RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy2599
         (78 letters)



>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small
          guanosine triphosphatases (GTPases).  Rab GTPases form
          the largest family within the Ras superfamily. There
          are at least 60 Rab genes in the human genome, and a
          number of Rab GTPases are conserved from yeast to
          humans. Rab GTPases are small, monomeric proteins that
          function as molecular switches to regulate vesicle
          trafficking pathways. The different Rab GTPases are
          localized to the cytosolic face of specific
          intracellular membranes, where they regulate distinct
          steps in membrane traffic pathways. In the GTP-bound
          form, Rab GTPases recruit specific sets of effector
          proteins onto membranes. Through their effectors, Rab
          GTPases regulate vesicle formation, actin- and
          tubulin-dependent vesicle movement, and membrane
          fusion. GTPase activating proteins (GAPs) interact with
          GTP-bound Rab and accelerate the hydrolysis of GTP to
          GDP. Guanine nucleotide exchange factors (GEFs)
          interact with GDP-bound Rabs to promote the formation
          of the GTP-bound state. Rabs are further regulated by
          guanine nucleotide dissociation inhibitors (GDIs),
          which mask C-terminal lipid binding and promote
          cytosolic localization. While most unicellular
          organisms possess 5-20 Rab members, several have been
          found to possess 60 or more Rabs; for many of these Rab
          isoforms, homologous proteins are not found in other
          organisms. Most Rab GTPases contain a lipid
          modification site at the C-terminus, with sequence
          motifs CC, CXC, or CCX. Lipid binding is essential for
          membrane attachment, a key feature of most Rab
          proteins. Since crystal structures often lack
          C-terminal residues, the lipid modification site is not
          available for annotation in many of the CDs in the
          hierarchy, but is included where possible.
          Length = 159

 Score = 56.3 bits (137), Expect = 8e-12
 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 2/66 (3%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGKANESSAGLVKTY 71
          G +    R+  ++F+  Y  T G DF  K + +  + VKL +WD  G+  E    +  +Y
Sbjct: 12 GKTSLLLRFVDNKFSENYKSTIGVDFKSKTIEVDGKKVKLQIWDTAGQ--ERFRSITSSY 69

Query: 72 LSSANI 77
             A+ 
Sbjct: 70 YRGAHG 75


>gnl|CDD|206654 cd01861, Rab6, Rab GTPase family 6 (Rab6).  Rab6 is involved in
          microtubule-dependent transport pathways through the
          Golgi and from endosomes to the Golgi. Rab6A of mammals
          is implicated in retrograde transport through the Golgi
          stack, and is also required for a slow,
          COPI-independent, retrograde transport pathway from the
          Golgi to the endoplasmic reticulum (ER). This pathway
          may allow Golgi residents to be recycled through the ER
          for scrutiny by ER quality-control systems. Yeast
          Ypt6p, the homolog of the mammalian Rab6 GTPase, is not
          essential for cell viability. Ypt6p acts in
          endosome-to-Golgi, in intra-Golgi retrograde transport,
          and possibly also in Golgi-to-ER trafficking. GTPase
          activating proteins (GAPs) interact with GTP-bound Rab
          and accelerate the hydrolysis of GTP to GDP. Guanine
          nucleotide exchange factors (GEFs) interact with
          GDP-bound Rabs to promote the formation of the
          GTP-bound state. Rabs are further regulated by guanine
          nucleotide dissociation inhibitors (GDIs), which
          facilitate Rab recycling by masking C-terminal lipid
          binding and promoting cytosolic localization. Most Rab
          GTPases contain a lipid modification site at the
          C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
          binding is essential for membrane attachment, a key
          feature of most Rab proteins. Due to the presence of
          truncated sequences in this CD, the lipid modification
          site is not available for annotation.
          Length = 161

 Score = 55.7 bits (135), Expect = 2e-11
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGKANESSAGLVKTY 71
          G +   TR+  D F  QY  T G DF  K + + ++ V+L LWD  G+    S  L+ +Y
Sbjct: 12 GKTSIITRFMYDTFDNQYQATIGIDFLSKTMYVDDKTVRLQLWDTAGQERFRS--LIPSY 69

Query: 72 LSSANI 77
          +  +++
Sbjct: 70 IRDSSV 75


>gnl|CDD|215692 pfam00071, Ras, Ras family.  Includes sub-families Ras, Rab, Rac,
          Ral, Ran, Rap Ypt1 and more. Shares P-loop motif with
          GTP_EFTU, arf and myosin_head. See pfam00009 pfam00025,
          pfam00063. As regards Rab GTPases, these are important
          regulators of vesicle formation, motility and fusion.
          They share a fold in common with all Ras GTPases: this
          is a six-stranded beta-sheet surrounded by five
          alpha-helices.
          Length = 162

 Score = 52.1 bits (126), Expect = 4e-10
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          G S    R+TQ++F  +Y PT G DF+ K + +  + VKL +WD  G
Sbjct: 11 GKSSLLIRFTQNKFPEEYIPTIGVDFYTKTIEVDGKTVKLQIWDTAG 57


>gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases.  Rab GTPases are
          implicated in vesicle trafficking.
          Length = 164

 Score = 48.7 bits (117), Expect = 7e-09
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          G S   +R+T  +F+ QY  T G DF  K + +  + VKL +WD  G
Sbjct: 12 GKSSLLSRFTDGKFSEQYKSTIGVDFKTKTIEVDGKRVKLQIWDTAG 58


>gnl|CDD|206694 cd04109, Rab28, Rab GTPase family 28 (Rab28).  Rab28 subfamily.
          First identified in maize, Rab28 has been shown to be a
          late embryogenesis-abundant (Lea) protein that is
          regulated by the plant hormone abcisic acid (ABA). In
          Arabidopsis, Rab28 is expressed during embryo
          development and is generally restricted to provascular
          tissues in mature embryos. Unlike maize Rab28, it is
          not ABA-inducible. Characterization of the human Rab28
          homolog revealed two isoforms, which differ by a
          95-base pair insertion, producing an alternative
          sequence for the 30 amino acids at the C-terminus. The
          two human isoforms are presumably the result of
          alternative splicing. Since they differ at the
          C-terminus but not in the GTP-binding region, they are
          predicted to be targeted to different cellular
          locations. GTPase activating proteins (GAPs) interact
          with GTP-bound Rab and accelerate the hydrolysis of GTP
          to GDP. Guanine nucleotide exchange factors (GEFs)
          interact with GDP-bound Rabs to promote the formation
          of the GTP-bound state. Rabs are further regulated by
          guanine nucleotide dissociation inhibitors (GDIs),
          which facilitate Rab recycling by masking C-terminal
          lipid binding and promoting cytosolic localization.
          Most Rab GTPases contain a lipid modification site at
          the C-terminus, with sequence motifs CC, CXC, or CCX.
          Lipid binding is essential for membrane attachment, a
          key feature of most Rab proteins.
          Length = 213

 Score = 45.9 bits (109), Expect = 1e-07
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 6  IKVLTEGTS---CFSTRYTQDEFTRQYYPTSGPDFHLKLLTI-QNRGVKLILWDIGGK 59
          I VL +G S       R+ Q+ F + Y  T G DF  + +T+  +  V L +WDIGG+
Sbjct: 3  IVVLGDGASGKTSLIRRFAQEGFGKSYKQTIGLDFFSRRITLPGSLNVTLQVWDIGGQ 60


>gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13
          (Rab8, Rab10, Rab13).  Rab8/Sec4/Ypt2 are known or
          suspected to be involved in post-Golgi transport to the
          plasma membrane. It is likely that these Rabs have
          functions that are specific to the mammalian lineage
          and have no orthologs in plants. Rab8 modulates
          polarized membrane transport through reorganization of
          actin and microtubules, induces the formation of new
          surface extensions, and has an important role in
          directed membrane transport to cell surfaces. The Ypt2
          gene of the fission yeast Schizosaccharomyces pombe
          encodes a member of the Ypt/Rab family of small
          GTP-binding proteins, related in sequence to Sec4p of
          Saccharomyces cerevisiae but closer to mammalian Rab8.
          GTPase activating proteins (GAPs) interact with
          GTP-bound Rab and accelerate the hydrolysis of GTP to
          GDP. Guanine nucleotide exchange factors (GEFs)
          interact with GDP-bound Rabs to promote the formation
          of the GTP-bound state. Rabs are further regulated by
          guanine nucleotide dissociation inhibitors (GDIs),
          which facilitate Rab recycling by masking C-terminal
          lipid binding and promoting cytosolic localization.
          Most Rab GTPases contain a lipid modification site at
          the C-terminus, with sequence motifs CC, CXC, or CCX.
          Lipid binding is essential for membrane attachment, a
          key feature of most Rab proteins. Due to the presence
          of truncated sequences in this CD, the lipid
          modification site is not available for annotation.
          Length = 167

 Score = 44.6 bits (106), Expect = 3e-07
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          G SC   R+++D F   +  T G DF ++ + +  + +KL +WD  G+
Sbjct: 15 GKSCLLLRFSEDSFNPSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQ 62


>gnl|CDD|206692 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab18) and 32
          (Rab32).  Rab38/Rab32 subfamily. Rab32 and Rab38 are
          members of the Rab family of small GTPases. Human Rab32
          was first identified in platelets but it is expressed
          in a variety of cell types, where it functions as an
          A-kinase anchoring protein (AKAP). Rab38 has been shown
          to be melanocyte-specific. GTPase activating proteins
          (GAPs) interact with GTP-bound Rab and accelerate the
          hydrolysis of GTP to GDP. Guanine nucleotide exchange
          factors (GEFs) interact with GDP-bound Rabs to promote
          the formation of the GTP-bound state. Rabs are further
          regulated by guanine nucleotide dissociation inhibitors
          (GDIs), which facilitate Rab recycling by masking
          C-terminal lipid binding and promoting cytosolic
          localization. Most Rab GTPases contain a lipid
          modification site at the C-terminus, with sequence
          motifs CC, CXC, or CCX. Lipid binding is essential for
          membrane attachment, a key feature of most Rab
          proteins.
          Length = 201

 Score = 44.2 bits (105), Expect = 5e-07
 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTI-QNRGVKLILWDIGG 58
          G +    RY    F++ Y  T G DF LK++    N  V+L LWDI G
Sbjct: 12 GKTSIIKRYVHGVFSQHYKATIGVDFALKVIEWDPNTVVRLQLWDIAG 59


>gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18).  Rab18 subfamily.
          Mammalian Rab18 is implicated in endocytic transport
          and is expressed most highly in polarized epithelial
          cells. However, trypanosomal Rab, TbRAB18, is
          upregulated in the BSF (Blood Stream Form) stage and
          localized predominantly to elements of the Golgi
          complex. In human and mouse cells, Rab18 has been
          identified in lipid droplets, organelles that store
          neutral lipids. GTPase activating proteins (GAPs)
          interact with GTP-bound Rab and accelerate the
          hydrolysis of GTP to GDP. Guanine nucleotide exchange
          factors (GEFs) interact with GDP-bound Rabs to promote
          the formation of the GTP-bound state. Rabs are further
          regulated by guanine nucleotide dissociation inhibitors
          (GDIs), which facilitate Rab recycling by masking
          C-terminal lipid binding and promoting cytosolic
          localization. Most Rab GTPases contain a lipid
          modification site at the C-terminus, with sequence
          motifs CC, CXC, or CCX. Lipid binding is essential for
          membrane attachment, a key feature of most Rab
          proteins. Due to the presence of truncated sequences in
          this CD, the lipid modification site is not available
          for annotation.
          Length = 161

 Score = 43.5 bits (103), Expect = 7e-07
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          G S    R+T D F      T G DF +K +T+  + VKL +WD  G
Sbjct: 12 GKSSLLLRFTDDTFDEDLSSTIGVDFKVKTVTVDGKKVKLAIWDTAG 58


>gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast
          homolog Ypt1.  Rab1/Ypt1 subfamily. Rab1 is found in
          every eukaryote and is a key regulatory component for
          the transport of vesicles from the ER to the Golgi
          apparatus. Studies on mutations of Ypt1, the yeast
          homolog of Rab1, showed that this protein is necessary
          for the budding of vesicles of the ER as well as for
          their transport to, and fusion with, the Golgi
          apparatus. GTPase activating proteins (GAPs) interact
          with GTP-bound Rab and accelerate the hydrolysis of GTP
          to GDP. Guanine nucleotide exchange factors (GEFs)
          interact with GDP-bound Rabs to promote the formation
          of the GTP-bound state. Rabs are further regulated by
          guanine nucleotide dissociation inhibitors (GDIs),
          which facilitate Rab recycling by masking C-terminal
          lipid binding and promoting cytosolic localization.
          Most Rab GTPases contain a lipid modification site at
          the C-terminus, with sequence motifs CC, CXC, or CCX.
          Lipid binding is essential for membrane attachment, a
          key feature of most Rab proteins. Due to the presence
          of truncated sequences in this CD, the lipid
          modification site is not available for annotation.
          Length = 166

