlnVGG~iYTTSLsTLtkyP   57 (65)
                      .+.|+++|..|+=.+.+++.+-
T Consensus        40 ~~~~~~~~~~Y~IDF~~M~Q~n   61 (72)
T PF02825_consen   40 SCQLSIGGRPYTIDFKSMTQIN   61 (72)
T ss_dssp             EEEEEETTEEEEEETTTTEEEE
T ss_pred             EEEEEeCCcEEEEEChhcEEEe
Confidence            6789999999999998887653


No 18 
>PF05456 eIF_4EBP:  Eukaryotic translation initiation factor 4E binding protein (EIF4EBP);  InterPro: IPR008606 This family consists of several eukaryotic translation initiation factor 4E binding proteins (EIF4EBP1, -2 and -3). Translation initiation in eukaryotes is mediated by the cap structure (m7GpppN, where N is any nucleotide) present at the 5' end of all cellular mRNAs, except organellar. The cap is recognised by eukaryotic initiation factor 4F (eIF4F), which consists of three polypeptides, including eIF4E, the cap-binding protein subunit. The interaction of the cap with eIF4E facilitates the binding of the ribosome to the mRNA. eIF4E activity is regulated in part by translational repressors, 4E-BP1, 4E-BP2 and 4E-BP3 which bind to it and prevent its assembly into eIF4F [].; GO: 0008190 eukaryotic initiation factor 4E binding, 0045947 negative regulation of translational initiation; PDB: 2JGB_B 2V8Y_F 1WKW_B 3HXG_C 3U7X_D 3M94_C 3M93_C 2V8X_B 3HXI_C 2V8W_B ....
Probab=35.40  E-value=12  Score=25.19  Aligned_cols=11  Identities=27%  Similarity=0.703  Sum_probs=0.0

Q ss_pred             ecceeEechhH
Q psy2580          41 VGGTIYTSSLE   51 (65)
Q Consensus        41 VGG~iYTTSLs   51 (65)
                      -||+||.|+-.
T Consensus        34 PGGTlfsTTPG   44 (116)
T PF05456_consen   34 PGGTLFSTTPG   44 (116)
T ss_dssp             -----------
T ss_pred             CCCceEEeccC
Confidence            69999998753


No 19 
>PF12415 rpo132:  Poxvirus DNA dependent RNA polymerase;  InterPro: IPR024390 All three classes of poxvirus genes - early, intermediate and late - are transcribed by the viral RNA polymerase compex []. This complex is composed of nine distinct subunits which total more than 500kDa in mass. The two largest subunits (147 and 136kDa) are homologous to the largest subunits of eukaryotic and prokaryotic RNA polymerases and, like them, are thought to form a claw-shaped structure whose cleft is the site of template interaction and phosphodiester bond formation. While the smaller subunits of poxvirus RNA polymerase show much less similarity, if any, to the smaller subunits of the eukaryotic and prokaryotic enzymes, it is thought that they may play a similar role in interacting with transcription factors. The 132kDa subunit is the second largest subunit of the poxvirus DNA dependent RNA polymerase and shows structural similarity to the second-largest RNA polymerase subunits of eubacteria, archaebacteria, and eukaryotes.
Probab=35.21  E-value=14  Score=20.53  Aligned_cols=7  Identities=43%  Similarity=0.804  Sum_probs=5.7

Q ss_pred             cceeecC
Q psy2580          59 LEICYDM   65 (65)
Q Consensus        59 s~l~~~~   65 (65)
                      .-|||||
T Consensus         5 ~~Lsydm   11 (33)
T PF12415_consen    5 NSLSYDM   11 (33)
T ss_pred             HhhccCC
Confidence            4689998


No 20 
>PF05164 ZapA:  Cell division protein ZapA;  InterPro: IPR007838 This entry a structural domain found in the cell division protein ZapA, as well as in related proteins. This domain has a core structure consisting of two layers alpha/beta, and has a long C-terminal helix that forms dimeric parallel and tetrameric antiparallel coiled coils []. ZapA interacts with FtsZ, where FtsZ is part of a mid-cell cytokinetic structure termed the Z-ring that recruits a hierarchy of fission related proteins early in the bacterial cell cycle. ZapA drives the polymerisation and filament bundling of FtsZ, thereby contributing to the spatio-temporal tuning of the Z-ring.; PDB: 1T3U_B 1W2E_B 3HNW_A.
Probab=34.31  E-value=38  Score=19.40  Aligned_cols=12  Identities=25%  Similarity=0.426  Sum_probs=10.3

