Query         psy2610
Match_columns 133
No_of_seqs    121 out of 680
Neff          4.9 
Searched_HMMs 46136
Date          Fri Aug 16 20:37:21 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2610.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2610hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0469|consensus              100.0 6.9E-30 1.5E-34  227.1   5.3  101   33-133   190-293 (842)
  2 KOG0468|consensus               99.9   4E-26 8.7E-31  207.1   7.5   92   41-132   295-387 (971)
  3 KOG0467|consensus               99.9 3.4E-24 7.3E-29  195.8   5.5   93   39-131   181-273 (887)
  4 PLN00116 translation elongatio  99.8 3.5E-19 7.6E-24  164.3   9.4   91   41-131   198-289 (843)
  5 PTZ00416 elongation factor 2;   99.7 1.3E-17 2.9E-22  153.8   8.3   89   42-130   193-284 (836)
  6 cd01885 EF2 EF2 (for archaea a  99.1 4.8E-11   1E-15   95.4   2.6   34   40-73    177-210 (222)
  7 cd04167 Snu114p Snu114p subfam  98.3 3.9E-07 8.4E-12   70.7   3.3   32   42-73    170-201 (213)
  8 PRK07560 elongation factor EF-  95.0   0.027 5.9E-07   52.1   4.1   30   42-71    189-218 (731)
  9 TIGR00490 aEF-2 translation el  94.2   0.019   4E-07   53.1   1.0   30   41-70    187-216 (720)
 10 cd01639 IMPase IMPase, inosito  56.6     8.6 0.00019   30.3   2.2   26   41-66     76-101 (244)
 11 PLN02553 inositol-phosphate ph  51.9      12 0.00025   30.2   2.2   26   41-66     86-111 (270)
 12 PRK10757 inositol monophosphat  51.7      12 0.00025   30.3   2.2   26   41-66     79-104 (267)
 13 cd01636 FIG FIG, FBPase/IMPase  50.9      13 0.00029   27.9   2.3   27   41-67     79-105 (184)
 14 cd01642 Arch_FBPase_2 Putative  49.1      16 0.00034   29.5   2.5   25   42-66     76-100 (244)
 15 cd01637 IMPase_like Inositol-m  48.2      13 0.00029   28.9   2.0   27   40-66     74-100 (238)
 16 PF00165 HTH_AraC:  Bacterial r  45.0      23  0.0005   20.5   2.2   25   60-84     17-41  (42)
 17 cd01643 Bacterial_IMPase_like_  41.7      21 0.00045   28.5   2.2   26   41-66     72-97  (242)
 18 TIGR02067 his_9_proposed histi  41.2      23 0.00049   28.2   2.3   26   41-66     75-100 (251)
 19 cd01517 PAP_phosphatase PAP-ph  40.1      18  0.0004   29.2   1.7   24   42-66     74-97  (274)
 20 cd00383 trans_reg_C Effector d  36.7      73  0.0016   20.7   4.0   49   42-92      5-57  (95)
 21 TIGR01843 type_I_hlyD type I s  35.3      36 0.00078   28.3   2.7   23  110-132   401-423 (423)
 22 COG1312 UxuA D-mannonate dehyd  34.3      44 0.00096   29.4   3.2   36   57-94    158-195 (362)
 23 PRK09685 DNA-binding transcrip  33.6      36 0.00077   27.2   2.4   27   60-86    273-300 (302)
 24 PF14056 DUF4250:  Domain of un  32.8      45 0.00098   21.7   2.3   27   74-100    28-55  (55)
 25 PLN02737 inositol monophosphat  32.4      29 0.00063   30.0   1.8   25   42-66    153-177 (363)
 26 PRK10931 adenosine-3'(2'),5'-b  32.3      17 0.00037   28.9   0.3   25   42-66     79-103 (246)
 27 PLN02911 inositol-phosphate ph  31.3      34 0.00074   28.3   1.9   25   42-66    111-135 (296)
 28 TIGR01331 bisphos_cysQ 3'(2'),  31.1      19 0.00042   28.6   0.4   25   42-66     78-102 (249)
 29 cd01638 CysQ CysQ, a 3'-Phosph  30.0      25 0.00054   27.8   0.9   26   41-66     75-100 (242)
 30 PRK12676 bifunctional inositol  29.6      42 0.00091   27.0   2.2   25   42-66     83-107 (263)
 31 COG0483 SuhB Archaeal fructose  29.2      21 0.00045   29.1   0.3   25   42-66     81-105 (260)
 32 PF13413 HTH_25:  Helix-turn-he  29.1      59  0.0013   21.0   2.4   19   65-83     44-62  (62)
 33 cd01641 Bacterial_IMPase_like_  28.7      49  0.0011   26.2   2.4   26   41-66     73-98  (248)
 34 cd07013 S14_ClpP Caseinolytic   27.8      57  0.0012   24.6   2.5   31   66-96    121-151 (162)
 35 PRK07080 hypothetical protein;  26.2 1.2E+02  0.0027   26.2   4.5   46   42-90    268-317 (317)
 36 cd01515 Arch_FBPase_1 Archaeal  25.6      31 0.00067   27.6   0.7   25   42-66     78-102 (257)
 37 PF15065 NCU-G1:  Lysosomal tra  25.1      99  0.0021   27.0   3.8   46    5-58     23-68  (350)
 38 KOG1785|consensus               24.6      33 0.00071   31.3   0.7   57    1-62    332-400 (563)
 39 PF00459 Inositol_P:  Inositol   24.2      17 0.00036   29.0  -1.1   26   41-66     85-110 (270)
 40 PHA02107 hypothetical protein   23.8      61  0.0013   26.2   2.1   50    1-50    115-169 (216)
 41 PRK10130 transcriptional regul  23.7      65  0.0014   27.5   2.4   28   55-82    312-340 (350)
 42 PRK10219 DNA-binding transcrip  22.7      86  0.0019   21.3   2.5   24   64-87     84-107 (107)
 43 PRK10572 DNA-binding transcrip  22.7      81  0.0018   25.1   2.6   28   60-87    257-285 (290)
 44 PF12833 HTH_18:  Helix-turn-he  22.7   1E+02  0.0022   19.7   2.7   23   64-86     59-81  (81)
 45 PF00574 CLP_protease:  Clp pro  21.6      81  0.0017   23.7   2.3   31   66-96    137-167 (182)
 46 PF12244 DUF3606:  Protein of u  20.9      91   0.002   20.0   2.1   18   70-87     24-41  (57)

No 1  
>KOG0469|consensus
Probab=99.96  E-value=6.9e-30  Score=227.11  Aligned_cols=101  Identities=31%  Similarity=0.635  Sum_probs=91.3

Q ss_pred             CccccCCCCCeeEecCCCceEeeecccceeeehhHHHHHHHhhcCCCHHHHHHhhhcccceecCCCcEecCCCc---CCC
Q psy2610          33 TGLEDADDSDLYFSPDRGNVVFASAFDGWGFTIDDFARLYSAKLGIREDILRKTLWGDYYLNAKAKRILKGAQE---KAK  109 (133)
Q Consensus        33 ~~~~~~~~~~~~fsP~~GNV~FaSal~GW~Ftl~~FA~~Y~~K~gi~~~~L~k~LWGD~Yyd~ktKk~~~~~~~---~~~  109 (133)
                      +++.+....+.++.|++|+|.||||||||+|||+|||++|++|||++..+|+++||||.|||+++|+|.++...   +..
T Consensus       190 sTy~d~~~g~~~v~P~kg~v~F~SGLhGWaFTlrQFa~~Y~~KF~~~~~kmm~~LWg~~~f~~ktkk~~~s~t~~~gn~~  269 (842)
T KOG0469|consen  190 STYGDGPMGDVQVDPEKGTVGFGSGLHGWAFTLRQFAEMYAKKFGIDVRKMMNRLWGDNFFNPKTKKWSKSATDAEGNPL  269 (842)
T ss_pred             EecccCCcCceEecCCCCceeeccccchhhhhHHHHHHHHHHHhCCcHHHHHHHhhcccccCccCCcccccccccccCcc
Confidence            45666677889999999999999999999999999999999999999999999999999999999999977532   223


