BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy2623
         (707 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3SH6|A Chain A, Frog M-Ferritin, D122r Mutant, With Magnesium
          Length = 176

 Score = 31.2 bits (69), Expect = 2.2,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 9/53 (16%)

Query: 405 WGGPSPVSLKSVNRMTKMEKNNENAMIVILSDVH-LDNDKVRNNLCEFITSEF 456
           WG     +L+++    ++EK    A++    D+H L  DKVR +LC+F+ SE+
Sbjct: 90  WGN----TLEAMQAALQLEKTVNQALL----DLHKLATDKVRPHLCDFLESEY 134


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.136    0.413 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,632,705
Number of Sequences: 62578
Number of extensions: 754261
Number of successful extensions: 1406
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1405
Number of HSP's gapped (non-prelim): 3
length of query: 707
length of database: 14,973,337
effective HSP length: 106
effective length of query: 601
effective length of database: 8,340,069
effective search space: 5012381469
effective search space used: 5012381469
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)