Query         psy2647
Match_columns 72
No_of_seqs    123 out of 1187
Neff          12.0
Searched_HMMs 46136
Date          Fri Aug 16 21:33:26 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2647.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2647hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 6.7E-23 1.5E-27  101.6   3.3   64    8-72    184-247 (279)
  2 KOG2462|consensus               99.8   5E-19 1.1E-23   88.0   3.2   60    2-61    206-265 (279)
  3 KOG3623|consensus               99.6 7.8E-17 1.7E-21   88.9   2.6   63    9-72    892-954 (1007)
  4 KOG3623|consensus               99.6 2.5E-16 5.3E-21   87.0   1.9   62    3-64    914-975 (1007)
  5 KOG3576|consensus               99.4 1.7E-14 3.8E-19   69.9   0.1   52    9-60    143-194 (267)
  6 KOG3576|consensus               99.4 6.6E-14 1.4E-18   67.9  -0.3   63    9-72    115-177 (267)
  7 PHA02768 hypothetical protein;  99.3 3.3E-13 7.1E-18   53.2   1.1   44   11-56      5-48  (55)
  8 KOG1074|consensus               99.3 1.4E-13 3.1E-18   77.1   0.1   56   11-67    353-408 (958)
  9 PHA00733 hypothetical protein   99.2 2.3E-11   5E-16   55.9   4.6   56    7-64     69-124 (128)
 10 KOG1074|consensus               99.2 8.1E-12 1.8E-16   70.3   1.6   58   11-69    605-662 (958)
 11 PF13465 zf-H2C2_2:  Zinc-finge  99.1 3.6E-11 7.8E-16   41.1   1.8   25   26-50      1-25  (26)
 12 KOG3608|consensus               99.1   1E-10 2.2E-15   61.1   2.7   62    9-72    235-296 (467)
 13 PHA00616 hypothetical protein   99.0 2.2E-10 4.8E-15   43.3   2.0   31   39-70      1-31  (44)
 14 PHA02768 hypothetical protein;  98.8 4.6E-09   1E-13   41.5   2.4   25   39-63      5-29  (55)
 15 PHA00616 hypothetical protein   98.8 3.5E-09 7.6E-14   40.1   1.8   34   11-44      1-34  (44)
 16 KOG3608|consensus               98.7 2.4E-08 5.2E-13   52.5   4.3   51   11-61    263-314 (467)
 17 PHA00732 hypothetical protein   98.7 1.4E-08 2.9E-13   43.3   1.9   45   11-61      1-46  (79)
 18 PF05605 zf-Di19:  Drought indu  98.6 1.4E-07 3.1E-12   37.4   4.2   51   11-64      2-54  (54)
 19 PLN03086 PRLI-interacting fact  98.6 8.9E-08 1.9E-12   53.2   4.2   57    9-71    451-507 (567)
 20 PHA00733 hypothetical protein   98.5 7.5E-08 1.6E-12   44.5   2.4   54    8-61     37-95  (128)
 21 PF00096 zf-C2H2:  Zinc finger,  98.5 6.3E-08 1.4E-12   31.9   1.6   22   40-61      1-22  (23)
 22 PF13465 zf-H2C2_2:  Zinc-finge  98.5 1.3E-08 2.9E-13   34.6  -0.4   21    2-22      5-25  (26)
 23 PF13894 zf-C2H2_4:  C2H2-type   98.4 2.2E-07 4.7E-12   30.6   2.0   24   40-63      1-24  (24)
 24 KOG3993|consensus               98.4   2E-07 4.4E-12   50.0   2.3   54   11-64    295-381 (500)
 25 PF13912 zf-C2H2_6:  C2H2-type   98.4 1.2E-07 2.7E-12   32.3   0.8   24   39-62      1-24  (27)