Q ss_pred             CchhhHHhHHHHHHHHHHHhccCC
Q psy2610         110 APLFVEFVLKNVVTLYETVAVRKK  133 (133)
Q Consensus       110 kr~FVqfILePI~kIy~~v~~~~~  133 (133)
                      +|.||+|||+|||++|++||+-+|
T Consensus       270 ~r~F~~~iLdPIykvfdaimN~kk  293 (842)
T KOG0469|consen  270 RRAFCMFILDPIYKVFDAIMNFKK  293 (842)
T ss_pred             ccceeEEeechHHHHHHHHhhccH
Confidence            789999999999999999997664


No 2  
>KOG0468|consensus
Probab=99.93  E-value=4e-26  Score=207.05  Aligned_cols=92  Identities=35%  Similarity=0.621  Sum_probs=85.4

Q ss_pred             CCeeEecCCCceEeeecccceeeehhHHHHHHHhhcC-CCHHHHHHhhhcccceecCCCcEecCCCcCCCCchhhHHhHH
Q psy2610          41 SDLYFSPDRGNVVFASAFDGWGFTIDDFARLYSAKLG-IREDILRKTLWGDYYLNAKAKRILKGAQEKAKAPLFVEFVLK  119 (133)
Q Consensus        41 ~~~~fsP~~GNV~FaSal~GW~Ftl~~FA~~Y~~K~g-i~~~~L~k~LWGD~Yyd~ktKk~~~~~~~~~~kr~FVqfILe  119 (133)
                      ....+||..|||||||+..||||||.+||++|++..| ++.+.|++|||||.||+++|+||.++++....+|+||+|||+
T Consensus       295 ~~~~~sP~~gNvcFaS~~~g~cFtl~sFak~Y~~~~~~~~~d~Fa~RLWGdvYf~~ktrkF~kk~~~~~~~rsFVeFILe  374 (971)
T KOG0468|consen  295 DNPVVSPILGNVCFASGKLGFCFTLKSFAKLYADAHGHIDVDDFAKRLWGDVYFHSKTRKFVKKPPDGSGSRSFVEFILE  374 (971)
T ss_pred             cccccccccCceeeeccccceeeehHHHHHHHHHhcCCcchhhhhhhhhccccccccccccccCCCCCcccchhhhhhHh
Confidence            5678999999999999999999999999999999864 789999999999999999999999998776668999999999


Q ss_pred             HHHHHHHHHhccC
Q psy2610         120 NVVTLYETVAVRK  132 (133)
Q Consensus       120 PI~kIy~~v~~~~  132 (133)
                      |+|||+..++...
T Consensus       375 PlYKi~sq~igd~  387 (971)
T KOG0468|consen  375 PLYKIFSQVIGDE  387 (971)
T ss_pred             HHHHHHHHHhcch
Confidence            9999999998754


No 3  
>KOG0467|consensus
Probab=99.89  E-value=3.4e-24  Score=195.79  Aligned_cols=93  Identities=48%  Similarity=0.976  Sum_probs=87.6

Q ss_pred             CCCCeeEecCCCceEeeecccceeeehhHHHHHHHhhcCCCHHHHHHhhhcccceecCCCcEecCCCcCCCCchhhHHhH
Q psy2610          39 DDSDLYFSPDRGNVVFASAFDGWGFTIDDFARLYSAKLGIREDILRKTLWGDYYLNAKAKRILKGAQEKAKAPLFVEFVL  118 (133)
Q Consensus        39 ~~~~~~fsP~~GNV~FaSal~GW~Ftl~~FA~~Y~~K~gi~~~~L~k~LWGD~Yyd~ktKk~~~~~~~~~~kr~FVqfIL  118 (133)
                      .++..+|+|++|||+||||++||+|.+++||++|++|+|.+.+.|.+.||||+|+++++|++....+-+|++|+|+||||
T Consensus       181 ~d~~~~F~p~kgNVif~~A~~~~~f~~~~fak~~~~kl~~k~~al~k~lwgd~y~~~ktk~I~~~~~~~grkplf~~~vl  260 (887)
T KOG0467|consen  181 EDEEITFGPEDGNVIFASALDGWGFGIEQFAKFYAKKLGLKDAALLKFLWGDRYIDPKTKRICEGKKLKGRKPLFVQFVL  260 (887)
T ss_pred             hhcceeecCCCCcEEEEEecccccccHHHHHHHHHHhcChhhhhhhhhhccceeecchhhhhhcccCcccCCCccceeeh
Confidence            37789999999999999999999999999999999999999999999999999999999999988877788999999999


Q ss_pred             HHHHHHHHHHhcc
Q psy2610         119 KNVVTLYETVAVR  131 (133)
Q Consensus       119 ePI~kIy~~v~~~  131 (133)
                      +|||+||+.+...
T Consensus       261 e~lw~iy~~~~~~  273 (887)
T KOG0467|consen  261 ENLWRIYELALKS  273 (887)
T ss_pred             hhHHHHHHHHhcc
Confidence            9999999976644


No 4  
>PLN00116 translation elongation factor EF-2 subunit; Provisional
Probab=99.78  E-value=3.5e-19  Score=164.30  Aligned_cols=91  Identities=25%  Similarity=0.626  Sum_probs=81.4

Q ss_pred             CCeeEecCCCceEeeecccceeeehhHHHHHHHhhcCCCHHHHHHhhhcccceecCCCcEecCCC-cCCCCchhhHHhHH
Q psy2610          41 SDLYFSPDRGNVVFASAFDGWGFTIDDFARLYSAKLGIREDILRKTLWGDYYLNAKAKRILKGAQ-EKAKAPLFVEFVLK  119 (133)
Q Consensus        41 ~~~~fsP~~GNV~FaSal~GW~Ftl~~FA~~Y~~K~gi~~~~L~k~LWGD~Yyd~ktKk~~~~~~-~~~~kr~FVqfILe  119 (133)
                      ++++|+|.+|||+|||+++||+|++++||.+|+.|++++.+.|.++||||+||+++++++...+. ..+.++.|++|||+
T Consensus       198 ~~~~~~P~~~nv~F~s~~~~~~~~l~~~~~~y~~~~~~~~~~l~~~lwg~~~~~~~~~~~~~~~~~~~~~~~~f~~~il~  277 (843)
T PLN00116        198 GDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATKKWTTKNTGSPTCKRGFVQFCYE  277 (843)
T ss_pred             CceEEccCCCeeeeeecccCEEEEhHHHHHHHHHHhCCcHHHHHHHhhccceEcCCCceEEecCCCCchhhHHHHHHHHH
Confidence            45789999999999999999999999999999999999999999999999999999998877652 33346789999999


Q ss_pred             HHHHHHHHHhcc
Q psy2610         120 NVVTLYETVAVR  131 (133)
Q Consensus       120 PI~kIy~~v~~~  131 (133)
                      |+|++|++++..
T Consensus       278 ~~~~l~e~v~~~  289 (843)
T PLN00116        278 PIKQIINTCMND  289 (843)
T ss_pred             HHHHHHHHHHhc
Confidence            999999998743


No 5  
>PTZ00416 elongation factor 2; Provisional
Probab=99.72  E-value=1.3e-17  Score=153.84  Aligned_cols=89  Identities=35%  Similarity=0.784  Sum_probs=79.2