Q ss_pred             EEEeecceeEec
Q psy2580          37 VHIDVGGTIYTS   48 (65)
Q Consensus        37 VhlnVGG~iYTT   48 (65)
                      |.|+++|.-|+=
T Consensus         2 V~v~I~G~~y~i   13 (89)
T PF05164_consen    2 VKVTILGREYRI   13 (89)
T ss_dssp             EEEEETTEEEEE
T ss_pred             eEEEECCEEEEe
Confidence            789999999973


No 21 
>TIGR01624 LRP1_Cterm LRP1 C-terminal domain. This model represents a tightly conserved small domain found in LRP1 and related plant proteins. This family also contains a well-conserved putative zinc finger domain (TIGR01623). The rest of the sequence of most members consists of highly divergent, low-complexity sequence.
Probab=32.34  E-value=32  Score=20.81  Aligned_cols=10  Identities=20%  Similarity=0.903  Sum_probs=8.0

Q ss_pred             EEeecceeEe
Q psy2580          38 HIDVGGTIYT   47 (65)
Q Consensus        38 hlnVGG~iYT   47 (65)
                      .+|.|||+|-
T Consensus        33 ~V~IgGHvFk   42 (50)
T TIGR01624        33 TVTIGGHVFK   42 (50)
T ss_pred             EEEECceEEe
Confidence            5678999984


No 22 
>PF08784 RPA_C:  Replication protein A C terminal;  InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A). RPA is involved in many DNA metabolic pathways including DNA replication, DNA repair, recombination, cell cycle and DNA damage checkpoints. ; PDB: 1QUQ_C 2PQA_C 3KDF_B 2Z6K_B 2PI2_B 1L1O_E 1DPU_A 1Z1D_A.
Probab=30.66  E-value=24  Score=21.21  Aligned_cols=7  Identities=43%  Similarity=0.966  Sum_probs=4.7

Q ss_pred             cceeEec
Q psy2580          42 GGTIYTS   48 (65)
Q Consensus        42 GG~iYTT   48 (65)
                      -|+||||
T Consensus        92 eG~IYsT   98 (102)
T PF08784_consen   92 EGHIYST   98 (102)
T ss_dssp             TTSEEES
T ss_pred             CCeEecc
Confidence            5677766


No 23 
>PF03990 DUF348:  Domain of unknown function (DUF348)     ;  InterPro: IPR007137 This domain normally occurs as tandem repeats; however it is found as a single copy in the Saccharomyces cerevisiae (Baker's yeast) DNA-binding nuclear protein YCR593 (P25357 from SWISSPROT).
Probab=27.94  E-value=61  Score=17.35  Aligned_cols=12  Identities=42%  Similarity=0.603  Sum_probs=9.6

Q ss_pred             cEEEeecceeEe
Q psy2580          36 PVHIDVGGTIYT   47 (65)
Q Consensus        36 pVhlnVGG~iYT   47 (65)
                      ||+|.++|.-.+
T Consensus         1 ~Vtv~~dG~~~~   12 (43)
T PF03990_consen    1 PVTVTVDGKEKT   12 (43)
T ss_pred             CEEEEECCEEEE
Confidence            699999997653


No 24 
>PF05142 DUF702:  Domain of unknown function (DUF702) ;  InterPro: IPR007818 This is a family of plant proteins of unknown function.
Probab=27.63  E-value=38  Score=24.15  Aligned_cols=10  Identities=20%  Similarity=0.959  Sum_probs=7.9

Q ss_pred             EEeecceeEe
Q psy2580          38 HIDVGGTIYT   47 (65)
Q Consensus        38 hlnVGG~iYT   47 (65)
                      .+|.|||+|-
T Consensus       134 aV~IGGHVFK  143 (154)
T PF05142_consen  134 AVNIGGHVFK  143 (154)
T ss_pred             eEEECCEEee
Confidence            5678999984


No 25 
>PF15097 Ig_J_chain:  Immunoglobulin J chain
Probab=23.07  E-value=42  Score=23.74  Aligned_cols=35  Identities=14%  Similarity=0.375  Sum_probs=27.7

Q ss_pred             cccccCCCcEEEeecceeEechhHHHhhccccceee
Q psy2580          28 AAASRYTAPVHIDVGGTIYTSSLETLTKLYLLEICY   63 (65)
Q Consensus        28 A~~~~~~apVhlnVGG~iYTTSLsTLtkyPds~l~~   63 (65)
                      +-+.+--+|+.+..||.++|-+-+-+-.=+ +|.||
T Consensus        65 S~LCkkCdp~evel~~qvvtAtqsn~cde~-~etCy   99 (134)
T PF15097_consen   65 SDLCKKCDPTEVELDNQVVTATQSNICDED-SETCY   99 (134)
T ss_pred             HHHhhcCCccccccCCEEEEeecCcccCCC-CCcee
Confidence            345566789999999999999988877654 48887