 26 PLN03086 PRLI-interacting fact  98.4 5.2E-07 1.1E-11   50.3   3.3   58   10-71    477-544 (567)
 27 PF00096 zf-C2H2:  Zinc finger,  98.3 4.7E-07   1E-11   29.7   1.3   23   12-34      1-23  (23)
 28 KOG3993|consensus               98.3 9.8E-08 2.1E-12   51.2  -0.6   52   11-62    267-318 (500)
 29 COG5189 SFP1 Putative transcri  98.0 1.6E-06 3.5E-11   45.3   0.7   52    9-60    347-419 (423)
 30 smart00355 ZnF_C2H2 zinc finge  97.9 1.9E-05   4E-10   26.1   2.5   22   40-61      1-22  (26)
 31 PF13912 zf-C2H2_6:  C2H2-type   97.9 4.3E-06 9.4E-11   28.4   0.7   25   11-35      1-25  (27)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.9 1.5E-05 3.2E-10   26.0   1.7   23   12-34      1-23  (24)
 33 PF12756 zf-C2H2_2:  C2H2 type   97.8   3E-05 6.4E-10   34.0   2.6   49   14-62      2-73  (100)
 34 PF09237 GAGA:  GAGA factor;  I  97.8   4E-05 8.6E-10   29.9   2.4   29   36-64     21-49  (54)
 35 PF13909 zf-H2C2_5:  C2H2-type   97.8   3E-05 6.6E-10   25.5   1.9   23   40-63      1-23  (24)
 36 PHA00732 hypothetical protein   97.7   4E-05 8.6E-10   32.8   2.2   26   39-64      1-26  (79)
 37 PF09237 GAGA:  GAGA factor;  I  97.7 6.7E-05 1.5E-09   29.3   2.5   32    8-39     21-52  (54)
 38 PRK04860 hypothetical protein;  97.7 3.2E-05 6.9E-10   37.2   1.9   37   11-51    119-155 (160)
 39 PF12874 zf-met:  Zinc-finger o  97.4 9.3E-05   2E-09   24.5   0.9   22   40-61      1-22  (25)
 40 PF13913 zf-C2HC_2:  zinc-finge  96.9  0.0014 3.1E-08   21.9   1.9   20   40-60      3-22  (25)
 41 PF12171 zf-C2H2_jaz:  Zinc-fin  96.8 0.00034 7.4E-09   23.7   0.3   21   12-32      2-22  (27)
 42 KOG2893|consensus               96.6 0.00046 9.9E-09   35.3  -0.2   43    9-56      9-51  (341)
 43 PF05605 zf-Di19:  Drought indu  96.5  0.0051 1.1E-07   24.3   2.6   32   39-71      2-34  (54)
 44 smart00451 ZnF_U1 U1-like zinc  96.1  0.0045 9.7E-08   22.0   1.3   22   39-60      3-24  (35)
 45 PRK04860 hypothetical protein;  95.6  0.0081 1.8E-07   29.1   1.3   28   39-71    119-146 (160)
 46 cd00350 rubredoxin_like Rubred  95.5  0.0083 1.8E-07   21.3   1.0   24   12-47      2-25  (33)
 47 COG5048 FOG: Zn-finger [Genera  95.4  0.0025 5.5E-08   34.3  -0.9   56   11-67    289-350 (467)
 48 PF09538 FYDLN_acid:  Protein o  95.2   0.013 2.8E-07   26.7   1.2   30   12-52     10-39  (108)
 49 COG4049 Uncharacterized protei  95.2   0.016 3.5E-07   23.1   1.3   25   36-60     14-38  (65)
 50 KOG1146|consensus               95.1   0.022 4.8E-07   35.7   2.2   55    7-61    461-540 (1406)
 51 COG1592 Rubrerythrin [Energy p  93.6   0.046   1E-06   26.8   1.2   23   11-46    134-156 (166)
 52 COG2888 Predicted Zn-ribbon RN  93.4   0.039 8.5E-07   22.3   0.7   32   11-47     27-58  (61)
 53 KOG2186|consensus               93.0   0.065 1.4E-06   28.0   1.3   47   11-60      3-49  (276)