Q ss_pred             CeeEecCCCceEeeecccceeeehhHHHHHHHhhcCCCHHHHHHhhhcccceecCCCcEecCCCc---CCCCchhhHHhH
Q psy2610          42 DLYFSPDRGNVVFASAFDGWGFTIDDFARLYSAKLGIREDILRKTLWGDYYLNAKAKRILKGAQE---KAKAPLFVEFVL  118 (133)
Q Consensus        42 ~~~fsP~~GNV~FaSal~GW~Ftl~~FA~~Y~~K~gi~~~~L~k~LWGD~Yyd~ktKk~~~~~~~---~~~kr~FVqfIL  118 (133)
                      +++|+|..|||.|+|+.+||+|||++|+.+|+++|+++...|.+.||||+||+++++++...+..   ...+++|++|+|
T Consensus       193 ~~~~~p~~~~vp~~s~~~~~~f~~~~F~~~y~~~~~~~~~~l~~~~wg~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~  272 (836)
T PTZ00416        193 DVQVYPEKGTVAFGSGLQGWAFTLTTFARIYAKKFGVEESKMMERLWGDNFFDAKTKKWIKDETNAQGKKLKRAFCQFIL  272 (836)
T ss_pred             ceecceeccEEEEEeccccceeehHHhhhhhhhhcCCcHHHHHHHHhccccccCCCCEEEeccCCccccccchHHHHHHH
Confidence            46799999999999999999999999999999999999999999999999999998888765311   123789999999


Q ss_pred             HHHHHHHHHHhc
Q psy2610         119 KNVVTLYETVAV  130 (133)
Q Consensus       119 ePI~kIy~~v~~  130 (133)
                      +|+|++|++++.
T Consensus       273 ~~~~~l~e~~~~  284 (836)
T PTZ00416        273 DPICQLFDAVMN  284 (836)
T ss_pred             HHHHHHHHHHHh
Confidence            999999998864


No 6  
>cd01885 EF2 EF2 (for archaea and eukarya).  Translocation requires hydrolysis of a molecule of GTP and is mediated by EF-G in bacteria and by eEF2 in eukaryotes.  The eukaryotic elongation factor eEF2 is a GTPase involved in the translocation of the peptidyl-tRNA from the A site to the P site on the ribosome.  The 95-kDa protein is highly conserved, with 60% amino acid sequence identity between the human and yeast proteins.  Two major mechanisms are known to regulate protein elongation and both involve eEF2.  First, eEF2 can be modulated by reversible phosphorylation.  Increased levels of phosphorylated eEF2 reduce elongation rates presumably because phosphorylated eEF2 fails to bind the ribosomes.  Treatment of mammalian cells with agents that raise the cytoplasmic Ca2+ and cAMP levels reduce elongation rates by activating the kinase responsible for phosphorylating eEF2.  In contrast, treatment of cells with insulin increases elongation rates by promoting eEF2 dephosphorylation.  Seco
Probab=99.08  E-value=4.8e-11  Score=95.35  Aligned_cols=34  Identities=62%  Similarity=1.221  Sum_probs=31.5

Q ss_pred             CCCeeEecCCCceEeeecccceeeehhHHHHHHH
Q psy2610          40 DSDLYFSPDRGNVVFASAFDGWGFTIDDFARLYS   73 (133)
Q Consensus        40 ~~~~~fsP~~GNV~FaSal~GW~Ftl~~FA~~Y~   73 (133)
                      ++++.|||++|||+||||++|||||+++||++|.
T Consensus       177 ~~~~~~~p~~gnv~f~S~~~gw~f~~~~f~~~~~  210 (222)
T cd01885         177 DEKWYFSPQKGNVAFGSALHGWGFTIIKFARIYA  210 (222)
T ss_pred             cCCcEEeeCCCcEEEEecccCEEeccccccchHH
Confidence            4567899999999999999999999999999994


No 7  
>cd04167 Snu114p Snu114p subfamily.  Snu114p is one of several proteins that make up the U5 small nuclear ribonucleoprotein (snRNP) particle.  U5 is a component of the spliceosome, which catalyzes the splicing of pre-mRNA to remove introns.  Snu114p is homologous to EF-2, but typically contains an additional N-terminal domain not found in Ef-2.  This protein is part of the GTP translation factor family and the Ras superfamily, characterized by five G-box motifs.
Probab=98.33  E-value=3.9e-07  Score=70.67  Aligned_cols=32  Identities=47%  Similarity=0.863  Sum_probs=29.9

Q ss_pred             CeeEecCCCceEeeecccceeeehhHHHHHHH
Q psy2610          42 DLYFSPDRGNVVFASAFDGWGFTIDDFARLYS   73 (133)
Q Consensus        42 ~~~fsP~~GNV~FaSal~GW~Ftl~~FA~~Y~   73 (133)
                      ++.|.|.++||+|+||++||+|++.+||++|.
T Consensus       170 ~~~~~p~~~nv~~~s~~~~w~~~~~~~~~~~~  201 (213)
T cd04167         170 SFLFSPENGNVCFASSKFGFCFTLESFAKKYG  201 (213)
T ss_pred             ceEeccCCCeEEEEecCCCeEEecHHHHhhhh
Confidence            36799999999999999999999999999993


No 8  
>PRK07560 elongation factor EF-2; Reviewed
Probab=95.03  E-value=0.027  Score=52.07  Aligned_cols=30  Identities=20%  Similarity=0.452  Sum_probs=26.3

Q ss_pred             CeeEecCCCceEeeecccceeeehhHHHHH
Q psy2610          42 DLYFSPDRGNVVFASAFDGWGFTIDDFARL   71 (133)
Q Consensus        42 ~~~fsP~~GNV~FaSal~GW~Ftl~~FA~~   71 (133)
                      .+.++|.+|||+|+||++||+|+++.+.+.
T Consensus       189 ~~~~~~~~~~v~~~sa~~~~~~~~~~~~~~  218 (731)
T PRK07560        189 KWKVDVEDGTVAFGSALYNWAISVPMMQKT  218 (731)
T ss_pred             ceeecCCCCcEeeeecccccceeHHHHHHh
Confidence            567899999999999999999999977553


No 9  
>TIGR00490 aEF-2 translation elongation factor aEF-2. This model represents archaeal elongation factor 2, a protein more similar to eukaryotic EF-2 than to bacterial EF-G, both in sequence similarity and in sharing with eukaryotes the property of having a diphthamide (modified His) residue at a conserved position. The diphthamide can be ADP-ribosylated by diphtheria toxin in the presence of NAD.
Probab=94.22  E-value=0.019  Score=53.10  Aligned_cols=30  Identities=20%  Similarity=0.540  Sum_probs=26.5

Q ss_pred             CCeeEecCCCceEeeecccceeeehhHHHH
Q psy2610          41 SDLYFSPDRGNVVFASAFDGWGFTIDDFAR   70 (133)
Q Consensus        41 ~~~~fsP~~GNV~FaSal~GW~Ftl~~FA~   70 (133)
                      +.+.++|+.|||+|+|++++|+|++++|.+
T Consensus       187 ~~~~~~~~~~~~~f~s~~~~~~~~~~~~~~  216 (720)
T TIGR00490       187 DKWKVRVEDGSVAFGSAYYNWAISVPSMKK  216 (720)
T ss_pred             hceEechhhCCHHHHhhhhcccccchhHhh
Confidence            346799999999999999999999998843


No 10 
>cd01639 IMPase IMPase, inositol monophosphatase and related domains. A family of Mg++ dependent phosphatases, inhibited by lithium, many of which may act on inositol monophosphate substrate. They dephosphorylate inositol phosphate to generate inositol, which may be recycled into inositol lipids; in eukaryotes IMPase plays a vital role in intracellular signaling. IMPase is one of the proposed targets of Li+ therapy in manic-depressive illness. This family contains some bacterial members of the inositol monophosphatase family classified as SuhB-like. E. coli SuhB has been suggested to participate in posstranscriptional control of gene expression, and its inositol monophosphatase activity doesn't appear to be sufficient for its cellular function. It has been proposed, that SuhB plays a role in the biosynthesis of phosphatidylinositol in mycobacteria.
Probab=56.61  E-value=8.6  Score=30.29  Aligned_cols=26  Identities=19%  Similarity=0.391  Sum_probs=23.7