 Score = 42.7 bits (101), Expect = 2e-06
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          G SC   R+  D +T  Y  T G DF ++ + +  + VKL +WD  G+
Sbjct: 14 GKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTVKLQIWDTAGQ 61


>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins
          [General function prediction only].
          Length = 219

 Score = 43.0 bits (101), Expect = 2e-06
 Identities = 17/47 (36%), Positives = 20/47 (42%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          G +    R   DEF   Y PT G     K +    R +KL LWD  G
Sbjct: 17 GKTTLLNRLVGDEFPEGYPPTIGNLDPAKTIEPYRRNIKLQLWDTAG 63


>gnl|CDD|133306 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)-like.
          Rab23-like subfamily. Rab23 is a member of the Rab
          family of small GTPases. In mouse, Rab23 has been shown
          to function as a negative regulator in the sonic
          hedgehog (Shh) signaling pathway. Rab23 mediates the
          activity of Gli2 and Gli3, transcription factors that
          regulate Shh signaling in the spinal cord, primarily by
          preventing Gli2 activation in the absence of Shh
          ligand. Rab23 also regulates a step in the cytoplasmic
          signal transduction pathway that mediates the effect of
          Smoothened (one of two integral membrane proteins that
          are essential components of the Shh signaling pathway
          in vertebrates). In humans, Rab23 is expressed in the
          retina. Mice contain an isoform that shares 93%
          sequence identity with the human Rab23 and an
          alternative splicing isoform that is specific to the
          brain. This isoform causes the murine open brain
          phenotype, indicating it may have a role in the
          development of the central nervous system. GTPase
          activating proteins (GAPs) interact with GTP-bound Rab
          and accelerate the hydrolysis of GTP to GDP. Guanine
          nucleotide exchange factors (GEFs) interact with
          GDP-bound Rabs to promote the formation of the
          GTP-bound state. Rabs are further regulated by guanine
          nucleotide dissociation inhibitors (GDIs), which
          facilitate Rab recycling by masking C-terminal lipid
          binding and promoting cytosolic localization. Most Rab
          GTPases contain a lipid modification site at the
          C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
          binding is essential for membrane attachment, a key
          feature of most Rab proteins. Due to the presence of
          truncated sequences in this CD, the lipid modification
          site is not available for annotation.
          Length = 162

 Score = 41.7 bits (98), Expect = 3e-06
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 4/66 (6%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRG--VKLILWDIGGKANESSAGLVK 69
          G S    R+ +  FT+ Y  T G DF  K + ++     V+L+LWD  G+  E    + K
Sbjct: 12 GKSSMIQRFVKGIFTKDYKKTIGVDFLEKQIFLRQSDEDVRLMLWDTAGQ--EEFDAITK 69

Query: 70 TYLSSA 75
           Y   A
Sbjct: 70 AYYRGA 75


>gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30).  Rab30 subfamily.
          Rab30 appears to be associated with the Golgi stack. It
          is expressed in a wide variety of tissue types and in
          humans maps to chromosome 11. GTPase activating
          proteins (GAPs) interact with GTP-bound Rab and
          accelerate the hydrolysis of GTP to GDP. Guanine
          nucleotide exchange factors (GEFs) interact with
          GDP-bound Rabs to promote the formation of the
          GTP-bound state. Rabs are further regulated by guanine
          nucleotide dissociation inhibitors (GDIs), which
          facilitate Rab recycling by masking C-terminal lipid
          binding and promoting cytosolic localization. Most Rab
          GTPases contain a lipid modification site at the
          C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
          binding is essential for membrane attachment, a key
          feature of most Rab proteins. Due to the presence of
          truncated sequences in this CD, the lipid modification
          site is not available for annotation.
          Length = 169

 Score = 41.0 bits (96), Expect = 7e-06
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGKANESSAGLVKTY 71
          G +C   R+TQ  F      T G DF +K + I+   +KL +WD  G+  E    + ++Y
Sbjct: 19 GKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEIKGEKIKLQIWDTAGQ--ERFRSITQSY 76

Query: 72 LSSAN 76
            SAN
Sbjct: 77 YRSAN 81


>gnl|CDD|206655 cd01862, Rab7, Rab GTPase family 7 (Rab7).  Rab7 subfamily. Rab7
          is a small Rab GTPase that regulates vesicular traffic
          from early to late endosomal stages of the endocytic
          pathway. The yeast Ypt7 and mammalian Rab7 are both
          involved in transport to the vacuole/lysosome, whereas
          Ypt7 is also required for homotypic vacuole fusion.
          Mammalian Rab7 is an essential participant in the
          autophagic pathway for sequestration and targeting of
          cytoplasmic components to the lytic compartment.
          Mammalian Rab7 is also proposed to function as a tumor
          suppressor. GTPase activating proteins (GAPs) interact
          with GTP-bound Rab and accelerate the hydrolysis of GTP
          to GDP. Guanine nucleotide exchange factors (GEFs)
          interact with GDP-bound Rabs to promote the formation
          of the GTP-bound state. Rabs are further regulated by
          guanine nucleotide dissociation inhibitors (GDIs),
          which facilitate Rab recycling by masking C-terminal
          lipid binding and promoting cytosolic localization.
          Most Rab GTPases contain a lipid modification site at
          the C-terminus, with sequence motifs CC, CXC, or CCX.
          Lipid binding is essential for membrane attachment, a
          key feature of most Rab proteins. Due to the presence
          of truncated sequences in this CD, the lipid
          modification site is not available for annotation.
          Length = 172

 Score = 40.7 bits (96), Expect = 8e-06
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          G +    +Y   +F+ QY  T G DF  K +T+ +R V L +WD  G
Sbjct: 12 GKTSLMNQYVNKKFSNQYKATIGADFLTKEVTVDDRLVTLQIWDTAG 58


>gnl|CDD|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like).  RJLs are
          found in many protists and as chimeras with C-terminal
          DNAJ domains in deuterostome metazoa. They are not
          found in plants, fungi, and protostome metazoa,
          suggesting a horizontal gene transfer between protists
          and deuterostome metazoa. RJLs lack any known membrane
          targeting signal and contain a degenerate
          phosphate/magnesium-binding 3 (PM3) motif, suggesting
          an impaired ability to hydrolyze GTP. GTPase activating
          proteins (GAPs) interact with GTP-bound Rab and
          accelerate the hydrolysis of GTP to GDP. Guanine
          nucleotide exchange factors (GEFs) interact with
          GDP-bound Rabs to promote the formation of the
          GTP-bound state. Rabs are further regulated by guanine
          nucleotide dissociation inhibitors (GDIs), which
          facilitate Rab recycling by masking C-terminal lipid
          binding and promoting cytosolic localization.
          Length = 168

 Score = 40.4 bits (95), Expect = 1e-05
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 5/58 (8%)

Query: 6  IKVLTEGT-----SCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          IKV++ G      SC   RY +  F  +Y PT G D+ +K ++++N+ V++  +D+ G
Sbjct: 1  IKVISMGNSGVGKSCIIKRYCEGRFVSKYLPTIGIDYGVKKVSVRNKEVRVNFFDLSG 58


>gnl|CDD|206657 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, Rab3B, Rab3C
          and Rab3D.  The Rab3 subfamily contains Rab3A, Rab3B,
          Rab3C, and Rab3D. All four isoforms were found in mouse
          brain and endocrine tissues, with varying levels of
          expression. Rab3A, Rab3B, and Rab3C localized to
          synaptic and secretory vesicles; Rab3D was expressed at
          high levels only in adipose tissue, exocrine glands,
          and the endocrine pituitary, where it is localized to
          cytoplasmic secretory granules. Rab3 appears to control
          Ca2+-regulated exocytosis. The appropriate GDP/GTP
          exchange cycle of Rab3A is required for Ca2+-regulated
          exocytosis to occur, and interaction of the GTP-bound
          form of Rab3A with effector molecule(s) is widely
          believed to be essential for this process.
          Functionally, most studies point toward a role for Rab3
          in the secretion of hormones and neurotransmitters.
          GTPase activating proteins (GAPs) interact with
          GTP-bound Rab and accelerate the hydrolysis of GTP to
          GDP. Guanine nucleotide exchange factors (GEFs)
          interact with GDP-bound Rabs to promote the formation
          of the GTP-bound state. Rabs are further regulated by
          guanine nucleotide dissociation inhibitors (GDIs),
          which facilitate Rab recycling by masking C-terminal
          lipid binding and promoting cytosolic localization.
          Most Rab GTPases contain a lipid modification site at
          the C-terminus, with sequence motifs CC, CXC, or CCX.
          Lipid binding is essential for membrane attachment, a
          key feature of most Rab proteins. Due to the presence
          of truncated sequences in this CD, the lipid
          modification site is not available for annotation.
          Length = 165

 Score = 40.3 bits (94), Expect = 1e-05
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          G + F  RY  D FT  +  T G DF +K +   ++ +KL +WD  G+
Sbjct: 13 GKTSFLFRYADDSFTSAFVSTVGIDFKVKTVYRNDKRIKLQIWDTAGQ 60


>gnl|CDD|206696 cd04113, Rab4, Rab GTPase family 4 (Rab4).  Rab4 subfamily. Rab4
          has been implicated in numerous functions within the
          cell. It helps regulate endocytosis through the
          sorting, recycling, and degradation of early endosomes.
          Mammalian Rab4 is involved in the regulation of many
          surface proteins including G-protein-coupled receptors,
          transferrin receptor, integrins, and surfactant protein
          A. Experimental data implicate Rab4 in regulation of
          the recycling of internalized receptors back to the
          plasma membrane. It is also believed to influence
          receptor-mediated antigen processing in B-lymphocytes,
          in calcium-dependent exocytosis in platelets, in
          alpha-amylase secretion in pancreatic cells, and in
          insulin-induced translocation of Glut4 from internal
          vesicles to the cell surface. Rab4 is known to share
          effector proteins with Rab5 and Rab11. GTPase
          activating proteins (GAPs) interact with GTP-bound Rab
          and accelerate the hydrolysis of GTP to GDP. Guanine
          nucleotide exchange factors (GEFs) interact with
          GDP-bound Rabs to promote the formation of the
          GTP-bound state. Rabs are further regulated by guanine
          nucleotide dissociation inhibitors (GDIs), which
          facilitate Rab recycling by masking C-terminal lipid
          binding and promoting cytosolic localization. Most Rab
          GTPases contain a lipid modification site at the
          C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
          binding is essential for membrane attachment, a key
          feature of most Rab proteins. Due to the presence of
          truncated sequences in this CD, the lipid modification
          site is not available for annotation.
          Length = 161

 Score = 39.7 bits (93), Expect = 2e-05
 Identities = 13/48 (27%), Positives = 27/48 (56%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          G SC   ++ +++F +    T G +F  +++ +  + VKL +WD  G+
Sbjct: 12 GKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKSVKLQIWDTAGQ 59


>gnl|CDD|178655 PLN03108, PLN03108, Rab family protein; Provisional.
          Length = 210

 Score = 38.4 bits (89), Expect = 7e-05
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGKANESSAGLVKTY 71
          G SC   ++T   F   +  T G +F  +++TI N+ +KL +WD  G+  ES   + ++Y
Sbjct: 18 GKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQ--ESFRSITRSY 75

Query: 72 LSSA 75
             A
Sbjct: 76 YRGA 79


>gnl|CDD|206698 cd04117, Rab15, Rab GTPase family 15 (Rab15).  Rab15 colocalizes
          with the transferrin receptor in early endosome
          compartments, but not with late endosomal markers. It
          codistributes with Rab4 and Rab5 on early/sorting
          endosomes, and with Rab11 on pericentriolar recycling
          endosomes. It is believed to function as an inhibitory
          GTPase that regulates distinct steps in early endocytic
          trafficking. GTPase activating proteins (GAPs) interact
          with GTP-bound Rab and accelerate the hydrolysis of GTP
          to GDP. Guanine nucleotide exchange factors (GEFs)
          interact with GDP-bound Rabs to promote the formation
          of the GTP-bound state. Rabs are further regulated by
          guanine nucleotide dissociation inhibitors (GDIs),
          which facilitate Rab recycling by masking C-terminal
          lipid binding and promoting cytosolic localization.
          Most Rab GTPases contain a lipid modification site at
          the C-terminus, with sequence motifs CC, CXC, or CCX.
          Lipid binding is essential for membrane attachment, a
          key feature of most Rab proteins. Due to the presence
          of truncated sequences in this CD, the lipid
          modification site is not available for annotation.
          Length = 164

 Score = 37.6 bits (87), Expect = 1e-04
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGKANESSAGLVKTY 71
          G +C   R+T +EF   +  T G DF +K + +    V++ +WD  G+  E    + K Y
Sbjct: 12 GKTCLLCRFTDNEFHSSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQ--ERYQTITKQY 69