 54 smart00659 RPOLCX RNA polymera  93.0    0.07 1.5E-06   20.3   1.1   29   11-50      2-30  (44)
 55 PF13719 zinc_ribbon_5:  zinc-r  93.0   0.076 1.6E-06   19.3   1.1   33   13-50      4-36  (37)
 56 PF09986 DUF2225:  Uncharacteri  92.6   0.021 4.5E-07   28.9  -0.7   42   10-51      4-60  (214)
 57 PRK00464 nrdR transcriptional   92.4   0.018 3.8E-07   27.8  -1.1   13   39-51     28-40  (154)
 58 cd00729 rubredoxin_SM Rubredox  92.1   0.097 2.1E-06   18.7   0.9   25   11-47      2-26  (34)
 59 TIGR02300 FYDLN_acid conserved  92.0    0.11 2.4E-06   24.4   1.2   30   12-52     10-39  (129)
 60 TIGR00373 conserved hypothetic  91.9   0.084 1.8E-06   25.6   0.9   33    9-50    107-139 (158)
 61 TIGR02605 CxxC_CxxC_SSSS putat  91.3   0.047   1E-06   21.2  -0.3   29   12-47      6-34  (52)
 62 PRK06266 transcription initiat  91.1     0.1 2.3E-06   25.8   0.7   32   10-50    116-147 (178)
 63 PF13717 zinc_ribbon_4:  zinc-r  91.0    0.16 3.4E-06   18.4   1.0   33   12-49      3-35  (36)
 64 smart00734 ZnF_Rad18 Rad18-lik  90.9    0.31 6.8E-06   16.3   1.6   20   40-60      2-21  (26)
 65 COG5189 SFP1 Putative transcri  90.6   0.062 1.4E-06   29.1  -0.3   24    8-31    395-418 (423)
 66 smart00834 CxxC_CXXC_SSSS Puta  90.1   0.068 1.5E-06   19.6  -0.3   29   12-47      6-34  (41)
 67 PF02892 zf-BED:  BED zinc fing  90.1    0.27 5.9E-06   18.3   1.4   25   37-61     14-42  (45)
 68 PRK00398 rpoP DNA-directed RNA  90.1    0.13 2.7E-06   19.6   0.4   31   10-50      2-32  (46)
 69 PF03604 DNA_RNApol_7kD:  DNA d  90.0    0.19   4E-06   17.8   0.8   28   12-50      1-28  (32)
 70 PF05443 ROS_MUCR:  ROS/MUCR tr  89.8    0.22 4.8E-06   23.6   1.2   24   39-65     72-95  (132)
 71 PF04959 ARS2:  Arsenite-resist  89.8    0.13 2.8E-06   26.3   0.4   25   39-63     77-101 (214)
 72 PF13451 zf-trcl:  Probable zin  89.7    0.23   5E-06   19.4   1.0   38    9-46      2-40  (49)
 73 TIGR02098 MJ0042_CXXC MJ0042 f  89.6    0.22 4.8E-06   18.0   0.9   34   12-50      3-36  (38)
 74 PF12013 DUF3505:  Protein of u  89.2    0.44 9.6E-06   21.5   1.9   25   40-64     81-109 (109)
 75 smart00531 TFIIE Transcription  88.7    0.18 3.8E-06   24.2   0.4   38    9-50     97-134 (147)
 76 PRK14890 putative Zn-ribbon RN  88.3    0.16 3.5E-06   20.6   0.1   32   11-47     25-56  (59)
 77 COG1996 RPC10 DNA-directed RNA  88.0    0.24 5.2E-06   19.4   0.5   30   10-49      5-34  (49)
 78 KOG2893|consensus               87.1    0.31 6.7E-06   25.5   0.8   26   37-63      9-34  (341)
 79 smart00614 ZnF_BED BED zinc fi  86.0    0.93   2E-05   17.5   1.7   21   40-60     19-44  (50)
 80 COG3357 Predicted transcriptio  85.6    0.52 1.1E-05   20.9   1.0   12   11-22     58-69  (97)
 81 PF12907 zf-met2:  Zinc-binding  85.4    0.22 4.7E-06   18.6  -0.2   20   41-60      3-25  (40)
 82 COG5048 FOG: Zn-finger [Genera  83.1    0.94   2E-05   24.7   1.5   53    9-61     31-85  (467)