Q ss_pred             CCeeEecCCCceEeeecccceeeehh
Q psy2610          41 SDLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        41 ~~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      --|.++|..|+--|..++..||.+|-
T Consensus        76 ~~WvIDPIDGT~nf~~g~p~~~vsia  101 (244)
T cd01639          76 PTWIIDPLDGTTNFVHGFPHFAVSIA  101 (244)
T ss_pred             cEEEEecccChhHHhcCCCcEEEEEE
Confidence            45899999999999999999998885


No 11 
>PLN02553 inositol-phosphate phosphatase
Probab=51.88  E-value=12  Score=30.20  Aligned_cols=26  Identities=19%  Similarity=0.225  Sum_probs=23.8

Q ss_pred             CCeeEecCCCceEeeecccceeeehh
Q psy2610          41 SDLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        41 ~~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      -.|.++|..|+.-|..++..||.+|-
T Consensus        86 ~~WiIDPIDGT~NF~~g~p~~avsIa  111 (270)
T PLN02553         86 PTWIVDPLDGTTNFVHGFPFVCVSIG  111 (270)
T ss_pred             cEEEEecccchhhHhhcCCceEEEEE
Confidence            35899999999999999999999885


No 12 
>PRK10757 inositol monophosphatase; Provisional
Probab=51.67  E-value=12  Score=30.25  Aligned_cols=26  Identities=15%  Similarity=0.294  Sum_probs=23.7

Q ss_pred             CCeeEecCCCceEeeecccceeeehh
Q psy2610          41 SDLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        41 ~~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      --|.++|..|+.-|..++..||.+|-
T Consensus        79 ~~WiIDPIDGT~nf~~g~p~~~vsia  104 (267)
T PRK10757         79 VQWVIDPLDGTTNFIKRLPHFAVSIA  104 (267)
T ss_pred             CEEEEeCccCchHHHhCCCcEEEEEE
Confidence            35899999999999999999999885


No 13 
>cd01636 FIG FIG, FBPase/IMPase/glpX-like domain. A superfamily of metal-dependent phosphatases with various substrates. Fructose-1,6-bisphospatase (both the major and the glpX-encoded variant) hydrolyze fructose-1,6,-bisphosphate to fructose-6-phosphate in gluconeogenesis. Inositol-monophosphatases and inositol polyphosphatases play vital roles in eukaryotic signalling, as they participate in metabolizing the messenger molecule Inositol-1,4,5-triphosphate. Many of these enzymes are inhibited by Li+.
Probab=50.88  E-value=13  Score=27.88  Aligned_cols=27  Identities=15%  Similarity=0.089  Sum_probs=24.1

Q ss_pred             CCeeEecCCCceEeeecccceeeehhH
Q psy2610          41 SDLYFSPDRGNVVFASAFDGWGFTIDD   67 (133)
Q Consensus        41 ~~~~fsP~~GNV~FaSal~GW~Ftl~~   67 (133)
                      --|.++|..|+--|..++..||-++--
T Consensus        79 ~~WiiDPiDGT~nf~~g~p~~~vsial  105 (184)
T cd01636          79 YTWVIDPIDGTKNFINGLPFVAVVIAV  105 (184)
T ss_pred             eEEEEecccChHHHHhCCCCEEEeHHH
Confidence            458999999999999999999988853


No 14 
>cd01642 Arch_FBPase_2 Putative fructose-1,6-bisphosphatase or related enzymes of inositol monophosphatase family. These are Mg++ dependent phosphatases. Members in this family may have fructose-1,6-bisphosphatase and/or inositol-monophosphatase activity. Fructose-1,6-bisphosphatase catalyzes the hydrolysis of fructose-1,6-biphosphate  into fructose-6-phosphate and is critical in gluconeogenesis pathway.
Probab=49.11  E-value=16  Score=29.47  Aligned_cols=25  Identities=12%  Similarity=0.210  Sum_probs=23.4

Q ss_pred             CeeEecCCCceEeeecccceeeehh
Q psy2610          42 DLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        42 ~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      -|.++|..|+.=|..++..||.+|-
T Consensus        76 ~WiIDPIDGT~NFi~g~P~favsIa  100 (244)
T cd01642          76 IAVLDPLDGSTNYLSGIPFYSVSVA  100 (244)
T ss_pred             EEEEeCCcCcHHHHcCCCCeEEEEE
Confidence            4899999999999999999999985


No 15 
>cd01637 IMPase_like Inositol-monophosphatase-like domains. This family of phosphatases is dependent on bivalent metal ions such as Mg++, and many members are inhibited by Li+ (which is thought to displace a bivalent ion in the active site). Substrates include fructose-1,6-bisphosphate, inositol poly- and monophosphates, PAP and PAPS, sedoheptulose-1,7-bisphosphate and probably others.
Probab=48.22  E-value=13  Score=28.88  Aligned_cols=27  Identities=15%  Similarity=0.309  Sum_probs=23.7

Q ss_pred             CCCeeEecCCCceEeeecccceeeehh
Q psy2610          40 DSDLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        40 ~~~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      +--|.++|..|+--|..++..||-++-
T Consensus        74 ~~~wviDPIDGT~nf~~g~p~~~vsia  100 (238)
T cd01637          74 GRVWVIDPIDGTTNFVAGLPNFAVSIA  100 (238)
T ss_pred             CcEEEEcceeChhhhhcCCCCEEEEEE
Confidence            345899999999999999999998875


No 16 
>PF00165 HTH_AraC:  Bacterial regulatory helix-turn-helix proteins, AraC family; PDB: 1WPK_A 1ZGW_A 1U8B_A.
Probab=45.00  E-value=23  Score=20.55  Aligned_cols=25  Identities=28%  Similarity=0.518  Sum_probs=18.1

Q ss_pred             ceeeehhHHHHHHHhhcCCCHHHHH
Q psy2610          60 GWGFTIDDFARLYSAKLGIREDILR   84 (133)
Q Consensus        60 GW~Ftl~~FA~~Y~~K~gi~~~~L~   84 (133)
                      -++|+...|.+.+.+.+|+.+.+..
T Consensus        17 ~~g~S~~~f~r~Fk~~~g~tp~~y~   41 (42)
T PF00165_consen   17 QAGFSPSYFSRLFKKETGMTPKQYR   41 (42)
T ss_dssp             HHTS-HHHHHHHHHHHTSS-HHHHH
T ss_pred             HHCCCHHHHHHHHHHHHCcCHHHHh
Confidence            3567888999999998999887654


No 17 
>cd01643 Bacterial_IMPase_like_2 Bacterial family of Mg++ dependent phosphatases, related to inositol monophosphatases. These enzymes may dephosphorylate inositol monophosphate or similar substrates.
Probab=41.68  E-value=21  Score=28.46  Aligned_cols=26  Identities=23%  Similarity=0.365  Sum_probs=23.6

Q ss_pred             CCeeEecCCCceEeeecccceeeehh
Q psy2610          41 SDLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        41 ~~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      .-|.++|..|+.-|..++..||.+|-
T Consensus        72 ~~WiIDPIDGT~nF~~g~p~~~vsia   97 (242)
T cd01643          72 WYWVIDPIDGTTNFARGIPIWAISIA   97 (242)
T ss_pred             CEEEEeCccChHHHhcCCCceEEEEE
Confidence            35889999999999999999999885


No 18 
>TIGR02067 his_9_proposed histidinol-phosphate phosphatase HisN, inositol monophosphatase family. This subfamily belongs to the inositol monophosphatase family (pfam00459). The members of this family consist of no more than one per species and are found only in species in which histidine is synthesized de novo but no histidinol phosphatase can be found in either of the two described families (TIGR01261, TIGR01856). In at least one species, the member of this family is found near known histidine biosynthesis genes.
Probab=41.15  E-value=23  Score=28.20  Aligned_cols=26  Identities=23%  Similarity=0.374  Sum_probs=23.4

