Diaphorina citri psyllid: psy2609


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MLCMVSSYMDSRKDEQERGITMKSSSISLYYKDNKDTPEEYLINLIDSPGHVDFSSEVSTAVRLCDGTIIVVDCVEGICAQTQVALKQAWLEKIQPILVLNKIDRLILEMKLSPLDIYVHLSQLLEQVNAVMGELFASQVMDETAVKTTAQDNETKQTSRF
cccccccccccHHHHHHccccEEccEEEEEECccccccccEEEEcccccccccccHHHHHHHHHHccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccccccccc
****VSSYMDSRKDEQERGITMKSSSISLYYKDNKDTPEEYLINLIDSPGHVDFSSEVSTAVRLCDGTIIVVDCVEGICAQTQVALKQAWLEKIQPILVLNKIDRLILEMKLSPLDIYVHLSQLLEQVNAVMGELFASQVM********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLCMVSSYMDSRKDEQERGITMKSSSISLYYKDNKDTPEEYLINLIDSPGHVDFSSEVSTAVRLCDGTIIVVDCVEGICAQTQVALKQAWLEKIQPILVLNKIDRLILEMKLSPLDIYVHLSQLLEQVNAVMGELFASQVMDETAVKTTAQDNETKQTSRF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribosome assembly protein 1 GTPase involved in the biogenesis of the 60S ribosomal subunit and translational activation of ribosomes. Together with sdo1, may trigger the GTP-dependent release of tif6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating tif6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. Inhibits GTPase activity of ribosome-bound EF-2.confidentO74945
Elongation factor Tu GTP-binding domain-containing protein 1 Involved in the biogenesis of the 60S ribosomal subunit and translational activation of ribosomes. Together with SBDS, triggers the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating EIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. Has low intrinsic GTPase activity. GTPase activity is increased by contact with 60S ribosome subunits.confidentQ8C0D5
Ribosome assembly protein 1 GTPase involved in the biogenesis of the 60S ribosomal subunit and translational activation of ribosomes. Together with SDO1, may trigger the GTP-dependent release of TIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating TIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. Inhibits GTPase activity of ribosome-bound EF-2.confidentP53893

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0042256 [BP]mature ribosome assemblyprobableGO:0006996, GO:0071826, GO:0022607, GO:0043933, GO:0009987, GO:0042255, GO:0042254, GO:0016043, GO:0065003, GO:0022618, GO:0044763, GO:0071840, GO:0034622, GO:0022613, GO:0008150, GO:0070925, GO:0044699, GO:0044085
GO:0043022 [MF]ribosome bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0006414 [BP]translational elongationprobableGO:0071704, GO:0044267, GO:0044238, GO:0008152, GO:0044260, GO:1901576, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:0006412
GO:0005681 [CC]spliceosomal complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003746 [MF]translation elongation factor activityprobableGO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0006184 [BP]GTP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043167 [MF]ion bindingprobableGO:0003674, GO:0005488
GO:0005844 [CC]polysomeprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CB4, chain D
Confidence level:very confident
Coverage over the Query: 25-109
View the alignment between query and template
View the model in PyMOL
Template: 1N0U, chain A
Confidence level:very confident
Coverage over the Query: 4-132
View the alignment between query and template
View the model in PyMOL