 83 COG1997 RPL43A Ribosomal prote  82.1    0.64 1.4E-05   20.4   0.5   30   11-50     35-64  (89)
 84 PHA00626 hypothetical protein   81.1    0.86 1.9E-05   18.4   0.7   16   37-52     21-36  (59)
 85 PF10571 UPF0547:  Uncharacteri  80.6    0.85 1.8E-05   15.3   0.5   10   41-50     16-25  (26)
 86 PF07754 DUF1610:  Domain of un  80.4    0.69 1.5E-05   15.3   0.3    9   38-46     15-23  (24)
 87 KOG4167|consensus               80.2    0.47   1E-05   28.7  -0.3   24   39-62    792-815 (907)
 88 KOG1842|consensus               79.4     1.7 3.8E-05   24.9   1.7   21   12-32     16-36  (505)
 89 COG4391 Uncharacterized protei  78.7    0.46 9.9E-06   19.5  -0.4   42    5-50     18-59  (62)
 90 PRK09678 DNA-binding transcrip  78.0    0.66 1.4E-05   19.7  -0.1   39   12-52      2-42  (72)
 91 KOG1146|consensus               77.9    0.56 1.2E-05   30.2  -0.4   47   17-63    442-489 (1406)
 92 PRK03824 hypA hydrogenase nick  77.1    0.84 1.8E-05   21.7   0.1   15   10-24     69-83  (135)
 93 COG1571 Predicted DNA-binding   76.5       2 4.3E-05   24.5   1.4   29   13-52    352-380 (421)
 94 PF08790 zf-LYAR:  LYAR-type C2  76.4    0.38 8.1E-06   16.5  -0.8    8   42-49      3-10  (28)
 95 TIGR00622 ssl1 transcription f  75.7     2.9 6.2E-05   19.4   1.6   20   11-30     15-34  (112)
 96 PF09723 Zn-ribbon_8:  Zinc rib  75.5    0.96 2.1E-05   16.9   0.1   12   40-51      6-17  (42)
 97 KOG3408|consensus               75.5     2.6 5.6E-05   19.8   1.4   24   38-61     56-79  (129)
 98 PF15269 zf-C2H2_7:  Zinc-finge  75.4     2.4 5.2E-05   16.3   1.1   22   40-61     21-42  (54)
 99 PF05191 ADK_lid:  Adenylate ki  75.2    0.63 1.4E-05   16.9  -0.4   31   13-51      3-33  (36)
100 PF04780 DUF629:  Protein of un  75.0     3.2   7E-05   24.0   2.0   26   39-64     57-82  (466)
101 KOG4167|consensus               74.7    0.82 1.8E-05   27.8  -0.3   25   11-35    792-816 (907)
102 COG4530 Uncharacterized protei  73.6       2 4.3E-05   19.8   0.8   27   13-50     11-37  (129)
103 KOG2482|consensus               72.5     2.7 5.9E-05   23.4   1.3   22   40-61    196-217 (423)
104 cd00924 Cyt_c_Oxidase_Vb Cytoc  70.8     2.1 4.6E-05   19.3   0.6   13   10-22     78-90  (97)
105 COG4957 Predicted transcriptio  70.2     2.1 4.6E-05   20.5   0.6   20   41-63     78-97  (148)
106 KOG2785|consensus               70.1     7.4 0.00016   22.1   2.6   51   11-61    166-242 (390)
107 PF09845 DUF2072:  Zn-ribbon co  69.2     2.6 5.6E-05   20.1   0.7   14   39-52      1-14  (131)
108 PF08274 PhnA_Zn_Ribbon:  PhnA   68.6     1.9   4E-05   15.0   0.2   11   37-47     17-27  (30)
109 COG3091 SprT Zn-dependent meta  68.1     1.9 4.2E-05   21.1   0.2   33   11-48    117-149 (156)
110 TIGR00100 hypA hydrogenase nic  67.7     2.4 5.1E-05   19.6   0.4   24   12-47     71-94  (115)