Query: 72 LSSA 75
             A
Sbjct: 70 YRRA 73


>gnl|CDD|133267 cd01864, Rab19, Rab GTPase family 19 (Rab19).  Rab19 subfamily.
          Rab19 proteins are associated with Golgi stacks.
          Similarity analysis indicated that Rab41 is closely
          related to Rab19. However, the function of these Rabs
          is not yet characterized. GTPase activating proteins
          (GAPs) interact with GTP-bound Rab and accelerate the
          hydrolysis of GTP to GDP. Guanine nucleotide exchange
          factors (GEFs) interact with GDP-bound Rabs to promote
          the formation of the GTP-bound state. Rabs are further
          regulated by guanine nucleotide dissociation inhibitors
          (GDIs), which facilitate Rab recycling by masking
          C-terminal lipid binding and promoting cytosolic
          localization. Most Rab GTPases contain a lipid
          modification site at the C-terminus, with sequence
          motifs CC, CXC, or CCX. Lipid binding is essential for
          membrane attachment, a key feature of most Rab
          proteins. Due to the presence of truncated sequences in
          this CD, the lipid modification site is not available
          for annotation.
          Length = 165

 Score = 37.4 bits (87), Expect = 1e-04
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGKANESSAGLVKTY 71
          G +C   R+    F+ +   T G DF +K L IQ + VKL +WD  G+  E    + ++Y
Sbjct: 15 GKTCVVQRFKSGTFSERQGNTIGVDFTMKTLEIQGKRVKLQIWDTAGQ--ERFRTITQSY 72

Query: 72 LSSAN 76
            SAN
Sbjct: 73 YRSAN 77


>gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5
          and Rab22; regulates early endosome fusion.  The
          Rab5-related subfamily includes Rab5 and Rab22 of
          mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of
          plants. The members of this subfamily are involved in
          endocytosis and endocytic-sorting pathways. In mammals,
          Rab5 GTPases localize to early endosomes and regulate
          fusion of clathrin-coated vesicles to early endosomes
          and fusion between early endosomes. In yeast, Ypt51p
          family members similarly regulate membrane trafficking
          through prevacuolar compartments. GTPase activating
          proteins (GAPs) interact with GTP-bound Rab and
          accelerate the hydrolysis of GTP to GDP. Guanine
          nucleotide exchange factors (GEFs) interact with
          GDP-bound Rabs to promote the formation of the
          GTP-bound state. Rabs are further regulated by guanine
          nucleotide dissociation inhibitors (GDIs), which
          facilitate Rab recycling by masking C-terminal lipid
          binding and promoting cytosolic localization. Most Rab
          GTPases contain a lipid modification site at the
          C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
          binding is essential for membrane attachment, a key
          feature of most Rab proteins. Due to the presence of
          truncated sequences in this CD, the lipid modification
          site is not available for annotation.
          Length = 163

 Score = 36.8 bits (86), Expect = 2e-04
 Identities = 13/47 (27%), Positives = 22/47 (46%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          G S    R+ ++EF+     T G  F  + + + +  VK  +WD  G
Sbjct: 13 GKSSIVLRFVKNEFSENQESTIGAAFLTQTVNLDDTTVKFEIWDTAG 59


>gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39).  Found in
          eukaryotes, Rab39 is mainly found in epithelial cell
          lines, but is distributed widely in various human
          tissues and cell lines. It is believed to be a novel
          Rab protein involved in regulating Golgi-associated
          vesicular transport during cellular endocytosis. GTPase
          activating proteins (GAPs) interact with GTP-bound Rab
          and accelerate the hydrolysis of GTP to GDP. Guanine
          nucleotide exchange factors (GEFs) interact with
          GDP-bound Rabs to promote the formation of the
          GTP-bound state. Rabs are further regulated by guanine
          nucleotide dissociation inhibitors (GDIs), which
          facilitate Rab recycling by masking C-terminal lipid
          binding and promoting cytosolic localization. Most Rab
          GTPases contain a lipid modification site at the
          C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
          binding is essential for membrane attachment, a key
          feature of most Rab proteins.
          Length = 211

 Score = 37.0 bits (86), Expect = 2e-04
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 10 TEGTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQ-NRGVKLILWDIGGK 59
          T G S    R+T+  F     PT G DF  +L+ I+    +KL LWD  G+
Sbjct: 12 TVGKSSLLKRFTEGRFAEVSDPTVGVDFFSRLIEIEPGVRIKLQLWDTAGQ 62


>gnl|CDD|133315 cd04115, Rab33B_Rab33A, Rab GTPase family 33 includes Rab33A and
          Rab33B.  Rab33B/Rab33A subfamily. Rab33B is
          ubiquitously expressed in mouse tissues and cells,
          where it is localized to the medial Golgi cisternae. It
          colocalizes with alpha-mannose II. Together with the
          other cisternal Rabs, Rab6A and Rab6A', it is believed
          to regulate the Golgi response to stress and is likely
          a molecular target in stress-activated signaling
          pathways. Rab33A (previously known as S10) is expressed
          primarily in the brain and immune system cells. In
          humans, it is located on the X chromosome at Xq26 and
          its expression is down-regulated in tuberculosis
          patients. Experimental evidence suggests that Rab33A is
          a novel CD8+ T cell factor that likely plays a role in
          tuberculosis disease processes. GTPase activating
          proteins (GAPs) interact with GTP-bound Rab and
          accelerate the hydrolysis of GTP to GDP. Guanine
          nucleotide exchange factors (GEFs) interact with
          GDP-bound Rabs to promote the formation of the
          GTP-bound state. Rabs are further regulated by guanine
          nucleotide dissociation inhibitors (GDIs), which
          facilitate Rab recycling by masking C-terminal lipid
          binding and promoting cytosolic localization. Most Rab
          GTPases contain a lipid modification site at the
          C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
          binding is essential for membrane attachment, a key
          feature of most Rab proteins. Due to the presence of
          truncated sequences in this CD, the lipid modification
          site is not available for annotation.
          Length = 170

 Score = 36.6 bits (85), Expect = 3e-04
 Identities = 14/48 (29%), Positives = 23/48 (47%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          G +C + R+    F  +   T G DF  + + I    +K+ LWD  G+
Sbjct: 14 GKTCLTYRFCAGRFPERTEATIGVDFRERTVEIDGERIKVQLWDTAGQ 61


>gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35).  Rab35 is one of
          several Rab proteins to be found to participate in the
          regulation of osteoclast cells in rats. In addition,
          Rab35 has been identified as a protein that interacts
          with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK)
          in human cells. Overexpression of NPM-ALK is a key
          oncogenic event in some anaplastic large-cell
          lymphomas; since Rab35 interacts with N|PM-ALK, it may
          provide a target for cancer treatments. GTPase
          activating proteins (GAPs) interact with GTP-bound Rab
          and accelerate the hydrolysis of GTP to GDP. Guanine
          nucleotide exchange factors (GEFs) interact with
          GDP-bound Rabs to promote the formation of the
          GTP-bound state. Rabs are further regulated by guanine
          nucleotide dissociation inhibitors (GDIs), which
          facilitate Rab recycling by masking C-terminal lipid
          binding and promoting cytosolic localization. Most Rab
          GTPases contain a lipid modification site at the
          C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
          binding is essential for membrane attachment, a key
          feature of most Rab proteins.
          Length = 199

 Score = 36.8 bits (85), Expect = 3e-04
 Identities = 16/48 (33%), Positives = 24/48 (50%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          G S    R+  + F+  Y  T G DF ++ + I    VKL +WD  G+
Sbjct: 18 GKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGERVKLQIWDTAGQ 65


>gnl|CDD|206701 cd04128, Spg1, Septum-promoting GTPase (Spg1).  Spg1p. Spg1p
          (septum-promoting GTPase) was first identified in the
          fission yeast S. pombe, where it regulates septum
          formation in the septation initiation network (SIN)
          through the cdc7 protein kinase. Spg1p is an essential
          gene that localizes to the spindle pole bodies. When
          GTP-bound, it binds cdc7 and causes it to translocate
          to spindle poles. Sid4p (septation initiation
          defective) is required for localization of Spg1p to the
          spindle pole body, and the ability of Spg1p to promote
          septum formation from any point in the cell cycle
          depends on Sid4p. Spg1p is negatively regulated by Byr4
          and cdc16, which form a two-component GTPase activating
          protein (GAP) for Spg1p. The existence of a SIN-related
          pathway in plants has been proposed. GTPase activating
          proteins (GAPs) interact with GTP-bound Rab and
          accelerate the hydrolysis of GTP to GDP. Guanine
          nucleotide exchange factors (GEFs) interact with
          GDP-bound Rabs to promote the formation of the
          GTP-bound state. Rabs are further regulated by guanine
          nucleotide dissociation inhibitors (GDIs), which
          facilitate Rab recycling by masking C-terminal lipid
          binding and promoting cytosolic localization.
          Length = 182

 Score = 34.7 bits (80), Expect = 0.001
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          G +    +Y + EF  +Y  T G +F  K ++I+   +   +WD+GG
Sbjct: 12 GKTSLMVKYVEGEFDEEYIQTLGVNFMEKTISIRGTEITFSIWDLGG 58


>gnl|CDD|206693 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab34) and 36
          (Rab36).  Rab34/Rab36 subfamily. Rab34, found primarily
          in the Golgi, interacts with its effector,
          Rab-interacting lysosomal protein (RILP). This enables
          its participation in microtubular
          dynenin-dynactin-mediated repositioning of lysosomes
          from the cell periphery to the Golgi. A Rab34 (Rah)
          isoform that lacks the consensus GTP-binding region has
          been identified in mice. This isoform is associated
          with membrane ruffles and promotes macropinosome
          formation. Rab36 has been mapped to human chromosome
          22q11.2, a region that is homozygously deleted in
          malignant rhabdoid tumors (MRTs). However, experimental
          assessments do not implicate Rab36 as a tumor
          suppressor that would enable tumor formation through a
          loss-of-function mechanism. GTPase activating proteins
          (GAPs) interact with GTP-bound Rab and accelerate the
          hydrolysis of GTP to GDP. Guanine nucleotide exchange
          factors (GEFs) interact with GDP-bound Rabs to promote
          the formation of the GTP-bound state. Rabs are further
          regulated by guanine nucleotide dissociation inhibitors
          (GDIs), which facilitate Rab recycling by masking
          C-terminal lipid binding and promoting cytosolic
          localization. Most Rab GTPases contain a lipid
          modification site at the C-terminus, with sequence
          motifs CC, CXC, or CCX. Lipid binding is essential for
          membrane attachment, a key feature of most Rab
          proteins.
          Length = 170

 Score = 34.5 bits (79), Expect = 0.002
 Identities = 16/51 (31%), Positives = 25/51 (49%)

Query: 9  LTEGTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          L+ G +C   R+ +D F + Y  T G DF ++   +      L LWD  G+
Sbjct: 9  LSVGKTCLINRFCKDVFDKNYKATIGVDFEMERFEVLGVPFSLQLWDTAGQ 59


>gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a).  The Rab27a
          subfamily consists of Rab27a and its highly homologous
          isoform, Rab27b. Unlike most Rab proteins whose
          functions remain poorly defined, Rab27a has many known
          functions. Rab27a has multiple effector proteins, and
          depending on which effector it binds, Rab27a has
          different functions as well as tissue distribution
          and/or cellular localization. Putative functions have
          been assigned to Rab27a when associated with the
          effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp,
          rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c,
          Noc2, JFC1, and Munc13-4. Rab27a has been associated
          with several human diseases, including hemophagocytic
          syndrome (Griscelli syndrome or GS), Hermansky-Pudlak
          syndrome, and choroidermia. In the case of GS, a rare,
          autosomal recessive disease, a Rab27a mutation is
          directly responsible for the disorder. When Rab27a is
          localized to the secretory granules of pancreatic beta
          cells, it is believed to mediate glucose-stimulated
          insulin secretion, making it a potential target for
          diabetes therapy. When bound to JFC1 in prostate cells,
          Rab27a is believed to regulate the exocytosis of
          prostate- specific markers. GTPase activating proteins
          (GAPs) interact with GTP-bound Rab and accelerate the
          hydrolysis of GTP to GDP. Guanine nucleotide exchange
          factors (GEFs) interact with GDP-bound Rabs to promote
          the formation of the GTP-bound state. Rabs are further
          regulated by guanine nucleotide dissociation inhibitors
          (GDIs), which facilitate Rab recycling by masking
          C-terminal lipid binding and promoting cytosolic
          localization. Most Rab GTPases contain a lipid
          modification site at the C-terminus, with sequence
          motifs CC, CXC, or CCX. Lipid binding is essential for
          membrane attachment, a key feature of most Rab
          proteins. Due to the presence of truncated sequences in
          this CD, the lipid modification site is not available
          for annotation.
          Length = 180

 Score = 34.4 bits (79), Expect = 0.002
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 10/58 (17%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRG----------VKLILWDIGGK 59
          G + F  RYT ++F  ++  T G DF  K +   ++G          V L LWD  G+
Sbjct: 16 GKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNSQGPDGTSGKAFRVHLQLWDTAGQ 73