Q ss_pred             CCeeEecCCCceEeeecccceeeehh
Q psy2610          41 SDLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        41 ~~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      .-|.++|..|+.-|..++..||.+|-
T Consensus        75 ~~WiiDPIDGT~nF~~g~p~~~vsia  100 (251)
T TIGR02067        75 RVWVLDPIDGTKSFIRGVPVWGTLIA  100 (251)
T ss_pred             eEEEEecCcChhHHhcCCCceEEEEE
Confidence            35889999999999999999998885


No 19 
>cd01517 PAP_phosphatase PAP-phosphatase_like domains. PAP-phosphatase is a member of the inositol monophosphatase family, and catalyses the hydrolysis of 3'-phosphoadenosine-5'-phosphate (PAP) to AMP. In Saccharomyces cerevisiae, HAL2 (MET22) is involved in methionine biosynthesis and provides increased salt tolerance when over-expressed. Bacterial members of this domain family may differ in their substrate specificity and dephosphorylate different targets, as the substrate binding site does not appear to be conserved in that sub-set.
Probab=40.12  E-value=18  Score=29.17  Aligned_cols=24  Identities=13%  Similarity=0.137  Sum_probs=22.1

Q ss_pred             CeeEecCCCceEeeecccceeeehh
Q psy2610          42 DLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        42 ~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      -|.++|..|+.-|..++ .||.+|-
T Consensus        74 ~WiIDPIDGT~nfv~g~-~~~vsIa   97 (274)
T cd01517          74 FWVLDPIDGTKGFLRGD-QFAVALA   97 (274)
T ss_pred             EEEEcCCcCchhhhcCC-ceEEEEE
Confidence            48999999999999999 9998884


No 20 
>cd00383 trans_reg_C Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and a response regulator. The former autophosphorylates in a histidine residue on detecting an external stimulus. The phosphate is then transferred to an invariant aspartate residue in a highly conserved receiver domain of the response regulator. Phosphorylation activates a variable effector domain of the response regulator, which triggers the cellular response. The C-terminal effector domain contains DNA and RNA polymerase binding sites. Several dimers or monomers bind head to tail to small tandem repeats upstream of the genes. The RNA polymerase binding sites interact with the alpha or sigma subunite of RNA polymerase.
Probab=36.69  E-value=73  Score=20.75  Aligned_cols=49  Identities=27%  Similarity=0.472  Sum_probs=33.3

Q ss_pred             CeeEecCCCceEeeecccceeeehhHHHHH--HHhhc--CCCHHHHHHhhhcccc
Q psy2610          42 DLYFSPDRGNVVFASAFDGWGFTIDDFARL--YSAKL--GIREDILRKTLWGDYY   92 (133)
Q Consensus        42 ~~~fsP~~GNV~FaSal~GW~Ftl~~FA~~--Y~~K~--gi~~~~L~k~LWGD~Y   92 (133)
                      ++.|+|....|.+..  .-..+|-.+++=+  .+..-  -++.+.|.+.+||+..
T Consensus         5 ~~~~d~~~~~l~~~~--~~v~Lt~~e~~lL~~L~~~~~~~vs~~~l~~~lw~~~~   57 (95)
T cd00383           5 DLVLDPARREVTRDG--EPVELTPKEFELLELLARNPGRVLSREQLLEAVWGDDY   57 (95)
T ss_pred             CEEEehhhCEEEECC--EEEEeCHHHHHHHHHHHhCCCCcCCHHHHHHHhcCCCC
Confidence            577888888776543  4566776666543  23332  3788999999999754


No 21 
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins.
Probab=35.26  E-value=36  Score=28.27  Aligned_cols=23  Identities=13%  Similarity=0.281  Sum_probs=20.1

Q ss_pred             CchhhHHhHHHHHHHHHHHhccC
Q psy2610         110 APLFVEFVLKNVVTLYETVAVRK  132 (133)
Q Consensus       110 kr~FVqfILePI~kIy~~v~~~~  132 (133)
                      ++...+++|+||++++..++.++
T Consensus       401 ~~~~~~~~l~~~~~~~~~~~~~~  423 (423)
T TIGR01843       401 ERTVIEYLLKPITDSVQEALRER  423 (423)
T ss_pred             CccHHHHHHHHHHHHHHHHhcCC
Confidence            66789999999999999988764


No 22 
>COG1312 UxuA D-mannonate dehydratase [Carbohydrate transport and metabolism]
Probab=34.26  E-value=44  Score=29.43  Aligned_cols=36  Identities=36%  Similarity=0.751  Sum_probs=29.2

Q ss_pred             ccccee--eehhHHHHHHHhhcCCCHHHHHHhhhccccee
Q psy2610          57 AFDGWG--FTIDDFARLYSAKLGIREDILRKTLWGDYYLN   94 (133)
Q Consensus        57 al~GW~--Ftl~~FA~~Y~~K~gi~~~~L~k~LWGD~Yyd   94 (133)
                      |+-||.  +|+.+|.++...--+|+.++|.+.|  .+|++
T Consensus       158 glPG~~~~~tl~~~~~~~~~y~~Id~~~L~~nL--~yFL~  195 (362)
T COG1312         158 GLPGWEEGYTLDQFRELLELYGGIDEEKLWENL--AYFLK  195 (362)
T ss_pred             CCCCCcccccHHHHHHHHHHhcCCCHHHHHHHH--HHHHH
Confidence            899976  9999999999876679998888877  45543


No 23 
>PRK09685 DNA-binding transcriptional activator FeaR; Provisional
Probab=33.63  E-value=36  Score=27.17  Aligned_cols=27  Identities=22%  Similarity=0.711  Sum_probs=20.7

Q ss_pred             ceeee-hhHHHHHHHhhcCCCHHHHHHh
Q psy2610          60 GWGFT-IDDFARLYSAKLGIREDILRKT   86 (133)
Q Consensus        60 GW~Ft-l~~FA~~Y~~K~gi~~~~L~k~   86 (133)
                      .|||+ ...|++.|.+.+|++|.+..+.
T Consensus       273 ~~GF~d~s~Fsr~Fkk~~G~sP~~yR~~  300 (302)
T PRK09685        273 KWGFSDSSHFSTAFKQRFGVSPGEYRRK  300 (302)
T ss_pred             HhCCCCHHHHHHHHHHHHCcCHHHHHhh
Confidence            35554 6889999999999998877653


No 24 
>PF14056 DUF4250:  Domain of unknown function (DUF4250)
Probab=32.81  E-value=45  Score=21.71  Aligned_cols=27  Identities=15%  Similarity=0.267  Sum_probs=21.3

Q ss_pred             hhcCCCHHHHHHhhhc-ccceecCCCcE
Q psy2610          74 AKLGIREDILRKTLWG-DYYLNAKAKRI  100 (133)
Q Consensus        74 ~K~gi~~~~L~k~LWG-D~Yyd~ktKk~  100 (133)
                      ..++++.+.|.++|=. +|.|++++++|
T Consensus        28 ~~~~id~~~l~~kL~~~Gy~Y~~~~NQF   55 (55)
T PF14056_consen   28 YDYDIDKEELEEKLASIGYEYDEEQNQF   55 (55)
T ss_pred             HHhCCCHHHHHHHHHHcCCeEchhhCCC
Confidence            3467899999999955 78899988764


No 25 
>PLN02737 inositol monophosphatase family protein
Probab=32.38  E-value=29  Score=29.99  Aligned_cols=25  Identities=16%  Similarity=0.373  Sum_probs=23.4

Q ss_pred             CeeEecCCCceEeeecccceeeehh
Q psy2610          42 DLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        42 ~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      -|.++|..|+.-|..++..||.+|-
T Consensus       153 ~WiIDPIDGT~NFv~G~P~faVsIA  177 (363)
T PLN02737        153 LWCIDPLDGTTNFAHGYPSFAVSVG  177 (363)
T ss_pred             EEEEecccCHHHHHhCCCCeEEEEE
Confidence            5899999999999999999999985