111 smart00154 ZnF_AN1 AN1-like Zi  66.9     2.7 5.8E-05   15.5   0.4   13   39-51     12-24  (39)
112 COG1326 Uncharacterized archae  66.7     5.6 0.00012   20.4   1.6   34   12-49      7-40  (201)
113 COG3364 Zn-ribbon containing p  66.5       3 6.4E-05   19.0   0.6   13   39-51      2-14  (112)
114 COG0068 HypF Hydrogenase matur  66.2     2.7 5.9E-05   25.7   0.5   28   14-47    154-181 (750)
115 KOG0717|consensus               65.8     3.9 8.4E-05   23.8   1.1   22   40-61    293-314 (508)
116 PLN02294 cytochrome c oxidase   65.4     3.3 7.1E-05   20.7   0.7   14   10-23    140-153 (174)
117 PF08209 Sgf11:  Sgf11 (transcr  65.3     5.2 0.00011   14.2   1.0   20   40-60      5-24  (33)
118 KOG0978|consensus               64.9     2.5 5.4E-05   25.7   0.3   18   38-55    677-694 (698)
119 COG1655 Uncharacterized protei  64.8    0.85 1.8E-05   23.8  -1.4   25    9-33     17-41  (267)
120 PRK12380 hydrogenase nickel in  64.7     3.5 7.5E-05   19.0   0.7   24   12-47     71-94  (113)
121 KOG2071|consensus               64.0     6.6 0.00014   23.5   1.7   25   37-61    416-440 (579)
122 PF07975 C1_4:  TFIIH C1-like d  62.1     4.2 9.1E-05   16.1   0.6   13   12-24     22-34  (51)
123 COG2331 Uncharacterized protei  62.0     5.8 0.00012   17.1   1.0   32   11-49     12-43  (82)
124 PF14311 DUF4379:  Domain of un  61.9     7.9 0.00017   15.2   1.4   11   40-50     29-39  (55)
125 PF01428 zf-AN1:  AN1-like Zinc  61.8     1.9 4.1E-05   16.1  -0.4   15   38-52     12-26  (43)
126 PF02176 zf-TRAF:  TRAF-type zi  61.8     3.9 8.4E-05   16.1   0.5   39   11-50      9-53  (60)
127 PF02891 zf-MIZ:  MIZ/SP-RING z  61.2     3.9 8.4E-05   15.9   0.4   10   38-47     40-49  (50)
128 PF13878 zf-C2H2_3:  zinc-finge  60.4     9.7 0.00021   14.1   2.2   22   40-61     14-37  (41)
129 COG1675 TFA1 Transcription ini  59.8     7.2 0.00016   19.6   1.3   33    8-49    110-142 (176)
130 KOG3507|consensus               59.8     4.1 8.9E-05   16.6   0.4   31   11-52     20-50  (62)
131 PF04423 Rad50_zn_hook:  Rad50   59.3     3.5 7.6E-05   16.1   0.2   12   41-52     22-33  (54)
132 PF07503 zf-HYPF:  HypF finger;  59.3     1.4 2.9E-05   15.9  -0.9   12   39-50     21-32  (35)
133 PTZ00255 60S ribosomal protein  58.7     2.6 5.7E-05   18.7  -0.3   12   39-50     54-65  (90)
134 KOG4173|consensus               58.3      11 0.00023   19.7   1.7   52   13-64    108-171 (253)
135 TIGR00627 tfb4 transcription f  57.7       8 0.00017   20.9   1.3    8   41-48    271-278 (279)
136 smart00440 ZnF_C2C2 C2C2 Zinc   56.9     0.5 1.1E-05   17.5  -2.3   10   40-49     29-38  (40)
137 PF07282 OrfB_Zn_ribbon:  Putat  56.9     6.6 0.00014   16.0   0.8   30   12-51     29-58  (69)
138 KOG2907|consensus               56.8     3.6 7.8E-05   19.1  -0.0   11   40-50    103-113 (116)
