Diaphorina citri psyllid: psy2627


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MNEAVRGKAIDTRLEPSNNVMSVFQMLEHFNKLIDETPPIDQPQRFGNKAFAQWLNKIGECVETELQKALPEKFHAAIPEISVYLKESFGNSTRIDYGTGHEMAFCMFLLCLFRIGAFSMNDRVAVVNRIFVRYLDLVRRLQCEYRMEPAGSHGVWSLDDYQFVPFIWGSSQLFAFSSKNAVGPDHVYAIPKRQVLKDSDMKQWENSEAYHVKTGHFSEHSNQLWNISALPSWSKINQGLLKMYKGEVLAKFPVIQHVLFGSLIKFEPLQHDIRTPVMTARPLPPKFTSEFTKPLCDGDVTSANTSSQS
cccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHcccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*****RGKAIDTRLEPSNNVMSVFQMLEHFNKLIDETPPIDQPQRFGNKAFAQWLNKIGECVETELQKALPEKFHAAIPEISVYLKESFGNSTRIDYGTGHEMAFCMFLLCLFRIGAFSMNDRVAVVNRIFVRYLDLVRRLQCEYRMEPAGSHGVWSLDDYQFVPFIWGSSQLFAFSSKNAVGPDHVYAIPKRQVLKDSDMKQWENSEAYHVKTGHFSEHSNQLWNISALPSWSKINQGLLKMYKGEVLAKFPVIQHVLFGSLIKFEPLQ***************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNEAVRGKAIDTRLEPSNNVMSVFQMLEHFNKLIDETPPIDQPQRFGNKAFAQWLNKIGECVETELQKALPEKFHAAIPEISVYLKESFGNSTRIDYGTGHEMAFCMFLLCLFRIGAFSMNDRVAVVNRIFVRYLDLVRRLQCEYRMEPAGSHGVWSLDDYQFVPFIWGSSQLFAFSSKNAVGPDHVYAIPKRQVLKDSDMKQWENSEAYHVKTGHFSEHSNQLWNISALPSWSKINQGLLKMYKGEVLAKFPVIQHVLFGSLIKFEPLQHDIRTPVMTARPLPPKFTSEFTKPLCDGDVTSANTSSQS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable serine/threonine-protein phosphatase 2A activator 1 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Acts as a regulatory subunit for PP2A-like phosphatases modulating their activity or substrate specificity, probably by inducing a conformational change in the catalytic subunit, a direct target of the PPIase.confidentQ55CJ3
Serine/threonine-protein phosphatase 2A activator PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Acts as a regulatory subunit for serine/threonine-protein phosphatase 2A (PP2A) modulating its activity or substrate specificity, probably by inducing a conformational change in the catalytic subunit, a proposed direct target of the PPIase. Can reactivate inactive phosphatase PP2A-phosphatase methylesterase complexes (PP2A(i)) in presence of ATP and Mg(2+). Reversibly stimulates the variable phosphotyrosyl phosphatase activity of PP2A core heterodimer PP2A(D) in presence of ATP and Mg(2+) (in vitro). The phosphotyrosyl phosphatase activity is dependent of an ATPase activty of the PP2A(D):PPP2R4 complex. Is involved in apoptosis; the function appears to be independent from PP2A.confidentP58389
Serine/threonine-protein phosphatase 2A activator PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Acts as a regulatory subunit for serine/threonine-protein phosphatase 2A (PP2A) modulating its activity or substrate specificity, probably by inducing a conformational change in the catalytic subunit, a proposed direct target of the PPIase. Can reactivate inactive phosphatase PP2A-phosphatase methylesterase complexes (PP2A(i)) in presence of ATP and Mg(2+) (By similarity). Reversibly stimulates the variable phosphotyrosyl phosphatase activity of PP2A core heterodimer PP2A(D) in presence of ATP and Mg(2+) (in vitro). The phosphotyrosyl phosphatase activity is dependent of an ATPase activty of the PP2A(D):PPP2R4 complex. Is involved in apoptosis; the function appears to be independent from PP2A.confidentQ2KJ44

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusconfidentGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008160 [MF]protein tyrosine phosphatase activator activityprobableGO:0019211, GO:0072542, GO:0019208, GO:0019888, GO:0003674, GO:0008047, GO:0030234
GO:0034704 [CC]calcium channel complexprobableGO:0043234, GO:0032991, GO:0016021, GO:0016020, GO:0005575, GO:0034702, GO:0034703, GO:0044425, GO:0031224
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0030472 [BP]mitotic spindle organization in nucleusprobableGO:0006996, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0007051, GO:0007052, GO:0022402, GO:0044699, GO:0000226, GO:0007049
GO:0035307 [BP]positive regulation of protein dephosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0035303, GO:0035304, GO:0035306, GO:0032268, GO:0031401, GO:0048522
GO:0008601 [MF]protein phosphatase type 2A regulator activityprobableGO:0019888, GO:0019208, GO:0003674, GO:0030234
GO:0000159 [CC]protein phosphatase type 2A complexprobableGO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0003755 [MF]peptidyl-prolyl cis-trans isomerase activityprobableGO:0003824, GO:0003674, GO:0016853, GO:0016859
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0051721 [MF]protein phosphatase 2A bindingprobableGO:0019899, GO:0019903, GO:0019902, GO:0003674, GO:0005488, GO:0005515
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0032515 [BP]negative regulation of phosphoprotein phosphatase activityprobableGO:0051336, GO:0051174, GO:0060191, GO:0019220, GO:0043666, GO:0050790, GO:0065009, GO:0010921, GO:0031323, GO:0010923, GO:0019222, GO:0050789, GO:0051004, GO:0065007, GO:0044092, GO:0008150, GO:0035303, GO:0050794, GO:0043086, GO:0051346
GO:0032516 [BP]positive regulation of phosphoprotein phosphatase activityprobableGO:0051336, GO:0051174, GO:0060191, GO:0019220, GO:0043666, GO:0051345, GO:0010921, GO:0010922, GO:0050790, GO:0019222, GO:0031323, GO:0051004, GO:0050789, GO:0065007, GO:0044093, GO:0008150, GO:0035303, GO:0050794, GO:0065009, GO:0043085
GO:0043065 [BP]positive regulation of apoptotic processprobableGO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0035308 [BP]negative regulation of protein dephosphorylationprobableGO:0019220, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0009892, GO:0050789, GO:0051248, GO:0010605, GO:0010563, GO:0051246, GO:0065007, GO:0031399, GO:0048519, GO:0045936, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0035303, GO:0035305, GO:0035304, GO:0032269, GO:0032268, GO:0031400, GO:0048523
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000413 [BP]protein peptidyl-prolyl isomerizationprobableGO:0044267, GO:0018208, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0006457 [BP]protein foldingprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.2.-.-Cis-trans-isomerases.probable
5.2.1.-Cis-trans Isomerases.probable
5.2.1.8Peptidylprolyl isomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IXM, chain A
Confidence level:very confident
Coverage over the Query: 1-177,188-271
View the alignment between query and template
View the model in PyMOL