No 26 
>KOG0149|consensus
Probab=22.97  E-value=47  Score=25.39  Aligned_cols=20  Identities=35%  Similarity=0.507  Sum_probs=18.3

Q ss_pred             EEEeecceeEechhHHHhhc
Q psy2580          37 VHIDVGGTIYTSSLETLTKL   56 (65)
Q Consensus        37 VhlnVGG~iYTTSLsTLtky   56 (65)
                      -.|-|||--|.|.-++|+||
T Consensus        13 TKifVggL~w~T~~~~l~~y   32 (247)
T KOG0149|consen   13 TKIFVGGLAWETHKETLRRY   32 (247)
T ss_pred             EEEEEcCcccccchHHHHHH
Confidence            46889999999999999987


No 27 
>PF08002 DUF1697:  Protein of unknown function (DUF1697);  InterPro: IPR012545 This family contains many hypothetical bacterial proteins.; PDB: 2HIY_B.
Probab=21.72  E-value=35  Score=22.38  Aligned_cols=6  Identities=67%  Similarity=1.271  Sum_probs=4.1

Q ss_pred             Eeecce
Q psy2580          39 IDVGGT   44 (65)
Q Consensus        39 lnVGG~   44 (65)
                      |||||+
T Consensus        11 INVGG~   16 (137)
T PF08002_consen   11 INVGGK   16 (137)
T ss_dssp             -SBTTB
T ss_pred             eecCCC
Confidence            688885


No 28 
>PF08922 DUF1905:  Domain of unknown function (DUF1905);  InterPro: IPR015018 This family consist of hypothetical bacterial proteins. ; PDB: 2D9R_A.
Probab=20.83  E-value=73  Score=19.18  Aligned_cols=18  Identities=28%  Similarity=0.401  Sum_probs=15.0

Q ss_pred             CCcEEEeecceeEechhH
Q psy2580          34 TAPVHIDVGGTIYTSSLE   51 (65)
Q Consensus        34 ~apVhlnVGG~iYTTSLs   51 (65)
                      .-+|...++|+-|.+||-
T Consensus        32 ~v~V~~tI~g~~~~~sl~   49 (80)
T PF08922_consen   32 RVPVRGTIDGHPWRTSLF   49 (80)
T ss_dssp             -EEEEEEETTEEEEEEEE
T ss_pred             ceEEEEEECCEEEEEEEE
Confidence            568999999999999874


No 29 
>cd02113 bact_SoxC_Moco bacterial SoxC is a member of the sulfite oxidase (SO) family of molybdopterin binding domains. SoxC is involved in oxidation of sulfur compounds during chemolithothrophic growth. Together with SoxD, a small c-type heme containing subunit, it forms a hetrotetrameric sulfite dehydrogenase. This molybdopterin cofactor (Moco) binding domain is found in a variety of oxidoreductases, main members of this family are nitrate reductase (NR) and sulfite oxidase (SO). Common features of all known members of this family are that they contain one single pterin cofactor and part of the coordination of the metal (Mo) is a cysteine ligand of the protein and that they catalyze the transfer of an oxygen to or from a lone pair of electrons on the substrate.
Probab=20.42  E-value=1.1e+02  Score=23.07  Aligned_cols=48  Identities=17%  Similarity=0.308  Sum_probs=33.9

Q ss_pred             CCCCCCCcCCCCCCCCcccccccCCCcEEEeecc---eeEechhHHHhhcccccee
Q psy2580          10 TPPAPLAFNHKITGIPCVAAASRYTAPVHIDVGG---TIYTSSLETLTKLYLLEIC   62 (65)
Q Consensus        10 ~~p~~~~y~~~~~giP~~A~~~~~~apVhlnVGG---~iYTTSLsTLtkyPds~l~   62 (65)
                      -||...-|.-+..++|.+..     +-=.|.|+|   +-.+=||+-|.++|..++-
T Consensus         9 iTP~~~~fvr~h~~~P~~d~-----~~w~L~V~G~V~~p~~ltl~dL~~~p~~~~~   59 (326)
T cd02113           9 ITPNGLHFERHHGGVPDIDP-----AQHRLMIHGMVKKPLVFTMDDLKRFPSVSRI   59 (326)
T ss_pred             cCCCcceEEECCCCCCccCc-----cccEEEEEEecCCCeEeeHHHHhcCCCEEEE
Confidence            35555667656678886542     334777788   4578899999999987753


Done!