Diaphorina citri psyllid: psy2603


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MEEWKTKPGRLPKIPIPYPFEYGSKESSTQNERTNQNARTPCLLFVVSQHGHRRAHAPPFQLRANGPNSGPPLDPGEHRVLGVHYFNTLPYFLLFPGFLNTNTDVHMRLPSNYGLMDQIAALHWIQENIGYFNGDPSNVTLVGHGTGAACVNFLMISPAVPDGLIKGIRNNCSGPIVP
cccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccCECcccccccccccccccccccccEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccEEEEEccHHHHHHHHHHHcccccccHHHHHHccccccccc
********GRLPKIPIPYPFEYGSKESSTQNERTNQNARTPCLLFVVSQHGHRRAHAPPFQLRANGPNSGPPLDPGEHRVLGVHYFNTLPYFLLFPGFLNTNTDVHMRLPSNYGLMDQIAALHWIQENIGYFNGDPSNVTLVGHGTGAACVNFLMISPAVPDGLIKGIRNNCSGPIVP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEWKTKPGRLPKIPIPYPFEYGSKESSTQNERTNQNARTPCLLFVVSQHGHRRAHAPPFQLRANGPNSGPPLDPGEHRVLGVHYFNTLPYFLLFPGFLNTNTDVHMRLPSNYGLMDQIAALHWIQENIGYFNGDPSNVTLVGHGTGAACVNFLMISPAVPDGLIKGIRNNCSGPIVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016788 [MF]hydrolase activity, acting on ester bondsprobableGO:0016787, GO:0003674, GO:0003824
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0005576 [CC]extracellular regionprobableGO:0005575
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OGT, chain A
Confidence level:very confident
Coverage over the Query: 23-176
View the alignment between query and template
View the model in PyMOL
Template: 3BIW, chain A
Confidence level:probable
Coverage over the Query: 9-166
View the alignment between query and template
View the model in PyMOL