>gnl|CDD|206658 cd01866, Rab2, Rab GTPase family 2 (Rab2).  Rab2 is localized on
          cis-Golgi membranes and interacts with Golgi matrix
          proteins. Rab2 is also implicated in the maturation of
          vesicular tubular clusters (VTCs), which are
          microtubule-associated intermediates in transport
          between the ER and Golgi apparatus. In plants, Rab2
          regulates vesicle trafficking between the ER and the
          Golgi bodies and is important to pollen tube growth.
          GTPase activating proteins (GAPs) interact with
          GTP-bound Rab and accelerate the hydrolysis of GTP to
          GDP. Guanine nucleotide exchange factors (GEFs)
          interact with GDP-bound Rabs to promote the formation
          of the GTP-bound state. Rabs are further regulated by
          guanine nucleotide dissociation inhibitors (GDIs),
          which facilitate Rab recycling by masking C-terminal
          lipid binding and promoting cytosolic localization.
          Most Rab GTPases contain a lipid modification site at
          the C-terminus, with sequence motifs CC, CXC, or CCX.
          Lipid binding is essential for membrane attachment, a
          key feature of most Rab proteins. Due to the presence
          of truncated sequences in this CD, the lipid
          modification site is not available for annotation.
          Length = 168

 Score = 34.3 bits (79), Expect = 0.002
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGKANESSAGLVKTY 71
          G SC   ++T   F   +  T G +F  +++TI  + +KL +WD  G+  ES   + ++Y
Sbjct: 16 GKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQ--ESFRSITRSY 73


>gnl|CDD|128473 smart00176, RAN, Ran (Ras-related nuclear proteins) /TC4
          subfamily of small GTPases.  Ran is involved in the
          active transport of proteins through nuclear pores.
          Length = 200

 Score = 33.8 bits (77), Expect = 0.003
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRG-VKLILWDIGGKANESSAGLVKT 70
          G + F  R+   EF ++Y  T G + H  L+   NRG ++  +WD  G+  E   GL   
Sbjct: 7  GKTTFVKRHLTGEFEKKYVATLGVEVH-PLVFHTNRGPIRFNVWDTAGQ--EKFGGLRDG 63

Query: 71 Y 71
          Y
Sbjct: 64 Y 64


>gnl|CDD|206699 cd04120, Rab12, Rab GTPase family 12 (Rab12).  Rab12 was first
          identified in canine cells, where it was localized to
          the Golgi complex. The specific function of Rab12
          remains unknown, and inconsistent results about its
          cellular localization have been reported. More recent
          studies have identified Rab12 associated with
          post-Golgi vesicles, or with other small vesicle-like
          structures but not with the Golgi complex. Most Rab
          GTPases contain a lipid modification site at the
          C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
          binding is essential for membrane attachment, a key
          feature of most Rab proteins. GTPase activating
          proteins (GAPs) interact with GTP-bound Rab and
          accelerate the hydrolysis of GTP to GDP. Guanine
          nucleotide exchange factors (GEFs) interact with
          GDP-bound Rabs to promote the formation of the
          GTP-bound state. Rabs are further regulated by guanine
          nucleotide dissociation inhibitors (GDIs), which
          facilitate Rab recycling by masking C-terminal lipid
          binding and promoting cytosolic localization. Most Rab
          GTPases contain a lipid modification site at the
          C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
          binding is essential for membrane attachment, a key
          feature of most Rab proteins.
          Length = 202

 Score = 33.8 bits (77), Expect = 0.003
 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGKANESSAGLVKTY 71
          G +    R+T D F      T G DF +K + ++ + ++L +WD  G+   +S  +   Y
Sbjct: 12 GKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNS--ITSAY 69

Query: 72 LSSA 75
            SA
Sbjct: 70 YRSA 73


>gnl|CDD|206695 cd04112, Rab26, Rab GTPase family 26 (Rab26).  Rab26 subfamily.
          First identified in rat pancreatic acinar cells, Rab26
          is believed to play a role in recruiting mature
          granules to the plasma membrane upon beta-adrenergic
          stimulation. Rab26 belongs to the Rab functional group
          III, which are considered key regulators of
          intracellular vesicle transport during exocytosis.
          GTPase activating proteins (GAPs) interact with
          GTP-bound Rab and accelerate the hydrolysis of GTP to
          GDP. Guanine nucleotide exchange factors (GEFs)
          interact with GDP-bound Rabs to promote the formation
          of the GTP-bound state. Rabs are further regulated by
          guanine nucleotide dissociation inhibitors (GDIs),
          which facilitate Rab recycling by masking C-terminal
          lipid binding and promoting cytosolic localization.
          Most Rab GTPases contain a lipid modification site at
          the C-terminus, with sequence motifs CC, CXC, or CCX.
          Lipid binding is essential for membrane attachment, a
          key feature of most Rab proteins.
          Length = 191

 Score = 33.7 bits (77), Expect = 0.004
 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 1/49 (2%)

Query: 12 GTSCFSTRYTQDEFTR-QYYPTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          G +C   R+    F    +  T G  F  K++T+    VKL +WD  G+
Sbjct: 12 GKTCLLVRFKDGAFLAGSFIATVGIQFTNKVVTVDGVKVKLQIWDTAGQ 60


>gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21).  The localization
          and function of Rab21 are not clearly defined, with
          conflicting data reported. Rab21 has been reported to
          localize in the ER in human intestinal epithelial
          cells, with partial colocalization with
          alpha-glucosidase, a late endosomal/lysosomal marker.
          More recently, Rab21 was shown to colocalize with and
          affect the morphology of early endosomes. In
          Dictyostelium, GTP-bound Rab21, together with two novel
          LIM domain proteins, LimF and ChLim, has been shown to
          regulate phagocytosis. GTPase activating proteins
          (GAPs) interact with GTP-bound Rab and accelerate the
          hydrolysis of GTP to GDP. Guanine nucleotide exchange
          factors (GEFs) interact with GDP-bound Rabs to promote
          the formation of the GTP-bound state. Rabs are further
          regulated by guanine nucleotide dissociation inhibitors
          (GDIs), which facilitate Rab recycling by masking
          C-terminal lipid binding and promoting cytosolic
          localization. Most Rab GTPases contain a lipid
          modification site at the C-terminus, with sequence
          motifs CC, CXC, or CCX. Lipid binding is essential for
          membrane attachment, a key feature of most Rab
          proteins. Due to the presence of truncated sequences in
          this CD, the lipid modification site is not available
          for annotation.
          Length = 162

 Score = 33.4 bits (77), Expect = 0.004
 Identities = 12/47 (25%), Positives = 23/47 (48%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          G +    RY +++F  ++  T+   F  K + I  + + L +WD  G
Sbjct: 12 GKTSLVLRYVENKFNEKHESTTQASFFQKTVNIGGKRIDLAIWDTAG 58


>gnl|CDD|133322 cd04122, Rab14, Rab GTPase family 14 (Rab14).  Rab14 GTPases are
          localized to biosynthetic compartments, including the
          rough ER, the Golgi complex, and the trans-Golgi
          network, and to endosomal compartments, including early
          endosomal vacuoles and associated vesicles. Rab14 is
          believed to function in both the biosynthetic and
          recycling pathways between the Golgi and endosomal
          compartments. Rab14 has also been identified on GLUT4
          vesicles, and has been suggested to help regulate GLUT4
          translocation. In addition, Rab14 is believed to play a
          role in the regulation of phagocytosis. GTPase
          activating proteins (GAPs) interact with GTP-bound Rab
          and accelerate the hydrolysis of GTP to GDP. Guanine
          nucleotide exchange factors (GEFs) interact with
          GDP-bound Rabs to promote the formation of the
          GTP-bound state. Rabs are further regulated by guanine
          nucleotide dissociation inhibitors (GDIs), which
          facilitate Rab recycling by masking C-terminal lipid
          binding and promoting cytosolic localization. Most Rab
          GTPases contain a lipid modification site at the
          C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
          binding is essential for membrane attachment, a key
          feature of most Rab proteins. Due to the presence of
          truncated sequences in this CD, the lipid modification
          site is not available for annotation.
          Length = 166

 Score = 33.3 bits (76), Expect = 0.005
 Identities = 13/48 (27%), Positives = 26/48 (54%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          G SC   ++T+ +F      T G +F  +++ +  + +KL +WD  G+
Sbjct: 14 GKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVNGQKIKLQIWDTAGQ 61


>gnl|CDD|215587 PLN03118, PLN03118, Rab family protein; Provisional.
          Length = 211

 Score = 33.1 bits (75), Expect = 0.007
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 31 PTSGPDFHLKLLTIQNRGVKLILWDIGGKANESSAGLVKTYLSSA 75
          PT G DF +K LT+  + +KL +WD  G+  E    L  +Y  +A
Sbjct: 44 PTIGVDFKIKQLTVGGKRLKLTIWDTAGQ--ERFRTLTSSYYRNA 86


>gnl|CDD|240284 PTZ00132, PTZ00132, GTP-binding nuclear protein Ran; Provisional.
          Length = 215

 Score = 32.7 bits (75), Expect = 0.007
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 6/62 (9%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFH-LKLLTIQNRG-VKLILWDIGGKANESSAGLVK 69
          G + F  R+   EF ++Y PT G + H LK  T  N G +   +WD  G+  E   GL  
Sbjct: 21 GKTTFVKRHLTGEFEKKYIPTLGVEVHPLKFYT--NCGPICFNVWDTAGQ--EKFGGLRD 76

Query: 70 TY 71
           Y
Sbjct: 77 GY 78


>gnl|CDD|133277 cd01875, RhoG, Ras homolog family, member G (RhoG) of small
          guanosine triphosphatases (GTPases).  RhoG is a GTPase
          with high sequence similarity to members of the Rac
          subfamily, including the regions involved in effector
          recognition and binding. However, RhoG does not bind to
          known Rac1 and Cdc42 effectors, including proteins
          containing a Cdc42/Rac interacting binding (CRIB)
          motif. Instead, RhoG interacts directly with Elmo, an
          upstream regulator of Rac1, in a GTP-dependent manner
          and forms a ternary complex with Dock180 to induce
          activation of Rac1. The RhoG-Elmo-Dock180 pathway is
          required for activation of Rac1 and cell spreading
          mediated by integrin, as well as for neurite outgrowth
          induced by nerve growth factor. Thus RhoG activates
          Rac1 through Elmo and Dock180 to control cell
          morphology. RhoG has also been shown to play a role in
          caveolar trafficking and has a novel role in signaling
          the neutrophil respiratory burst stimulated by G
          protein-coupled receptor (GPCR) agonists. Most Rho
          proteins contain a lipid modification site at the
          C-terminus, with a typical sequence motif CaaX, where a
          = an aliphatic amino acid and X = any amino acid. Lipid
          binding is essential for membrane attachment, a key
          feature of most Rho proteins.
          Length = 191

 Score = 32.7 bits (74), Expect = 0.008
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          G +C    YT + F ++Y PT   ++  +   +  R V L LWD  G+
Sbjct: 15 GKTCLLICYTTNAFPKEYIPTVFDNYSAQ-TAVDGRTVSLNLWDTAGQ 61


>gnl|CDD|206641 cd00157, Rho, Ras homology family (Rho) of small guanosine
          triphosphatases (GTPases).  Members of the Rho (Ras
          homology) family include RhoA, Cdc42, Rac, Rnd, Wrch1,
          RhoBTB, and Rop. There are 22 human Rho family members
          identified currently. These proteins are all involved
          in the reorganization of the actin cytoskeleton in
          response to external stimuli. They also have roles in
          cell transformation by Ras in cytokinesis, in focal
          adhesion formation and in the stimulation of
          stress-activated kinase. These various functions are
          controlled through distinct effector proteins and
          mediated through a GTP-binding/GTPase cycle involving
          three classes of regulating proteins: GAPs
          (GTPase-activating proteins), GEFs (guanine nucleotide
          exchange factors), and GDIs (guanine nucleotide
          dissociation inhibitors). Most Rho proteins contain a
          lipid modification site at the C-terminus, with a
          typical sequence motif CaaX, where a = an aliphatic
          amino acid and X = any amino acid. Lipid binding is
          essential for membrane attachment, a key feature of
          most Rho proteins. Since crystal structures often lack
          C-terminal residues, this feature is not available for
          annotation in many of the CDs in the hierarchy.
          Length = 171

 Score = 32.5 bits (75), Expect = 0.009
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          G +C    YT ++F  +Y PT   D +   +T+  + V L LWD  G
Sbjct: 12 GKTCLLISYTTNKFPTEYVPTVF-DNYSANVTVDGKQVNLGLWDTAG 57


>gnl|CDD|206697 cd04116, Rab9, Rab GTPase family 9 (Rab9).  Rab9 is found in late
          endosomes, together with mannose 6-phosphate receptors
          (MPRs) and the tail-interacting protein of 47 kD
          (TIP47). Rab9 is a key mediator of vesicular transport
          from late endosomes to the trans-Golgi network (TGN) by
          redirecting the MPRs. Rab9 has been identified as a key
          component for the replication of several viruses,
          including HIV1, Ebola, Marburg, and measles, making it
          a potential target for inhibiting a variety of viruses.
          GTPase activating proteins (GAPs) interact with
          GTP-bound Rab and accelerate the hydrolysis of GTP to
          GDP. Guanine nucleotide exchange factors (GEFs)
          interact with GDP-bound Rabs to promote the formation
          of the GTP-bound state. Rabs are further regulated by
          guanine nucleotide dissociation inhibitors (GDIs),
          which facilitate Rab recycling by masking C-terminal
          lipid binding and promoting cytosolic localization.
          Most Rab GTPases contain a lipid modification site at
          the C-terminus, with sequence motifs CC, CXC, or CCX.
          Lipid binding is essential for membrane attachment, a
          key feature of most Rab proteins. Due to the presence
          of truncated sequences in this CD, the lipid
          modification site is not available for annotation.
          Length = 170