139 KOG2593|consensus               56.4      13 0.00028   21.6   2.0   35   10-47    127-161 (436)
140 PF14803 Nudix_N_2:  Nudix N-te  55.9     1.4 3.1E-05   15.8  -1.1   11   38-48     21-31  (34)
141 COG3677 Transposase and inacti  55.9     6.4 0.00014   18.7   0.7   35   12-51     31-65  (129)
142 PRK00564 hypA hydrogenase nick  55.4     5.1 0.00011   18.6   0.4   13   11-23     71-83  (117)
143 KOG2636|consensus               54.8      12 0.00025   21.9   1.7   27   33-59    395-422 (497)
144 COG1773 Rubredoxin [Energy pro  53.0     5.8 0.00013   16.0   0.3   15   10-24      2-16  (55)
145 KOG0562|consensus               51.4      16 0.00035   18.4   1.7   27   37-63    151-177 (184)
146 cd00730 rubredoxin Rubredoxin;  51.3     6.5 0.00014   15.4   0.3   11   40-50      2-12  (50)
147 PF01155 HypA:  Hydrogenase exp  50.6     4.1 8.8E-05   18.7  -0.3   25   12-48     71-95  (113)
148 PF10013 DUF2256:  Uncharacteri  50.6     9.6 0.00021   14.4   0.7   14   13-26     10-23  (42)
149 PF10276 zf-CHCC:  Zinc-finger   49.9     6.1 0.00013   14.7   0.1    9   40-48     30-38  (40)
150 COG5112 UFD2 U1-like Zn-finger  49.4     9.4  0.0002   17.6   0.7   23   10-32     54-76  (126)
151 PF14353 CpXC:  CpXC protein     48.7     7.4 0.00016   18.1   0.3   15   38-52     37-51  (128)
152 PHA02998 RNA polymerase subuni  48.4     1.8 3.9E-05   21.8  -1.7   13   40-52    172-184 (195)
153 PF10263 SprT-like:  SprT-like   47.8     6.5 0.00014   18.8   0.1   10   40-49    144-153 (157)
154 cd00065 FYVE FYVE domain; Zinc  46.8      17 0.00037   14.0   1.2   10   13-22      4-13  (57)
155 PRK05452 anaerobic nitric oxid  46.3     5.9 0.00013   23.0  -0.2   39    9-47    423-466 (479)
156 PRK03681 hypA hydrogenase nick  45.9     6.4 0.00014   18.2  -0.1   26   11-47     70-95  (114)
157 PF01286 XPA_N:  XPA protein N-  45.8     8.4 0.00018   13.9   0.2   12   41-52      5-16  (34)
158 PRK12860 transcriptional activ  45.1      15 0.00033   18.8   1.1   27   12-46    135-161 (189)
159 PF11672 DUF3268:  Protein of u  44.3     8.2 0.00018   17.6   0.1   10   11-20      2-11  (102)
160 PF04810 zf-Sec23_Sec24:  Sec23  44.3      11 0.00023   13.9   0.4   11    9-19     22-32  (40)
161 PF01927 Mut7-C:  Mut7-C RNAse   44.2     8.9 0.00019   18.4   0.3   13   39-51    124-136 (147)
162 PRK12722 transcriptional activ  44.1      16 0.00035   18.6   1.1   28   12-47    135-162 (187)
163 PF14255 Cys_rich_CPXG:  Cystei  44.0      11 0.00023   15.0   0.4    9   41-49      2-10  (52)
164 PRK04351 hypothetical protein;  43.8     9.6 0.00021   18.6   0.3   12   38-49    131-142 (149)
165 PF01194 RNA_pol_N:  RNA polyme  43.4      14 0.00031   15.2   0.7   14   39-52      4-17  (60)
166 PF01215 COX5B:  Cytochrome c o  43.3     7.7 0.00017   18.7  -0.0   14   10-23    111-124 (136)