No 26 
>PRK10931 adenosine-3'(2'),5'-bisphosphate nucleotidase; Provisional
Probab=32.33  E-value=17  Score=28.90  Aligned_cols=25  Identities=16%  Similarity=0.170  Sum_probs=23.2

Q ss_pred             CeeEecCCCceEeeecccceeeehh
Q psy2610          42 DLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        42 ~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      -|.++|..|+.-|..++..||.+|-
T Consensus        79 ~WiIDPIDGT~nF~~g~p~~~vsIa  103 (246)
T PRK10931         79 YWLVDPLDGTKEFIKRNGEFTVNIA  103 (246)
T ss_pred             EEEEecCcChHHHHcCCCCEEEEEE
Confidence            3889999999999999999999885


No 27 
>PLN02911 inositol-phosphate phosphatase
Probab=31.25  E-value=34  Score=28.30  Aligned_cols=25  Identities=20%  Similarity=0.214  Sum_probs=23.3

Q ss_pred             CeeEecCCCceEeeecccceeeehh
Q psy2610          42 DLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        42 ~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      -|.++|..|+.=|.-++..||.+|-
T Consensus       111 ~WiIDPIDGT~NFv~G~p~favsIa  135 (296)
T PLN02911        111 VWVLDPIDGTKSFITGKPLFGTLIA  135 (296)
T ss_pred             EEEEeCCcChHHHhcCCCceEEEEE
Confidence            5899999999999999999999985


No 28 
>TIGR01331 bisphos_cysQ 3'(2'),5'-bisphosphate nucleotidase, bacterial. Sulfate is incorporated into 3-phosphoadenylylsulfate, PAPS, for utilization in pathways such as methionine biosynthesis. Transfer of sulfate from PAPS to an acceptor leaves adenosine 3'-5'-bisphosphate, APS. This model describes a form found in bacteria of the enzyme 3'(2'),5'-bisphosphate nucleotidase, which removes the 3'-phosphate from APS to regenerate AMP and help drive the cycle.
Probab=31.09  E-value=19  Score=28.64  Aligned_cols=25  Identities=16%  Similarity=0.170  Sum_probs=23.2

Q ss_pred             CeeEecCCCceEeeecccceeeehh
Q psy2610          42 DLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        42 ~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      -|.++|..|+.-|..++..||.+|-
T Consensus        78 ~WvIDPIDGT~nF~~G~p~~~vsIa  102 (249)
T TIGR01331        78 FWLVDPLDGTKEFINRNGDFTVNIA  102 (249)
T ss_pred             EEEEcCCcChHHHhcCCCcEEEEEE
Confidence            4899999999999999999999885


No 29 
>cd01638 CysQ CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, is a bacterial member of the inositol monophosphatase family. It has been proposed that CysQ helps control intracellular levels of PAPS, which is an intermediate in cysteine biosynthesis (a principal route of sulfur assimilation).
Probab=30.01  E-value=25  Score=27.76  Aligned_cols=26  Identities=15%  Similarity=0.170  Sum_probs=23.5

Q ss_pred             CCeeEecCCCceEeeecccceeeehh
Q psy2610          41 SDLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        41 ~~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      .-|.++|..|+--|..++..||-++-
T Consensus        75 ~~WviDPIDGT~Nfv~g~p~~~isia  100 (242)
T cd01638          75 RFWLVDPLDGTREFIKGNGEFAVNIA  100 (242)
T ss_pred             EEEEEecccChHHHhcCCCCeEEEEE
Confidence            35889999999999999999998876


No 30 
>PRK12676 bifunctional inositol-1 monophosphatase/fructose-1,6-bisphosphatase; Reviewed
Probab=29.61  E-value=42  Score=26.97  Aligned_cols=25  Identities=12%  Similarity=0.195  Sum_probs=23.2

Q ss_pred             CeeEecCCCceEeeecccceeeehh
Q psy2610          42 DLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        42 ~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      -|.++|..|+.-|..++..||-+|-
T Consensus        83 ~WvIDPiDGT~nfv~g~p~~~vsia  107 (263)
T PRK12676         83 TVVLDPLDGTYNAINGIPFYAISIA  107 (263)
T ss_pred             EEEEeccCCchHHhcCCCceEEEEE
Confidence            4889999999999999999998886


No 31 
>COG0483 SuhB Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family [Carbohydrate transport and metabolism]
Probab=29.17  E-value=21  Score=29.05  Aligned_cols=25  Identities=16%  Similarity=0.230  Sum_probs=23.5

Q ss_pred             CeeEecCCCceEeeecccceeeehh
Q psy2610          42 DLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        42 ~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      .|.++|..|+.-|.+++.-||-+|-
T Consensus        81 ~wVIDPIDGT~NFv~G~P~favSIa  105 (260)
T COG0483          81 VWVIDPIDGTTNFVRGIPFFAVSIA  105 (260)
T ss_pred             EEEEcCCCCcHHHHcCCCcceEEEE
Confidence            5889999999999999999999886


No 32 
>PF13413 HTH_25:  Helix-turn-helix domain; PDB: 2WUS_R 3FYM_A.
Probab=29.12  E-value=59  Score=21.02  Aligned_cols=19  Identities=32%  Similarity=0.511  Sum_probs=13.5

Q ss_pred             hhHHHHHHHhhcCCCHHHH
Q psy2610          65 IDDFARLYSAKLGIREDIL   83 (133)
Q Consensus        65 l~~FA~~Y~~K~gi~~~~L   83 (133)
                      ++.|.+.|++.+|++++.+
T Consensus        44 ~rg~lr~Ya~~Lgld~~~l   62 (62)
T PF13413_consen   44 ARGYLRKYARFLGLDPDEL   62 (62)
T ss_dssp             HHHHHHHHHHHTT--HHHH
T ss_pred             HHHHHHHHHHHhCcCcccC
Confidence            4778888999899998754


No 33 
>cd01641 Bacterial_IMPase_like_1 Predominantly bacterial family of Mg++ dependend phosphatases, related to inositol monophosphatases. These enzymes may dephosphorylate fructose-1,6-bisphosphate, inositol monophospate, 3'-phosphoadenosine-5'-phosphate,  or similar substrates.
Probab=28.74  E-value=49  Score=26.24  Aligned_cols=26  Identities=23%  Similarity=0.377  Sum_probs=23.6

Q ss_pred             CCeeEecCCCceEeeecccceeeehh
Q psy2610          41 SDLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        41 ~~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      .-|.++|..|+--|..++..||.+|-
T Consensus        73 ~~WviDPIDGT~nf~~g~p~~~vsia   98 (248)
T cd01641          73 YVWVLDPIDGTKSFIRGLPVWGTLIA   98 (248)
T ss_pred             cEEEEecCcCchhHhcCCCceEEEEE
Confidence            35889999999999999999998886


No 34 
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease. Clp protease (caseinolytic protease; ClpP; Peptidase S14) is a highly conserved serine protease present throughout in bacteria and eukaryota, but seems to be absent in archaea, mollicutes and some fungi. Clp proteases are involved in a number of cellular processes such as degradation of misfolded proteins, regulation of short-lived proteins and housekeeping removal of dysfunctional proteins. Additionally, they are implicated in the control of cell growth, targeting DNA-binding protein from starved cells. ClpP has also been linked to the tight regulation of virulence genes in the pathogens Listeria monocytogenes and Salmonella typhimurium. This enzyme belong to the family of ATP-dependent proteases; the functional Clp protease is comprised of two components: a proteolytic component and one of several regulatory ATPase components, both of which are required for effective levels of proteas
Probab=27.85  E-value=57  Score=24.60  Aligned_cols=31  Identities=29%  Similarity=0.441  Sum_probs=25.5