 Score = 32.5 bits (74), Expect = 0.009
 Identities = 16/48 (33%), Positives = 23/48 (47%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          G S    RY  ++F  Q + T G +F  K L +    V L +WD  G+
Sbjct: 17 GKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTLQIWDTAGQ 64


>gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional.
          Length = 216

 Score = 32.6 bits (74), Expect = 0.010
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          G S   +R+T++EF  +   T G +F  + L ++ + VK  +WD  G+
Sbjct: 24 GKSNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQ 71


>gnl|CDD|206660 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)-like includes
          Rab11a, Rab11b, and Rab25.  Rab11a, Rab11b, and Rab25
          are closely related, evolutionary conserved Rab
          proteins that are differentially expressed. Rab11a is
          ubiquitously synthesized, Rab11b is enriched in brain
          and heart and Rab25 is only found in epithelia.
          Rab11/25 proteins seem to regulate recycling pathways
          from endosomes to the plasma membrane and to the
          trans-Golgi network. Furthermore, Rab11a is thought to
          function in the histamine-induced fusion of
          tubulovesicles containing H+, K+ ATPase with the plasma
          membrane in gastric parietal cells and in
          insulin-stimulated insertion of GLUT4 in the plasma
          membrane of cardiomyocytes. Overexpression of Rab25 has
          recently been observed in ovarian cancer and breast
          cancer, and has been correlated with worsened outcomes
          in both diseases. In addition, Rab25 overexpression has
          also been observed in prostate cancer, transitional
          cell carcinoma of the bladder, and invasive breast
          tumor cells. GTPase activating proteins (GAPs) interact
          with GTP-bound Rab and accelerate the hydrolysis of GTP
          to GDP. Guanine nucleotide exchange factors (GEFs)
          interact with GDP-bound Rabs to promote the formation
          of the GTP-bound state. Rabs are further regulated by
          guanine nucleotide dissociation inhibitors (GDIs),
          which facilitate Rab recycling by masking C-terminal
          lipid binding and promoting cytosolic localization.
          Most Rab GTPases contain a lipid modification site at
          the C-terminus, with sequence motifs CC, CXC, or CCX.
          Lipid binding is essential for membrane attachment, a
          key feature of most Rab proteins. Due to the presence
          of truncated sequences in this CD, the lipid
          modification site is not available for annotation.
          Length = 165

 Score = 31.8 bits (73), Expect = 0.017
 Identities = 12/41 (29%), Positives = 22/41 (53%)

Query: 18 TRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          +R+T++EF      T G +F  + + I  + +K  +WD  G
Sbjct: 21 SRFTRNEFNLDSKSTIGVEFATRTIQIDGKTIKAQIWDTAG 61


>gnl|CDD|178620 PLN03071, PLN03071, GTP-binding nuclear protein Ran; Provisional.
          Length = 219

 Score = 31.3 bits (71), Expect = 0.030
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 6/62 (9%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFH-LKLLTIQNRG-VKLILWDIGGKANESSAGLVK 69
          G + F  R+   EF ++Y PT G + H L   T  N G ++   WD  G+  E   GL  
Sbjct: 25 GKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFT--NCGKIRFYCWDTAGQ--EKFGGLRD 80

Query: 70 TY 71
           Y
Sbjct: 81 GY 82


>gnl|CDD|206662 cd01870, RhoA_like, Ras homology family A (RhoA)-like includes
          RhoA, RhoB and RhoC.  The RhoA subfamily consists of
          RhoA, RhoB, and RhoC. RhoA promotes the formation of
          stress fibers and focal adhesions, regulating cell
          shape, attachment, and motility. RhoA can bind to
          multiple effector proteins, thereby triggering
          different downstream responses. In many cell types,
          RhoA mediates local assembly of the contractile ring,
          which is necessary for cytokinesis. RhoA is vital for
          muscle contraction; in vascular smooth muscle cells,
          RhoA plays a key role in cell contraction,
          differentiation, migration, and proliferation. RhoA
          activities appear to be elaborately regulated in a
          time- and space-dependent manner to control
          cytoskeletal changes. Most Rho proteins contain a lipid
          modification site at the C-terminus, with a typical
          sequence motif CaaX, where a = an aliphatic amino acid
          and X = any amino acid. Lipid binding is essential for
          membrane attachment, a key feature of most Rho
          proteins. RhoA and RhoC are observed only in
          geranylgeranylated forms; however, RhoB can be present
          in palmitoylated, farnesylated, and geranylgeranylated
          forms. RhoA and RhoC are highly relevant for tumor
          progression and invasiveness; however, RhoB has
          recently been suggested to be a tumor suppressor. Due
          to the presence of truncated sequences in this CD, the
          lipid modification site is not available for
          annotation.
          Length = 175

 Score = 30.9 bits (70), Expect = 0.036
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGKAN 61
          G +C    +++D+F   Y PT   ++ +  + +  + V+L LWD  G+ +
Sbjct: 13 GKTCLLIVFSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQED 61


>gnl|CDD|133343 cd04143, Rhes_like, Ras homolog enriched in striatum (Rhes) and
          activator of G-protein signaling 1 (Dexras1/AGS1).
          This subfamily includes Rhes (Ras homolog enriched in
          striatum) and Dexras1/AGS1 (activator of G-protein
          signaling 1). These proteins are homologous, but
          exhibit significant differences in tissue distribution
          and subcellular localization. Rhes is found primarily
          in the striatum of the brain, but is also expressed in
          other areas of the brain, such as the cerebral cortex,
          hippocampus, inferior colliculus, and cerebellum. Rhes
          expression is controlled by thyroid hormones. In rat
          PC12 cells, Rhes is farnesylated and localizes to the
          plasma membrane. Rhes binds and activates PI3K, and
          plays a role in coupling serpentine membrane receptors
          with heterotrimeric G-protein signaling. Rhes has
          recently been shown to be reduced under conditions of
          dopamine supersensitivity and may play a role in
          determining dopamine receptor sensitivity. Dexras1/AGS1
          is a dexamethasone-induced Ras protein that is
          expressed primarily in the brain, with low expression
          levels in other tissues. Dexras1 localizes primarily to
          the cytoplasm, and is a critical regulator of the
          circadian master clock to photic and nonphotic input.
          Most Ras proteins contain a lipid modification site at
          the C-terminus, with a typical sequence motif CaaX,
          where a = an aliphatic amino acid and X = any amino
          acid. Lipid binding is essential for membrane
          attachment, a key feature of most Ras proteins.
          Length = 247

 Score = 30.5 bits (69), Expect = 0.046
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          G +   +R+    F  QY PT   DFH KL +I+    +L + D  G
Sbjct: 12 GKTAIVSRFLGGRFEEQYTPTI-EDFHRKLYSIRGEVYQLDILDTSG 57


>gnl|CDD|185444 PTZ00099, PTZ00099, rab6; Provisional.
          Length = 176

 Score = 30.5 bits (68), Expect = 0.047
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 23 DEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGKANESSAGLVKTYLSSA 75
          D F   Y  T G DF  K L +    V+L LWD  G+  E    L+ +Y+  +
Sbjct: 3  DTFDNNYQSTIGIDFLSKTLYLDEGPVRLQLWDTAGQ--ERFRSLIPSYIRDS 53


>gnl|CDD|206723 cd04158, ARD1, (ADP-ribosylation factor domain protein 1 (ARD1). 
          ARD1 (ADP-ribosylation factor domain protein 1) is an
          unusual member of the Arf family. In addition to the
          C-terminal Arf domain, ARD1 has an additional 46-kDa
          N-terminal domain that contains a RING finger domain,
          two predicted B-Boxes, and a coiled-coil protein
          interaction motif. This domain belongs to the TRIM
          (tripartite motif) or RBCC (RING, B-Box, coiled-coil)
          family. Like most Arfs, the ARD1 Arf domain lacks
          detectable GTPase activity. However, unlike most Arfs,
          the full-length ARD1 protein has significant GTPase
          activity due to the GAP (GTPase-activating protein)
          activity exhibited by the 46-kDa N-terminal domain. The
          GAP domain of ARD1 is specific for its own Arf domain
          and does not bind other Arfs. The rate of GDP
          dissociation from the ARD1 Arf domain is slowed by the
          adjacent 15 amino acids, which act as a GDI
          (GDP-dissociation inhibitor) domain. ARD1 is
          ubiquitously expressed in cells and localizes to the
          Golgi and to the lysosomal membrane. Two Tyr-based
          motifs in the Arf domain are responsible for Golgi
          localization, while the GAP domain controls lysosomal
          localization.
          Length = 169

 Score = 30.4 bits (68), Expect = 0.053
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 5/48 (10%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          G +    +  QDEF  Q  PT G  F+++  T++ + +K  +WD+GGK
Sbjct: 11 GKTTILFKLKQDEFM-QPIPTIG--FNVE--TVEYKNLKFTIWDVGGK 53


>gnl|CDD|206643 cd00877, Ran, Ras-related nuclear proteins (Ran)/TC4 family of
          small GTPases.  Ran GTPase is involved in diverse
          biological functions, such as nuclear transport,
          spindle formation during mitosis, DNA replication, and
          cell division. Among the Ras superfamily, Ran is a
          unique small G protein. It does not have a lipid
          modification motif at the C-terminus to bind to the
          membrane, which is often observed within the Ras
          superfamily. Ran may therefore interact with a wide
          range of proteins in various intracellular locations.
          Like other GTPases, Ran exists in GTP- and GDP-bound
          conformations that interact differently with effectors.
          Conversion between these forms and the assembly or
          disassembly of effector complexes requires the
          interaction of regulator proteins. The intrinsic GTPase
          activity of Ran is very low, but it is greatly
          stimulated by a GTPase-activating protein (RanGAP1)
          located in the cytoplasm. By contrast, RCC1, a guanine
          nucleotide exchange factor that generates RanGTP, is
          bound to chromatin and confined to the nucleus. Ran
          itself is mobile and is actively imported into the
          nucleus by a mechanism involving NTF-2. Together with
          the compartmentalization of its regulators, this is
          thought to produce a relatively high concentration of
          RanGTP in the nucleus.
          Length = 166

 Score = 30.0 bits (68), Expect = 0.061
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 6/58 (10%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFH-LKLLTIQNRG-VKLILWDIGGKANESSAGL 67
          G + F  R+   EF ++Y  T G + H L   T  NRG ++  +WD  G+  E   GL
Sbjct: 12 GKTTFVKRHLTGEFEKKYVATLGVEVHPLDFHT--NRGKIRFNVWDTAGQ--EKFGGL 65


>gnl|CDD|133377 cd04177, RSR1, RSR1/Bud1p family GTPase.  RSR1/Bud1p is a member
          of the Rap subfamily of the Ras family that is found in
          fungi. In budding yeasts, RSR1 is involved in selecting
          a site for bud growth on the cell cortex, which directs
          the establishment of cell polarization. The Rho family
          GTPase cdc42 and its GEF, cdc24, then establish an axis
          of polarized growth by organizing the actin
          cytoskeleton and secretory apparatus at the bud site.
          It is believed that cdc42 interacts directly with RSR1
          in vivo. In filamentous fungi, polar growth occurs at
          the tips of hypha and at novel growth sites along the
          extending hypha. In Ashbya gossypii, RSR1 is a key
          regulator of hyphal growth, localizing at the tip
          region and regulating in apical polarization of the
          actin cytoskeleton. Most Ras proteins contain a lipid
          modification site at the C-terminus, with a typical
          sequence motif CaaX, where a = an aliphatic amino acid
          and X = any amino acid. Lipid binding is essential for
          membrane attachment, a key feature of most Ras
          proteins.
          Length = 168

 Score = 29.8 bits (67), Expect = 0.074
 Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 1/49 (2%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGKA 60
          G S  + ++ Q+ F   Y PT   D + K + I  R   L + D  G  
Sbjct: 13 GKSALTVQFVQNVFIESYDPTI-EDSYRKQVEIDGRQCDLEILDTAGTE 60