167 PTZ00043 cytochrome c oxidase   42.9      13 0.00028   19.7   0.7   16    9-24    179-194 (268)
168 PLN03238 probable histone acet  42.9      27 0.00058   19.3   1.8   25   37-61     46-70  (290)
169 PF01363 FYVE:  FYVE zinc finge  42.3      13 0.00028   15.1   0.6   10   13-22     11-20  (69)
170 COG4888 Uncharacterized Zn rib  41.3     1.8 3.8E-05   19.7  -2.1   38    9-50     20-57  (104)
171 smart00064 FYVE Protein presen  41.0      20 0.00044   14.5   1.1   11   12-22     11-21  (68)
172 KOG1994|consensus               40.8      15 0.00032   19.5   0.7   22   10-31    238-259 (268)
173 PF13824 zf-Mss51:  Zinc-finger  40.1      18  0.0004   14.6   0.8   13    9-21     12-24  (55)
174 PF05180 zf-DNL:  DNL zinc fing  39.3     1.4 2.9E-05   18.4  -2.5   35   11-48      4-38  (66)
175 PRK14873 primosome assembly pr  38.9      25 0.00054   21.7   1.5   11   38-48    421-431 (665)
176 PF11931 DUF3449:  Domain of un  38.8      10 0.00022   19.5   0.0   23   37-59     99-122 (196)
177 PF10537 WAC_Acf1_DNA_bd:  ATP-  38.6      44 0.00096   15.3   2.0   37   11-48      3-39  (102)
178 TIGR00244 transcriptional regu  38.3      13 0.00029   18.2   0.4   13   39-51     28-40  (147)
179 PLN02748 tRNA dimethylallyltra  38.2      30 0.00066   20.4   1.7   23   38-60    417-440 (468)
180 TIGR00416 sms DNA repair prote  38.2      18  0.0004   21.0   0.9   10   11-20      7-16  (454)
181 PF09963 DUF2197:  Uncharacteri  38.1      11 0.00023   15.3  -0.0   38   13-50      4-42  (56)
182 COG1379 PHP family phosphoeste  37.8      15 0.00033   20.7   0.5   12   39-50    265-276 (403)
183 COG0675 Transposase and inacti  37.6      16 0.00035   19.6   0.6   15   37-51    320-334 (364)
184 PF06676 DUF1178:  Protein of u  37.4      45 0.00097   16.4   2.0   26   20-49     17-42  (148)
185 PRK11823 DNA repair protein Ra  37.1      21 0.00045   20.7   1.0   11   10-20      6-16  (446)
186 PF10083 DUF2321:  Uncharacteri  36.9      19  0.0004   17.9   0.7   21    9-29     66-86  (158)
187 PF06397 Desulfoferrod_N:  Desu  36.3      14 0.00031   13.5   0.2   10   39-48      6-15  (36)
188 KOG2231|consensus               36.3      66  0.0014   20.2   2.8   47   13-63    184-236 (669)
189 PF12230 PRP21_like_P:  Pre-mRN  36.2      12 0.00026   19.4   0.0   22   39-61    168-189 (229)
190 PF12773 DZR:  Double zinc ribb  36.1      21 0.00046   13.4   0.7   11   39-49     29-39  (50)
191 PF08792 A2L_zn_ribbon:  A2L zi  36.0      14 0.00029   13.1   0.1   12   39-50     21-32  (33)
192 COG0846 SIR2 NAD-dependent pro  35.6      21 0.00046   19.1   0.8   34   10-47    121-154 (250)
193 PRK08222 hydrogenase 4 subunit  35.3      34 0.00073   17.2   1.5   19   38-56    113-131 (181)
194 smart00731 SprT SprT homologue  35.3      12 0.00026   17.9  -0.0   11   39-49    133-143 (146)