Q ss_pred             hHHHHHHHhhcCCCHHHHHHhhhcccceecC
Q psy2610          66 DDFARLYSAKLGIREDILRKTLWGDYYLNAK   96 (133)
Q Consensus        66 ~~FA~~Y~~K~gi~~~~L~k~LWGD~Yyd~k   96 (133)
                      .+|.++|+++.|.+.+++.+.|=++.|++++
T Consensus       121 ~~~~~~~a~~tg~~~~~i~~~~~~~~~~sa~  151 (162)
T cd07013         121 GNLVSAYAHKTGQSEEELHADLERDTWLSAR  151 (162)
T ss_pred             HHHHHHHHHHhCcCHHHHHHHHcCCccccHH
Confidence            6788899999999999998887777777653


No 35 
>PRK07080 hypothetical protein; Validated
Probab=26.25  E-value=1.2e+02  Score=26.21  Aligned_cols=46  Identities=22%  Similarity=0.418  Sum_probs=36.5

Q ss_pred             CeeEecCCCceEeeecccceeeehhHHHHHHHhhcCCC----HHHHHHhhhcc
Q psy2610          42 DLYFSPDRGNVVFASAFDGWGFTIDDFARLYSAKLGIR----EDILRKTLWGD   90 (133)
Q Consensus        42 ~~~fsP~~GNV~FaSal~GW~Ftl~~FA~~Y~~K~gi~----~~~L~k~LWGD   90 (133)
                      .+-+.-+.|.|+.+++   -||-|+-.|--.....|.+    ++...++|||+
T Consensus       268 ~f~I~~~~g~~ahTgC---vGFGlER~a~All~~hG~d~~~WP~~Vr~~l~~~  317 (317)
T PRK07080        268 TWGIRTADGAVAHTGC---VGFGLERLALALFRHHGLDPAAWPAAVRDVLWGT  317 (317)
T ss_pred             ccCcccCCCCEeEEee---eecCHHHHHHHHHHHhCCChhhccHHHHHHhcCC
Confidence            4556778899988875   4789998888777778877    56889999985


No 36 
>cd01515 Arch_FBPase_1 Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family (FBPase class IV). These are Mg++ dependent phosphatases. Members in this family may have both fructose-1,6-bisphosphatase and inositol-monophosphatase activity. In hyperthermophilic archaea, inositol monophosphatase is thought to play a role in the biosynthesis of di-myo-inositol-1,1'-phosphate, an osmolyte unique to hyperthermophiles.
Probab=25.60  E-value=31  Score=27.64  Aligned_cols=25  Identities=8%  Similarity=0.170  Sum_probs=23.1

Q ss_pred             CeeEecCCCceEeeecccceeeehh
Q psy2610          42 DLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        42 ~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      -|.++|..|+--|..++..||-+|-
T Consensus        78 ~WvIDPIDGT~nfv~g~p~~~isia  102 (257)
T cd01515          78 TVVLDPLDGTYNAINGIPFYSVSVA  102 (257)
T ss_pred             EEEEeCcCChhHHhcCCCceEEEEE
Confidence            5889999999999999999998875


No 37 
>PF15065 NCU-G1:  Lysosomal transcription factor, NCU-G1
Probab=25.07  E-value=99  Score=26.97  Aligned_cols=46  Identities=26%  Similarity=0.470  Sum_probs=32.7

Q ss_pred             CCCceeEEecCCCCCCCCCCCceeecccCccccCCCCCeeEecCCCceEeeecc
Q psy2610           5 HNPNLTLVLRPGPQSTSSPSDTVYTDWGTGLEDADDSDLYFSPDRGNVVFASAF   58 (133)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~fsP~~GNV~FaSal   58 (133)
                      +.|-+-|+.      +..+...+..+|+.-+..+..+.+.|.|..  |.|++|+
T Consensus        23 g~Ptvll~~------T~~~~s~l~VnW~~lls~~~~~ai~v~p~~--v~ys~A~   68 (350)
T PF15065_consen   23 GAPTVLLAH------TNSPSSALNVNWSKLLSPNPSGAITVEPKP--VQYSSAL   68 (350)
T ss_pred             CCCEEEEEE------cCCCcccEEeeHHHhcCCCCCCCEEEccCC--ceEEEee
Confidence            345555555      333333478899986666677889999988  9999886


No 38 
>KOG1785|consensus
Probab=24.61  E-value=33  Score=31.26  Aligned_cols=57  Identities=30%  Similarity=0.578  Sum_probs=34.5

Q ss_pred             CCCCCCCceeEEecCCCCCCCCCCCceeeccc-------Cccc-----cCCCCCeeEecCCCceEeeeccccee
Q psy2610           1 NGRNHNPNLTLVLRPGPQSTSSPSDTVYTDWG-------TGLE-----DADDSDLYFSPDRGNVVFASAFDGWG   62 (133)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~-------~~~~-----~~~~~~~~fsP~~GNV~FaSal~GW~   62 (133)
                      +||+|||+||-..++.++--.    .|++++-       |+++     .+.+.++.+.|- |...-+|++-.|-
T Consensus       332 dGr~~npdLt~l~~~~p~d~i----~VtqEQyeLYceMgsTFeLCKICaendKdvkIEPC-GHLlCt~CLa~WQ  400 (563)
T KOG1785|consen  332 DGRDQNPDLTGLCQPPPQDRI----KVTQEQYELYCEMGSTFELCKICAENDKDVKIEPC-GHLLCTSCLAAWQ  400 (563)
T ss_pred             CCccCCCChhhccCCCcccce----eeeHHHHHHHHHccchHHHHHHhhccCCCcccccc-cchHHHHHHHhhc
Confidence            699999999987766655332    2333322       2221     234556777773 6666777777775


No 39 
>PF00459 Inositol_P:  Inositol monophosphatase family;  InterPro: IPR000760 It has been shown that several proteins share two sequence motifs []. Two of these proteins, vertebrate and plant inositol monophosphatase (3.1.3.25 from EC), and vertebrate inositol polyphosphate 1-phosphatase (3.1.3.57 from EC), are enzymes of the inositol phosphate second messenger signalling pathway, and share similar enzyme activity. Both enzymes exhibit an absolute requirement for metal ions (Mg2+ is preferred), and their amino acid sequences contain a number of conserved motifs, which are also shared by several other proteins related to MPTASE (including products of fungal QaX and qutG, bacterial suhB and cysQ, and yeast hal2) []. The function of the other proteins is not yet clear, but it is suggested that they may act by enhancing the synthesis or degradation of phosphorylated messenger molecules []. Structural analysis of these proteins has revealed a common core of 155 residues, which includes residues essential for metal binding and catalysis. An interesting property of the enzymes of this family is their sensitivity to Li+. The targets and mechanism of action of Li+ are unknown, but overactive inositol phosphate signalling may account for symptoms of manic depression [].; GO: 0004437 inositol or phosphatidylinositol phosphatase activity; PDB: 1IMF_A 1IMA_A 1IMB_A 1IMD_A 1IMC_A 1IME_A 1AWB_A 2HHM_B 2QFL_A 1INP_A ....
Probab=24.19  E-value=17  Score=28.99  Aligned_cols=26  Identities=15%  Similarity=0.289  Sum_probs=22.9

Q ss_pred             CCeeEecCCCceEeeecccceeeehh
Q psy2610          41 SDLYFSPDRGNVVFASAFDGWGFTID   66 (133)
Q Consensus        41 ~~~~fsP~~GNV~FaSal~GW~Ftl~   66 (133)
                      --|.++|..|+--|..++..|+.+|-
T Consensus        85 ~~wviDPIDGT~nf~~g~p~~~i~ia  110 (270)
T PF00459_consen   85 YTWVIDPIDGTRNFVRGLPEFAISIA  110 (270)
T ss_dssp             EEEEEEEEETHHHHHHTSSG-EEEEE
T ss_pred             eEEEecccccchhhhhhhhHHHHHHH
Confidence            46889999999999999999999886