>gnl|CDD|206721 cd04155, Arl3, Arf-like 3 (Arl3) GTPase.  Arl3 (Arf-like 3) is an
          Arf family protein that differs from most Arf family
          members in the N-terminal extension. In is inactive,
          GDP-bound form, the N-terminal extension forms an
          elongated loop that is hydrophobically anchored into
          the membrane surface; however, it has been proposed
          that this region might form a helix in the GTP-bound
          form. The delta subunit of the rod-specific cyclic GMP
          phosphodiesterase type 6 (PDEdelta) is an Arl3
          effector. Arl3 binds microtubules in a regulated manner
          to alter specific aspects of cytokinesis via
          interactions with retinitis pigmentosa 2 (RP2). It has
          been proposed that RP2 functions in concert with Arl3
          to link the cell membrane and the cytoskeleton in
          photoreceptors as part of the cell signaling or
          vesicular transport machinery. In mice, the absence of
          Arl3 is associated with abnormal epithelial cell
          proliferation and cyst formation.
          Length = 174

 Score = 29.7 bits (67), Expect = 0.084
 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 4/29 (13%)

Query: 31 PTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          PT G  F++K   +Q  G KL +WDIGG+
Sbjct: 45 PTQG--FNIK--NVQADGFKLNVWDIGGQ 69


>gnl|CDD|197228 cd09130, PLDc_unchar2_2, Putative catalytic domain, repeat 2, of
           uncharacterized phospholipase D-like proteins.  Putative
           catalytic domain, repeat 2, of uncharacterized
           phospholipase D (PLD, EC 3.1.4.4)-like proteins. PLD
           enzymes hydrolyze phospholipid phosphodiester bonds to
           yield phosphatidic acid and a free polar head group.
           They can also catalyze transphosphatidylation of
           phospholipids to acceptor alcohols. Members of this
           subfamily contain two HKD motifs (H-x-K-x(4)-D, where x
           represents any amino acid residue) that characterizes
           the PLD superfamily. The two motifs may be part of the
           active site and may be involved in phosphatidyl group
           transfer.
          Length = 157

 Score = 28.7 bits (65), Expect = 0.17
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 3/44 (6%)

Query: 18  TRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGKAN 61
            + T+ +   ++Y T G  FH KLL I+ +G  +I   IGG AN
Sbjct: 77  MKKTKGKIQIRWYNTGGEQFHTKLLLIKKKGQAII---IGGSAN 117


>gnl|CDD|206642 cd00876, Ras, Rat sarcoma (Ras) family of small guanosine
          triphosphatases (GTPases).  The Ras family of the Ras
          superfamily includes classical N-Ras, H-Ras, and K-Ras,
          as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG,
          Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.
          Ras proteins regulate cell growth, proliferation and
          differentiation. Ras is activated by guanine nucleotide
          exchange factors (GEFs) that release GDP and allow GTP
          binding. Many RasGEFs have been identified. These are
          sequestered in the cytosol until activation by growth
          factors triggers recruitment to the plasma membrane or
          Golgi, where the GEF colocalizes with Ras. Active
          GTP-bound Ras interacts with several effector proteins:
          among the best characterized are the Raf kinases,
          phosphatidylinositol 3-kinase (PI3K), RalGEFs and
          NORE/MST1. Most Ras proteins contain a lipid
          modification site at the C-terminus, with a typical
          sequence motif CaaX, where a = an aliphatic amino acid
          and X = any amino acid. Lipid binding is essential for
          membrane attachment, a key feature of most Ras
          proteins. Due to the presence of truncated sequences in
          this CD, the lipid modification site is not available
          for annotation.
          Length = 160

 Score = 28.6 bits (65), Expect = 0.18
 Identities = 13/47 (27%), Positives = 20/47 (42%), Gaps = 1/47 (2%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          G S  + R+   EF  +Y PT   D + K + +      L + D  G
Sbjct: 11 GKSALTIRFVSGEFVEEYDPTIE-DSYRKQIVVDGETYTLDILDTAG 56


>gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl)
          small GTPases.  Arf (ADP-ribosylation factor)/Arl
          (Arf-like) small GTPases. Arf proteins are activators
          of phospholipase D isoforms. Unlike Ras proteins they
          lack cysteine residues at their C-termini and therefore
          are unlikely to be prenylated. Arfs are N-terminally
          myristoylated. Members of the Arf family are regulators
          of vesicle formation in intracellular traffic that
          interact reversibly with membranes of the secretory and
          endocytic compartments in a GTP-dependent manner. They
          depart from other small GTP-binding proteins by a
          unique structural device, interswitch toggle, that
          implements front-back communication from N-terminus to
          the nucleotide binding site. Arf-like (Arl) proteins
          are close relatives of the Arf, but only Arl1 has been
          shown to function in membrane traffic like the Arf
          proteins. Arl2 has an unrelated function in the folding
          of native tubulin, and Arl4 may function in the
          nucleus. Most other Arf family proteins are so far
          relatively poorly characterized. Thus, despite their
          significant sequence homologies, Arf family proteins
          may regulate unrelated functions.
          Length = 158

 Score = 28.7 bits (65), Expect = 0.21
 Identities = 11/29 (37%), Positives = 19/29 (65%), Gaps = 4/29 (13%)

Query: 31 PTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          PT G  F+++ +  +N  VK  +WD+GG+
Sbjct: 29 PTIG--FNVETVEYKN--VKFTVWDVGGQ 53


>gnl|CDD|200938 pfam00025, Arf, ADP-ribosylation factor family.  Pfam combines a
          number of different Prosite families together.
          Length = 174

 Score = 28.3 bits (64), Expect = 0.23
 Identities = 10/29 (34%), Positives = 16/29 (55%), Gaps = 4/29 (13%)

Query: 31 PTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          PT G +      T+  + VK  +WD+GG+
Sbjct: 44 PTIGFNVE----TVTYKNVKFTVWDVGGQ 68


>gnl|CDD|183125 PRK11413, PRK11413, putative hydratase; Provisional.
          Length = 751

 Score = 28.4 bits (64), Expect = 0.32
 Identities = 8/29 (27%), Positives = 14/29 (48%)

Query: 6   IKVLTEGTSCFSTRYTQDEFTRQYYPTSG 34
           + V+T  T+C S+ +  DE    +    G
Sbjct: 240 VDVMTTETTCLSSIWQTDEEVHNWLALHG 268


>gnl|CDD|206663 cd01871, Rac1_like, Ras-related C3 botulinum toxin substrate 1
          (rho family, small GTP binding protein Rac1)-like
          consists of Rac1, Rac2 and Rac3.  The Rac1-like
          subfamily consists of Rac1, Rac2, and Rac3 proteins,
          plus the splice variant Rac1b that contains a
          19-residue insertion near switch II relative to Rac1.
          While Rac1 is ubiquitously expressed, Rac2 and Rac3 are
          largely restricted to hematopoietic and neural tissues
          respectively. Rac1 stimulates the formation of actin
          lamellipodia and membrane ruffles. It also plays a role
          in cell-matrix adhesion and cell anoikis. In intestinal
          epithelial cells, Rac1 is an important regulator of
          migration and mediates apoptosis. Rac1 is also
          essential for RhoA-regulated actin stress fiber and
          focal adhesion complex formation. In leukocytes, Rac1
          and Rac2 have distinct roles in regulating cell
          morphology, migration, and invasion, but are not
          essential for macrophage migration or chemotaxis. Rac3
          has biochemical properties that are closely related to
          Rac1, such as effector interaction, nucleotide binding,
          and hydrolysis; Rac2 has a slower nucleotide
          association and is more efficiently activated by the
          RacGEF Tiam1. Both Rac1 and Rac3 have been implicated
          in the regulation of cell migration and invasion in
          human metastatic breast cancer. Most Rho proteins
          contain a lipid modification site at the C-terminus,
          with a typical sequence motif CaaX, where a = an
          aliphatic amino acid and X = any amino acid. Lipid
          binding is essential for membrane attachment, a key
          feature of most Rho proteins. Due to the presence of
          truncated sequences in this CD, the lipid modification
          site is not available for annotation.
          Length = 174

 Score = 27.9 bits (62), Expect = 0.36
 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          G +C    YT + F  +Y PT   ++   ++ +  + V L LWD  G+
Sbjct: 13 GKTCLLISYTTNAFPGEYIPTVFDNYSANVM-VDGKPVNLGLWDTAGQ 59


>gnl|CDD|197554 smart00174, RHO, Rho (Ras homology) subfamily of Ras-like small
          GTPases.  Members of this subfamily of Ras-like small
          GTPases include Cdc42 and Rac, as well as Rho isoforms.
          Length = 174

 Score = 28.0 bits (63), Expect = 0.37
 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          G +C    YT + F   Y PT   + +   + +  + V+L LWD  G
Sbjct: 10 GKTCLLIVYTTNAFPEDYVPTVF-ENYSADVEVDGKPVELGLWDTAG 55


>gnl|CDD|206724 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl10) GTPases.
          Arl10-like subfamily. Arl9/Arl10 was identified from a
          human cancer-derived EST dataset. No functional
          information about the subfamily is available at the
          current time, but crystal structures of human Arl10b
          and Arl10c have been solved.
          Length = 159

 Score = 27.7 bits (62), Expect = 0.40
 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 4/36 (11%)

Query: 23 DEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
           +F+    PT G  F+++ +T  N  V + +WD+GG
Sbjct: 22 GQFSEDTIPTVG--FNMRKVTKGN--VTIKVWDLGG 53


>gnl|CDD|216465 pfam01379, Porphobil_deam, Porphobilinogen deaminase,
          dipyromethane cofactor binding domain. 
          Length = 213

 Score = 27.6 bits (62), Expect = 0.44
 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 3/43 (6%)

Query: 21 TQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLI---LWDIGGKA 60
           Q E+ ++      PD   +++TI+  G K++   L  IGGK 
Sbjct: 14 IQAEYVKEKLKKLYPDIEFEIVTIKTTGDKILDKPLAKIGGKG 56


>gnl|CDD|129331 TIGR00228, ruvC, crossover junction endodeoxyribonuclease RuvC.
          Endonuclease that resolves Holliday junction
          intermediates in genetic recombination. The active form
          of the protein is a dimer. Structure studies reveals
          that the catalytic center, comprised of four acidic
          residues, lies at the bottom of a cleft that fits a DNA
          duplex. The model hits a single Synechocystis PCC6803
          protein at a score of 30, below the trusted cutoff,
          that appears orthologous and may act as authentic RuvC
          [DNA metabolism, DNA replication, recombination, and
          repair].
          Length = 156

 Score = 27.6 bits (61), Expect = 0.45
 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 3/52 (5%)

Query: 3  PLYIKVLTEGTSCFSTRYTQDEFT-RQYYPTSGPDFHLKLLTIQNRGVKLIL 53
          P  +K++  G +   T++  + F   Q +     D  LKL   Q RGV ++ 
Sbjct: 39 PSRLKLIYAGVTEIITQFQPNYFAIEQVFMAKNADSALKL--GQARGVAIVA 88


>gnl|CDD|206720 cd04154, Arl2, Arf-like 2 (Arl2) GTPase.  Arl2 (Arf-like 2)
          GTPases are members of the Arf family that bind GDP and
          GTP with very low affinity. Unlike most Arf family
          proteins, Arl2 is not myristoylated at its N-terminal
          helix. The protein PDE-delta, first identified in
          photoreceptor rod cells, binds specifically to Arl2 and
          is structurally very similar to RhoGDI. Despite the
          high structural similarity between Arl2 and Rho
          proteins and between PDE-delta and RhoGDI, the
          interactions between the GTPases and their effectors
          are very different. In its GTP bound form, Arl2
          interacts with the protein Binder of Arl2 (BART), and
          the complex is believed to play a role in mitochondrial
          adenine nucleotide transport. In its GDP bound form,
          Arl2 interacts with tubulin- folding Cofactor D; this
          interaction is believed to play a role in regulation of
          microtubule dynamics that impact the cytoskeleton, cell
          division, and cytokinesis.
          Length = 173

 Score = 27.3 bits (61), Expect = 0.67
 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 4/29 (13%)

Query: 31 PTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          PT G  F++K  T++  G KL +WD+GG+
Sbjct: 44 PTLG--FNIK--TLEYNGYKLNIWDVGGQ 68


>gnl|CDD|219856 pfam08477, Miro, Miro-like protein.  Mitochondrial Rho proteins
          (Miro-1, and Miro-2), are atypical Rho GTPases. They
          have a unique domain organisation, with tandem
          GTP-binding domains and two EF hand domains
          (pfam00036), that may bind calcium. They are also
          larger than classical small GTPases. It has been
          proposed that they are involved in mitochondrial
          homeostasis and apoptosis.
          Length = 116

 Score = 26.6 bits (59), Expect = 0.93
 Identities = 11/47 (23%), Positives = 17/47 (36%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          G S   ++    EF  +     G    +  L +      L +WD GG
Sbjct: 11 GKSSLLSQLVGGEFPPEPLEIQGDTLAVDTLEVDGDTGLLNIWDFGG 57


