Diaphorina citri psyllid: psy2636


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-----
TQLGRSSSSESPKLRHSAPLSSASSSPGCDTSRPTPPSPSQLCAVCGDIAACQHYGVRTCEGCKGFFKRTVQKGSKYVCLADKACPVDKRRRNRCQFCRFQKCLQVGMVKEVVRTDSLKGRRGRLPSKPKSPQESPPSPPVSLITALYREPNPLEPPIAEPEKIQQFYSLLTTSVDVIRHFADKIPGFSDLCKEDQELLFQSASLELFYREPNPLEPPIAEPEKIQQFYSLLTTSVDVIRHFADKIPGFSDLCKEDQELLFQSASLELFVLRLAYRTRAEDTKLIFCNGVVLEKQQCQRSFGDDWLNAILEFCQSLHLMEIDISAFACLCALTLI
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccCECcccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEECcccEEEHHHHHHHHcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHc
*****************************************LCAVCGDIAACQHYGVRTCEGCKGFFKRTVQKGSKYVCLADKACPVDKRRRNRCQFCRFQKCLQVGMVKEVVR************************************************KIQQFYSLLTTSVDVIRHFADKIPGFSDLCKEDQELLFQSASLELFYRE***********EKIQQFYSLLTTSVDVIRHFADKIPGFSDLCKEDQELLFQSASLELFVLRLAYRTRAEDTKLIFCNGVVLEKQQCQRSFGDDWLNAILEFCQSLHLMEIDISAFACLCALTLI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TQLGRSSSSESPKLRHSAPLSSASSSPGCDTSRPTPPSPSQLCAVCGDIAACQHYGVRTCEGCKGFFKRTVQKGSKYVCLADKACPVDKRRRNRCQFCRFQKCLQVGMVKEVVRTDSLKGRRGRLPSKPKSPQESPPSPPVSLITALYREPNPLEPPIAEPEKIQQFYSLLTTSVDVIRHFADKIPGFSDLCKEDQELLFQSASLELFYREPNPLEPPIAEPEKIQQFYSLLTTSVDVIRHFADKIPGFSDLCKEDQELLFQSASLELFVLRLAYRTRAEDTKLIFCNGVVLEKQQCQRSFGDDWLNAILEFCQSLHLMEIDISAFACLCALTLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear receptor subfamily 4 group A member 1 Orphan nuclear receptor. May act concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3'. May inhibit NF-kappa-B transactivation of IL2.confidentP22829
Nuclear receptor subfamily 4 group A member 1 Orphan nuclear receptor. May act concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3'. May inhibit NF-kappa-B transactivation of IL2.confidentP51666
Nuclear receptor subfamily 4 group A member 1 Orphan nuclear receptor. May act concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3' (By similarity). May inhibit NF-kappa-B transactivation of IL2.confidentP22736

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0000977 [MF]RNA polymerase II regulatory region sequence-specific DNA bindingprobableGO:0043565, GO:0044212, GO:0001067, GO:0003677, GO:0001012, GO:0000976, GO:0005488, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363
GO:0043154 [BP]negative regulation of cysteine-type endopeptidase activity involved in apoptotic processprobableGO:0019222, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0044699, GO:0051346, GO:2000116, GO:2000117, GO:0043086, GO:0043067, GO:0010466, GO:0065007, GO:0044092, GO:0043281, GO:0065009, GO:0010259, GO:0006915, GO:0052547, GO:0052548, GO:0009987, GO:0050794, GO:0012501, GO:0044763, GO:0010951, GO:0051336, GO:0050790, GO:0008150
GO:0071310 [BP]cellular response to organic substanceprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0006917 [BP]induction of apoptosisprobableGO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0051179 [BP]localizationprobableGO:0008150
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PDU, chain A
Confidence level:very confident
Coverage over the Query: 219-335
View the alignment between query and template
View the model in PyMOL
Template: 3DZY, chain D
Confidence level:very confident
Coverage over the Query: 40-167,178-204,219-335
View the alignment between query and template
View the model in PyMOL