No 40 
>PHA02107 hypothetical protein
Probab=23.84  E-value=61  Score=26.18  Aligned_cols=50  Identities=20%  Similarity=0.410  Sum_probs=28.0

Q ss_pred             CCCCCCCceeEEecCCCCCCCC---CCCceeeccc--CccccCCCCCeeEecCCC
Q psy2610           1 NGRNHNPNLTLVLRPGPQSTSS---PSDTVYTDWG--TGLEDADDSDLYFSPDRG   50 (133)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~---~~~~v~~~~~--~~~~~~~~~~~~fsP~~G   50 (133)
                      |||||--...+.|.++.-..+.   .+-++-.+..  .-.++++.+.++|+|+.|
T Consensus       115 NG~N~iV~FSi~L~~~~~apVK~V~~~~~~V~~~~~~EP~~~~~~~~IFF~~~~~  169 (216)
T PHA02107        115 NGSNHVVTFSVDLPNGDKAPVKNVETKTEVVSTVDYTEPAKEPDGQNIFFAPETM  169 (216)
T ss_pred             CCccceEEEEEEcCCccccCccchhhccchhhhccccCCccccccceeeecHHHH
Confidence            7999988888887765443322   2222212211  223344566788888765


No 41 
>PRK10130 transcriptional regulator EutR; Provisional
Probab=23.72  E-value=65  Score=27.52  Aligned_cols=28  Identities=25%  Similarity=0.521  Sum_probs=20.7

Q ss_pred             eecccceee-ehhHHHHHHHhhcCCCHHH
Q psy2610          55 ASAFDGWGF-TIDDFARLYSAKLGIREDI   82 (133)
Q Consensus        55 aSal~GW~F-tl~~FA~~Y~~K~gi~~~~   82 (133)
                      +..=.-||| ++..|++.|.+.||+.|..
T Consensus       312 ~eIA~~~GF~~~s~Fs~~fk~~fG~tPs~  340 (350)
T PRK10130        312 KDAAMQWGFWHLGQFATDYQQLFAEKPSL  340 (350)
T ss_pred             HHHHHHhCCCCHHHHHHHHHHHHCcCcHH
Confidence            333445666 6899999999999987654


No 42 
>PRK10219 DNA-binding transcriptional regulator SoxS; Provisional
Probab=22.75  E-value=86  Score=21.34  Aligned_cols=24  Identities=17%  Similarity=0.358  Sum_probs=20.0

Q ss_pred             ehhHHHHHHHhhcCCCHHHHHHhh
Q psy2610          64 TIDDFARLYSAKLGIREDILRKTL   87 (133)
Q Consensus        64 tl~~FA~~Y~~K~gi~~~~L~k~L   87 (133)
                      +...|.+.|.+.+|+.|.++.+++
T Consensus        84 ~~s~f~~~Fk~~~G~tP~~~r~~~  107 (107)
T PRK10219         84 SQQTFSRVFRRQFDRTPSDYRHRL  107 (107)
T ss_pred             CHHHHHHHHHHHHCcCHHHHHhcC
Confidence            467899999999999999887653


No 43 
>PRK10572 DNA-binding transcriptional regulator AraC; Provisional
Probab=22.70  E-value=81  Score=25.06  Aligned_cols=28  Identities=18%  Similarity=0.283  Sum_probs=21.3

Q ss_pred             ceeee-hhHHHHHHHhhcCCCHHHHHHhh
Q psy2610          60 GWGFT-IDDFARLYSAKLGIREDILRKTL   87 (133)
Q Consensus        60 GW~Ft-l~~FA~~Y~~K~gi~~~~L~k~L   87 (133)
                      .+||+ ...|.+.+.+.+|++|.++.++.
T Consensus       257 ~~GF~d~s~Fsr~FKk~~G~SP~~yR~~~  285 (290)
T PRK10572        257 NVGYDDQLYFSRVFKKCTGASPSEFRARC  285 (290)
T ss_pred             HhCCCCHHHHHHHHHHHHCcCHHHHHHHh
Confidence            34455 78889999888899888877654


No 44 
>PF12833 HTH_18:  Helix-turn-helix domain; PDB: 2K9S_A 3LSG_C 3OIO_A 1D5Y_B 3GBG_A 3OOU_A 1BL0_A 1XS9_A 3MN2_B 3MKL_B ....
Probab=22.66  E-value=1e+02  Score=19.67  Aligned_cols=23  Identities=22%  Similarity=0.443  Sum_probs=18.3

Q ss_pred             ehhHHHHHHHhhcCCCHHHHHHh
Q psy2610          64 TIDDFARLYSAKLGIREDILRKT   86 (133)
Q Consensus        64 tl~~FA~~Y~~K~gi~~~~L~k~   86 (133)
                      +...|.+.+.+.+|++|.++.++
T Consensus        59 ~~~~f~~~fk~~~g~tP~~~r~r   81 (81)
T PF12833_consen   59 SQSHFSRAFKRYFGMTPSEYRKR   81 (81)
T ss_dssp             SHHHHHHHHHHHHSS-HHHHHHH
T ss_pred             CHHHHHHHHHHHHCcCHHHHHcc
Confidence            36889999999999999887763


No 45 
>PF00574 CLP_protease:  Clp protease;  InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to the MEROPS peptidase family S14 (ClpP endopeptidase family, clan SK). ClpP is an ATP-dependent protease that cleaves a number of proteins, such as casein and albumin []. It exists as a heterodimer of ATP-binding regulatory A and catalytic P subunits, both of which are required for effective levels of protease activity in the presence of ATP [], although the P subunit alone does possess some catalytic activity. This family of sequences represent the P subunit. Proteases highly similar to ClpP have been found to be encoded in the genome of bacteria, metazoa, some viruses and in the chloroplast of plants. A number of the proteins in this family are classified as non-peptidase homologues as they have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for catalytic activity. ; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis; PDB: 2ZL3_L 2ZL0_F 2ZL2_M 2ZL4_C 1TG6_D 2F6I_D 3V5I_b 3V5E_M 3QWD_D 2DEO_A ....
Probab=21.63  E-value=81  Score=23.70  Aligned_cols=31  Identities=19%  Similarity=0.482  Sum_probs=23.5

Q ss_pred             hHHHHHHHhhcCCCHHHHHHhhhcccceecC
Q psy2610          66 DDFARLYSAKLGIREDILRKTLWGDYYLNAK   96 (133)
Q Consensus        66 ~~FA~~Y~~K~gi~~~~L~k~LWGD~Yyd~k   96 (133)
                      +.++++|+++.|++++.+.+.+=.|.|+.++
T Consensus       137 ~~~~~~~~~~tg~~~~~i~~~~~~~~~l~a~  167 (182)
T PF00574_consen  137 ERIANIYAERTGLSKEEIEELMDRDTWLSAE  167 (182)
T ss_dssp             HHHHHHHHHHHTS-HHHHHHHCSSTEEEEHH
T ss_pred             HHHHHHHHHHhCCcHHHHHHHHhCCccccHH
Confidence            3457888888899999998887777777664


No 46 
>PF12244 DUF3606:  Protein of unknown function (DUF3606);  InterPro: IPR022037  This family of proteins is found in bacteria. Proteins in this family are typically between 58 and 85 amino acids in length. There is a single completely conserved residue G that may be functionally important. 
Probab=20.91  E-value=91  Score=19.99  Aligned_cols=18  Identities=28%  Similarity=0.748  Sum_probs=14.4

Q ss_pred             HHHHhhcCCCHHHHHHhh
Q psy2610          70 RLYSAKLGIREDILRKTL   87 (133)
Q Consensus        70 ~~Y~~K~gi~~~~L~k~L   87 (133)
                      +.++++||++++.|....
T Consensus        24 ~ywa~~~gvt~~~L~~AV   41 (57)
T PF12244_consen   24 RYWAKRFGVTEEQLREAV   41 (57)
T ss_pred             HHHHHHHCcCHHHHHHHH
Confidence            457888999999887764


Done!