>gnl|CDD|206709 cd04137, RheB, Ras Homolog Enriched in Brain (RheB) is a small
          GTPase.  Rheb (Ras Homolog Enriched in Brain)
          subfamily. Rheb was initially identified in rat brain,
          where its expression is elevated by seizures or by
          long-term potentiation. It is expressed ubiquitously,
          with elevated levels in muscle and brain. Rheb
          functions as an important mediator between the tuberous
          sclerosis complex proteins, TSC1 and TSC2, and the
          mammalian target of rapamycin (TOR) kinase to stimulate
          cell growth. TOR kinase regulates cell growth by
          controlling nutrient availability, growth factors, and
          the energy status of the cell. TSC1 and TSC2 form a
          dimeric complex that has tumor suppressor activity, and
          TSC2 is a GTPase activating protein (GAP) for Rheb. The
          TSC1/TSC2 complex inhibits the activation of TOR kinase
          through Rheb. Rheb has also been shown to induce the
          formation of large cytoplasmic vacuoles in a process
          that is dependent on the GTPase cycle of Rheb, but
          independent of the TOR kinase, suggesting Rheb plays a
          role in endocytic trafficking that leads to cell growth
          and cell-cycle progression. Most Ras proteins contain a
          lipid modification site at the C-terminus, with a
          typical sequence motif CaaX, where a = an aliphatic
          amino acid and X = any amino acid. Lipid binding is
          essential for membrane attachment, a key feature of
          most Ras proteins.
          Length = 180

 Score = 26.8 bits (60), Expect = 0.94
 Identities = 10/42 (23%), Positives = 19/42 (45%), Gaps = 11/42 (26%)

Query: 12 GTSCFSTRYTQDEFTRQYYPT-----------SGPDFHLKLL 42
          G S  + ++ +  F   YYPT            G ++HL+++
Sbjct: 13 GKSSLTVQFVEGHFVESYYPTIENTFSKIITYKGQEYHLEIV 54


>gnl|CDD|206707 cd04135, Tc10, Rho GTPase TC10 (Tc10).  TC10 is a Rho family
          protein that has been shown to induce microspike
          formation and neurite outgrowth in vitro. Its
          expression changes dramatically after peripheral nerve
          injury, suggesting an important role in promoting
          axonal outgrowth and regeneration. TC10 regulates
          translocation of insulin-stimulated GLUT4 in adipocytes
          and has also been shown to bind directly to Golgi COPI
          coat proteins. GTP-bound TC10 in vitro can bind
          numerous potential effectors. Depending on its
          subcellular localization and distinct functional
          domains, TC10 can differentially regulate two types of
          filamentous actin in adipocytes. TC10 mRNAs are highly
          expressed in three types of mouse muscle tissues: leg
          skeletal muscle, cardiac muscle, and uterus; they were
          also present in brain, with higher levels in adults
          than in newborns. TC10 has also been shown to play a
          role in regulating the expression of cystic fibrosis
          transmembrane conductance regulator (CFTR) through
          interactions with CFTR-associated ligand (CAL). The
          GTP-bound form of TC10 directs the trafficking of CFTR
          from the juxtanuclear region to the secretory pathway
          toward the plasma membrane, away from CAL-mediated DFTR
          degradation in the lysosome. Most Rho proteins contain
          a lipid modification site at the C-terminus, with a
          typical sequence motif CaaX, where a = an aliphatic
          amino acid and X = any amino acid. Lipid binding is
          essential for membrane attachment, a key feature of
          most Rho proteins. Due to the presence of truncated
          sequences in this CD, the lipid modification site is
          not available for annotation.
          Length = 174

 Score = 26.1 bits (57), Expect = 1.7
 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 1/50 (2%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGKAN 61
          G +C    Y  D F  +Y PT   D +   +T+  +   L L+D  G+ +
Sbjct: 12 GKTCLLMSYANDAFPEEYVPTVF-DHYAVSVTVGGKQYLLGLYDTAGQED 60


>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Protein Kinase B beta.
           Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
           or Akt subfamily, beta (or Akt2) isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           PKB isoforms from different genes, PKB-alpha (or Akt1),
           PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. PKB-beta is the
           predominant PKB isoform expressed in insulin-responsive
           tissues. It plays a critical role in the regulation of
           glucose homeostasis. It is also implicated in muscle
           cell differentiation. Mice deficient in PKB-beta display
           normal growth weights but exhibit severe insulin
           resistance and diabetes, accompanied by lipoatrophy and
           B-cell failure.
          Length = 323

 Score = 26.1 bits (57), Expect = 2.1
 Identities = 12/24 (50%), Positives = 13/24 (54%)

Query: 13  TSCFSTRYTQDEFTRQYYPTSGPD 36
           TS   TRY  DEFT Q    + PD
Sbjct: 276 TSEVDTRYFDDEFTAQSITITPPD 299


>gnl|CDD|217946 pfam04183, IucA_IucC, IucA / IucC family.  IucA and IucC catalyze
           discrete steps in biosynthesis of the siderophore
           aerobactin from N epsilon-acetyl-N epsilon-hydroxylysine
           and citrate. This family represents the N-terminal
           region. The C-terminal region appears to be related to
           iron transporter proteins.
          Length = 241

 Score = 26.0 bits (58), Expect = 2.1
 Identities = 13/41 (31%), Positives = 18/41 (43%), Gaps = 14/41 (34%)

Query: 24  EFTRQYYPTS---------GPDFHLKL-LTIQN----RGVK 50
           E    Y PTS          P+ HLKL L+++N    R + 
Sbjct: 121 EGGDAYLPTSSVRTLYNPDAPEPHLKLSLSVRNTNSVRTLS 161


>gnl|CDD|236416 PRK09222, PRK09222, isocitrate dehydrogenase; Validated.
          Length = 482

 Score = 25.2 bits (56), Expect = 3.4
 Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 2/31 (6%)

Query: 21  TQDEFTRQYYPTSGPDFHLKLLTIQNRGVKL 51
             +E   +    +  +  LK+  I NRG+K+
Sbjct: 388 DANELAAKLEKLALGNLKLKM--ISNRGLKV 416


>gnl|CDD|215463 PLN02858, PLN02858, fructose-bisphosphate aldolase.
          Length = 1378

 Score = 25.6 bits (56), Expect = 3.4
 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 5/29 (17%)

Query: 30   YPTSGPDFHLKLL-----TIQNRGVKLIL 53
            YP SGP+  L LL         +GV L+L
Sbjct: 1278 YPASGPNLRLDLLKELRALSSKKGVLLVL 1306


>gnl|CDD|206705 cd04133, Rop_like, Rho-related protein from plants (Rop)-like.
          The Rop (Rho-related protein from plants) subfamily
          plays a role in diverse cellular processes, including
          cytoskeletal organization, pollen and vegetative cell
          growth, hormone responses, stress responses, and
          pathogen resistance. Rops are able to regulate several
          downstream pathways to amplify a specific signal by
          acting as master switches early in the signaling
          cascade. They transmit a variety of extracellular and
          intracellular signals. Rops are involved in
          establishing cell polarity in root-hair development,
          root-hair elongation, pollen-tube growth, cell-shape
          formation, responses to hormones such as abscisic acid
          (ABA) and auxin, responses to abiotic stresses such as
          oxygen deprivation, and disease resistance and disease
          susceptibility. An individual Rop can have a unique
          function or an overlapping function shared with other
          Rop proteins; in addition, a given Rop-regulated
          function can be controlled by one or multiple Rop
          proteins. For example, Rop1, Rop3, and Rop5 are all
          involved in pollen-tube growth; Rop2 plays a role in
          response to low-oxygen environments, cell-morphology,
          and root-hair development; root-hair development is
          also regulated by Rop4 and Rop6; Rop6 is also
          responsible for ABA response, and ABA response is also
          regulated by Rop10. Plants retain some of the
          regulatory mechanisms that are shared by other members
          of the Rho family, but have also developed a number of
          unique modes for regulating Rops. Unique RhoGEFs have
          been identified that are exclusively active toward Rop
          proteins, such as those containing the domain PRONE
          (plant-specific Rop nucleotide exchanger). Most Rho
          proteins contain a lipid modification site at the
          C-terminus, with a typical sequence motif CaaX, where a
          = an aliphatic amino acid and X = any amino acid. Lipid
          binding is essential for membrane attachment, a key
          feature of most Rho proteins. Due to the presence of
          truncated sequences in this CD, the lipid modification
          site is not available for annotation.
          Length = 173

 Score = 25.2 bits (55), Expect = 3.7
 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 1/48 (2%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          G +C    YT + F   Y PT   +F    + +    V L LWD  G+
Sbjct: 13 GKTCMLISYTSNTFPTDYVPTVFDNFSAN-VVVDGNTVNLGLWDTAGQ 59


>gnl|CDD|133321 cd04121, Rab40, Rab GTPase family 40 (Rab40) contains Rab40a,
          Rab40b and Rab40c.  The Rab40 subfamily contains
          Rab40a, Rab40b, and Rab40c, which are all highly
          homologous. In rat, Rab40c is localized to the
          perinuclear recycling compartment (PRC), and is
          distributed in a tissue-specific manor, with high
          expression in brain, heart, kidney, and testis, low
          expression in lung and liver, and no expression in
          spleen and skeletal muscle. Rab40c is highly expressed
          in differentiated oligodendrocytes but minimally
          expressed in oligodendrocyte progenitors, suggesting a
          role in the vesicular transport of myelin components.
          Unlike most other Ras-superfamily proteins, Rab40c was
          shown to have a much lower affinity for GTP, and an
          affinity for GDP that is lower than for GTP. GTPase
          activating proteins (GAPs) interact with GTP-bound Rab
          and accelerate the hydrolysis of GTP to GDP. Guanine
          nucleotide exchange factors (GEFs) interact with
          GDP-bound Rabs to promote the formation of the
          GTP-bound state. Rabs are further regulated by guanine
          nucleotide dissociation inhibitors (GDIs), which
          facilitate Rab recycling by masking C-terminal lipid
          binding and promoting cytosolic localization. Most Rab
          GTPases contain a lipid modification site at the
          C-terminus, with sequence motifs CC, CXC, or CCX. Lipid
          binding is essential for membrane attachment, a key
          feature of most Rab proteins.
          Length = 189

 Score = 24.9 bits (54), Expect = 4.1
 Identities = 11/31 (35%), Positives = 15/31 (48%)

Query: 29 YYPTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          Y    G D+    + +  R VKL LWD  G+
Sbjct: 35 YGYNMGIDYKTTTILLDGRRVKLQLWDTSGQ 65


>gnl|CDD|206708 cd04136, Rap_like, Rap-like family consists of Rap1, Rap2 and
          RSR1.  The Rap subfamily consists of the Rap1, Rap2,
          and RSR1. Rap subfamily proteins perform different
          cellular functions, depending on the isoform and its
          subcellular localization. For example, in rat salivary
          gland, neutrophils, and platelets, Rap1 localizes to
          secretory granules and is believed to regulate
          exocytosis or the formation of secretory granules. Rap1
          has also been shown to localize in the Golgi of rat
          fibroblasts, zymogen granules, plasma membrane, and
          microsomal membrane of the pancreatic acini, as well as
          in the endocytic compartment of skeletal muscle cells
          and fibroblasts. Rap1 localizes in the nucleus of human
          oropharyngeal squamous cell carcinomas (SCCs) and cell
          lines. Rap1 plays a role in phagocytosis by controlling
          the binding of adhesion receptors (typically integrins)
          to their ligands. In yeast, Rap1 has been implicated in
          multiple functions, including activation and silencing
          of transcription and maintenance of telomeres. Rap2 is
          involved in multiple functions, including activation of
          c-Jun N-terminal kinase (JNK) to regulate the actin
          cytoskeleton and activation of the Wnt/beta-catenin
          signaling pathway in embryonic Xenopus. A number of
          effector proteins for Rap2 have been identified,
          including isoform 3 of the human mitogen-activated
          protein kinase kinase kinase kinase 4 (MAP4K4) and
          Traf2- and Nck-interacting kinase (TNIK), and the
          RalGEFs RalGDS, RGL, and Rlf, which also interact with
          Rap1 and Ras. RSR1 is the fungal homolog of Rap1 and
          Rap2. In budding yeasts, it is involved in selecting a
          site for bud growth, which directs the establishment of
          cell polarization. The Rho family GTPase Cdc42 and its
          GEF, Cdc24, then establish an axis of polarized growth.
          It is believed that Cdc42 interacts directly with RSR1
          in vivo. In filamentous fungi such as Ashbya gossypii,
          RSR1 is a key regulator of polar growth in the hypha.
          Most Ras proteins contain a lipid modification site at
          the C-terminus, with a typical sequence motif CaaX,
          where a = an aliphatic amino acid and X = any amino
          acid. Lipid binding is essential for membrane
          attachment, a key feature of most Ras proteins. Due to
          the presence of truncated sequences in this CD, the
          lipid modification site is not available for
          annotation.
          Length = 164

 Score = 24.8 bits (54), Expect = 4.2
 Identities = 12/49 (24%), Positives = 21/49 (42%), Gaps = 1/49 (2%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGKA 60
          G S  + ++ Q  F  +Y PT   D + K + +  +   L + D  G  
Sbjct: 13 GKSALTVQFVQGIFVDKYDPTI-EDSYRKQIEVDCQQCMLEILDTAGTE 60


>gnl|CDD|238915 cd01940, Fructoselysine_kinase_like, Fructoselysine kinase-like.
           Fructoselysine is a fructoseamine formed by glycation, a
           non-enzymatic reaction of glucose with a primary amine
           followed by an Amadori rearrangement, resulting in a
           protein that is modified at the amino terminus and at
           the lysine side chains. Fructoseamines are typically
           metabolized by fructoseamine-3-kinase, especially in
           higher eukaryotes. In E. coli, fructoselysine kinase has
           been shown in vitro to catalyze the phosphorylation of
           fructoselysine. It is proposed that fructoselysine is
           released from glycated proteins during human digestion
           and is partly metabolized by bacteria in the hind gut
           using a protein such as fructoselysine kinase.  This
           family is found only in bacterial sequences, and its
           oligomeric state is currently unknown.
          Length = 264

 Score = 25.0 bits (55), Expect = 4.3
 Identities = 14/61 (22%), Positives = 20/61 (32%), Gaps = 10/61 (16%)

Query: 16  FSTRYTQDEFTR-----QYYPTSGPDF-----HLKLLTIQNRGVKLILWDIGGKANESSA 65
           FS R+  D          +   S  D        KL    +RG KL++   G     +  
Sbjct: 145 FSDRWDDDYLQLVCPYVDFAFFSASDLSDEEVKAKLKEAVSRGAKLVIVTRGEDGAIAYD 204

Query: 66  G 66
           G
Sbjct: 205 G 205


>gnl|CDD|206710 cd04139, RalA_RalB, Ral (Ras-like) family containing highly
          homologous RalA and RalB.  The Ral (Ras-like) subfamily
          consists of the highly homologous RalA and RalB. Ral
          proteins are believed to play a crucial role in
          tumorigenesis, metastasis, endocytosis, and actin
          cytoskeleton dynamics. Despite their high sequence
          similarity (>80% sequence identity), nonoverlapping and
          opposing functions have been assigned to RalA and RalBs
          in tumor migration. In human bladder and prostate
          cancer cells, RalB promotes migration while RalA
          inhibits it. A Ral-specific set of GEFs has been
          identified that are activated by Ras binding. This
          RalGEF activity is enhanced by Ras binding to another
          of its target proteins, phosphatidylinositol 3-kinase
          (PI3K). Ral effectors include RLIP76/RalBP1, a
          Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a
          heterooctomeric protein complex that is involved in
          tethering vesicles to specific sites on the plasma
          membrane prior to exocytosis. In rat kidney cells, RalB
          is required for functional assembly of the exocyst and
          for localizing the exocyst to the leading edge of
          migrating cells. In human cancer cells, RalA is
          required to support anchorage-independent proliferation
          and RalB is required to suppress apoptosis. RalA has
          been shown to localize to the plasma membrane while
          RalB is localized to the intracellular vesicles. Most
          Ras proteins contain a lipid modification site at the
          C-terminus, with a typical sequence motif CaaX, where a
          = an aliphatic amino acid and X = any amino acid. Lipid
          binding is essential for membrane attachment, a key
          feature of most Ras proteins. Due to the presence of
          truncated sequences in this CD, the lipid modification
          site is not available for annotation.
          Length = 163

 Score = 25.1 bits (55), Expect = 4.4
 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 3/63 (4%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGGKANESSAGLVKTY 71
          G S  + ++  DEF   Y PT   D + K + +    V+L + D  G+  E  A +   Y
Sbjct: 12 GKSALTLQFMYDEFVEDYEPTKA-DSYRKKVVLDGEEVQLNILDTAGQ--EDYAAIRDNY 68

Query: 72 LSS 74
            S
Sbjct: 69 FRS 71


>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain.  Proteins
          with a small GTP-binding domain recognized by this
          model include Ras, RhoA, Rab11, translation elongation
          factor G, translation initiation factor IF-2,
          tetratcycline resistance protein TetM, CDC42, Era,
          ADP-ribosylation factors, tdhF, and many others. In
          some proteins the domain occurs more than once.This
          model recognizes a large number of small GTP-binding
          proteins and related domains in larger proteins. Note
          that the alpha chains of heterotrimeric G proteins are
          larger proteins in which the NKXD motif is separated
          from the GxxxxGK[ST] motif (P-loop) by a long insert
          and are not easily detected by this model [Unknown
          function, General].
          Length = 162

 Score = 24.6 bits (54), Expect = 4.7
 Identities = 9/48 (18%), Positives = 18/48 (37%), Gaps = 1/48 (2%)

Query: 12 GTSCFSTRYTQDE-FTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          G S    R   ++    +Y P +  ++   ++    +  K  L D  G
Sbjct: 13 GKSTLLNRLLGNKISITEYKPGTTRNYVTTVIEEDGKTYKFNLLDTAG 60


>gnl|CDD|206725 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1).  Arfrp1
          (Arf-related protein 1), formerly known as ARP, is a
          membrane-associated Arf family member that lacks the
          N-terminal myristoylation motif. Arfrp1 is mainly
          associated with the trans-Golgi compartment and the
          trans-Golgi network, where it regulates the targeting
          of Arl1 and the GRIP domain-containing proteins,
          golgin-97 and golgin-245, onto Golgi membranes. It is
          also involved in the anterograde transport of the
          vesicular stomatitis virus G protein from the Golgi to
          the plasma membrane, and in the retrograde transport of
          TGN38 and Shiga toxin from endosomes to the trans-Golgi
          network. Arfrp1 also inhibits Arf/Sec7-dependent
          activation of phospholipase D. Deletion of Arfrp1 in
          mice causes embryonic lethality at the gastrulation
          stage and apoptosis of mesodermal cells, indicating its
          importance in development.
          Length = 168

 Score = 24.6 bits (54), Expect = 5.8
 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 4/29 (13%)

Query: 31 PTSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          PT G    L + TI+    +L+ WD+GG+
Sbjct: 37 PTVG----LNIGTIEVGKARLMFWDLGGQ 61


>gnl|CDD|214541 smart00173, RAS, Ras subfamily of RAS small GTPases.  Similar in
          fold and function to the bacterial EF-Tu GTPase. p21Ras
          couples receptor Tyr kinases and G protein receptors to
          protein kinase cascades.
          Length = 164

 Score = 24.4 bits (54), Expect = 5.8
 Identities = 13/47 (27%), Positives = 19/47 (40%), Gaps = 1/47 (2%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          G S  + ++ Q  F   Y PT   D + K + I      L + D  G
Sbjct: 12 GKSALTIQFIQGHFVDDYDPTI-EDSYRKQIEIDGEVCLLDILDTAG 57


>gnl|CDD|226284 COG3761, COG3761, NADH:ubiquinone oxidoreductase 17.2 kD subunit
          [Energy production and conversion].
          Length = 118

 Score = 24.5 bits (53), Expect = 5.9
 Identities = 7/21 (33%), Positives = 9/21 (42%)

Query: 16 FSTRYTQDEFTRQYYPTSGPD 36
          F  +  +DEF   YY     D
Sbjct: 12 FHKKVGEDEFGNVYYEGRNID 32


>gnl|CDD|206704 cd04132, Rho4_like, Ras homology family 4 (Rho4) of small
          guanosine triphosphatases (GTPases)-like.  Rho4 is a
          GTPase that controls septum degradation by regulating
          secretion of Eng1 or Agn1 during cytokinesis. Rho4 also
          plays a role in cell morphogenesis. Rho4 regulates
          septation and cell morphology by controlling the actin
          cytoskeleton and cytoplasmic microtubules. The
          localization of Rho4 is modulated by Rdi1, which may
          function as a GDI, and by Rga9, which is believed to
          function as a GAP. In S. pombe, both Rho4 deletion and
          Rho4 overexpression result in a defective cell wall,
          suggesting a role for Rho4 in maintaining cell wall
          integrity. Most Rho proteins contain a lipid
          modification site at the C-terminus, with a typical
          sequence motif CaaX, where a = an aliphatic amino acid
          and X = any amino acid. Lipid binding is essential for
          membrane attachment, a key feature of most Rho
          proteins.
          Length = 197

 Score = 24.6 bits (54), Expect = 6.3
 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 6/50 (12%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQ---NRGVKLILWDIGG 58
          G +C    Y Q  F  +Y PT    F   + T+Q    + ++L LWD  G
Sbjct: 15 GKTCLLMVYAQGSFPEEYVPTV---FENYVTTLQVPNGKIIELALWDTAG 61


>gnl|CDD|221790 pfam12819, Malectin_like, Carbohydrate-binding protein of the ER.
           Malectin is a membrane-anchored protein of the
           endoplasmic reticulum that recognises and binds
           Glc2-N-glycan. The domain is found on a number of plant
           receptor kinases.
          Length = 335

 Score = 24.6 bits (54), Expect = 6.8
 Identities = 8/35 (22%), Positives = 14/35 (40%)

Query: 12  GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQN 46
           G S  + RY  D + R + P        ++ T  +
Sbjct: 178 GGSEGTIRYPDDVYDRIWEPFFSSPGWSQISTSLS 212


>gnl|CDD|128474 smart00177, ARF, ARF-like small GTPases; ARF, ADP-ribosylation
          factor.  Ras homologues involved in vesicular
          transport. Activator of phospholipase D isoforms.
          Unlike Ras proteins they lack cysteine residues at
          their C-termini and therefore are unlikely to be
          prenylated. ARFs are N-terminally myristoylated.
          Contains ATP/GTP-binding motif (P-loop).
          Length = 175

 Score = 24.5 bits (53), Expect = 6.9
 Identities = 7/28 (25%), Positives = 15/28 (53%)

Query: 32 TSGPDFHLKLLTIQNRGVKLILWDIGGK 59
          T+ P     + T+  + +   +WD+GG+
Sbjct: 40 TTIPTIGFNVETVTYKNISFTVWDVGGQ 67


>gnl|CDD|197466 smart00010, small_GTPase, Small GTPase of the Ras superfamily;
          ill-defined subfamily.  SMART predicts Ras-like small
          GTPases of the ARF, RAB, RAN, RAS, and SAR subfamilies.
          Others that could not be classified in this way are
          predicted to be members of the small GTPase superfamily
          without predictions of the subfamily.
          Length = 166

 Score = 24.4 bits (54), Expect = 7.3
 Identities = 13/47 (27%), Positives = 20/47 (42%), Gaps = 1/47 (2%)

Query: 12 GTSCFSTRYTQDEFTRQYYPTSGPDFHLKLLTIQNRGVKLILWDIGG 58
          G S  + ++ Q  F  +Y PT   D + K + I      L + D  G
Sbjct: 14 GKSALTIQFVQGHFVDEYDPTI-EDSYRKQIEIDGEVCLLDILDTAG 59


>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid
          dehydrogenase XI-like, classical (c) SDRs.
          17-beta-hydroxysteroid dehydrogenases (17betaHSD) are a
          group of isozymes that catalyze activation and
          inactivation of estrogen and androgens. 17betaHSD type
          XI, a classical SDR, preferentially converts
          3alpha-adiol to androsterone but not numerous other
          tested steroids. This subgroup of classical SDRs also
          includes members identified as retinol dehydrogenases,
          which convert retinol to retinal, a property that
          overlaps with 17betaHSD activity. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet), an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Classical SDRs
          are typically about 250 residues long, while extended
          SDRS are approximately 350 residues. Sequence identity
          between different SDR enzymes are typically in the
          15-30% range, but the enzymes share the Rossmann fold
          NAD-binding motif and characteristic NAD-binding and
          catalytic sequence patterns. These enzymes have a
          3-glycine N-terminal NAD(P)(H)-binding pattern
          (typically, TGxxxGxG in classical SDRs and TGxxGxxG in
          extended SDRs), while substrate binding is in the
          C-terminal region. A critical catalytic Tyr residue
          (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase
          (15-PGDH) numbering), is often found in a conserved
          YXXXK pattern. In addition to the Tyr and Lys, there is
          often an upstream Ser (Ser-138, 15-PGDH numbering)
          and/or an Asn (Asn-107, 15-PGDH numbering) or
          additional Ser, contributing to the active site.
          Substrates for these enzymes include sugars, steroids,
          alcohols, and aromatic compounds. The standard reaction
          mechanism is a proton relay involving the conserved Tyr
          and Lys, as well as Asn (or Ser). Some SDR family
          members, including 17 beta-hydroxysteroid dehydrogenase
          contain an additional helix-turn-helix motif that is
          not generally found among SDRs.
          Length = 243

 Score = 24.1 bits (53), Expect = 8.1
 Identities = 9/23 (39%), Positives = 14/23 (60%)

Query: 47 RGVKLILWDIGGKANESSAGLVK 69
          RG K+++ DI  K  E +A  V+
Sbjct: 22 RGAKVVILDINEKGAEETANNVR 44


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.317    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0591    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,596,016
Number of extensions: 255724
Number of successful extensions: 276
Number of sequences better than 10.0: 1
Number of HSP's gapped: 269
Number of HSP's successfully gapped: 80
Length of query: 78
Length of database: 10,937,602
Length adjustment: 47
Effective length of query: 31
Effective length of database: 8,852,964
Effective search space: 274441884
Effective search space used: 274441884
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (24.5 bits)