195 PF09855 DUF2082:  Nucleic-acid  35.2      18  0.0004   15.0   0.5    8   40-47      1-8   (64)
196 PF14369 zf-RING_3:  zinc-finge  35.1      17 0.00037   13.0   0.3   10   13-22     23-32  (35)
197 PF03811 Zn_Tnp_IS1:  InsA N-te  35.0     5.8 0.00013   14.4  -0.9   12   34-45     24-35  (36)
198 KOG4727|consensus               35.0      22 0.00047   18.0   0.7   22   11-32     75-96  (193)
199 COG4338 Uncharacterized protei  34.7      13 0.00029   14.5   0.0   11   41-51     14-24  (54)
200 PTZ00448 hypothetical protein;  34.5      41 0.00089   19.3   1.8   23   39-61    314-336 (373)
201 TIGR03831 YgiT_finger YgiT-typ  33.8      16 0.00035   13.3   0.2   11   12-22     33-43  (46)
202 PTZ00409 Sir2 (Silent Informat  33.7      62  0.0013   17.6   2.3   15   10-24    136-150 (271)
203 PLN00104 MYST -like histone ac  33.6      35 0.00077   20.1   1.5   24   38-61    197-220 (450)
204 TIGR00595 priA primosomal prot  33.5      37 0.00081   20.1   1.6   10   38-47    252-261 (505)
205 PF00301 Rubredoxin:  Rubredoxi  33.3      13 0.00029   14.3  -0.1   36   12-47      2-42  (47)
206 PRK05978 hypothetical protein;  33.3      16 0.00034   17.9   0.2   11   40-50     53-63  (148)
207 cd01410 SIRT7 SIRT7: Eukaryoti  33.1      73  0.0016   16.4   2.5   36   10-48     94-129 (206)
208 PRK06260 threonine synthase; V  32.8      21 0.00045   20.2   0.6   10   12-21      4-13  (397)
209 TIGR01206 lysW lysine biosynth  32.2      20 0.00044   14.3   0.4   10   40-49      3-12  (54)
210 COG1594 RPB9 DNA-directed RNA   32.0     5.8 0.00013   18.3  -1.4   10   40-49    101-110 (113)
211 PLN03239 histone acetyltransfe  31.6      43 0.00093   19.1   1.6   24   37-60    104-127 (351)
212 PTZ00064 histone acetyltransfe  31.4      45 0.00097   20.1   1.7   25   37-61    278-302 (552)
213 TIGR00515 accD acetyl-CoA carb  31.2      27 0.00059   19.1   0.8   12   39-50     45-56  (285)
214 COG1198 PriA Primosomal protei  31.2      40 0.00087   21.2   1.5   13   36-48    472-484 (730)
215 PF07800 DUF1644:  Protein of u  31.1      79  0.0017   15.9   3.7   59   11-71     80-140 (162)
216 cd01413 SIR2_Af2 SIR2_Af2: Arc  30.8      58  0.0013   16.9   1.9   33   10-47    112-144 (222)
217 COG1327 Predicted transcriptio  30.6      22 0.00047   17.6   0.4   14   39-52     28-41  (156)
218 KOG4118|consensus               30.6      41 0.00088   14.2   1.1   26   39-64     38-63  (74)
219 PF14690 zf-ISL3:  zinc-finger   30.6      28 0.00061   12.8   0.7    9   39-47      2-10  (47)
220 PF14787 zf-CCHC_5:  GAG-polypr  30.5      21 0.00045   13.1   0.2   12   41-52      4-15  (36)
221 KOG0227|consensus               29.8      32  0.0007   17.8   0.9   21   11-31     53-73  (222)
222 PF06524 NOA36:  NOA36 protein;  29.8      11 0.00024   20.4  -0.7   25   10-34    208-232 (314)
223 PRK14138 NAD-dependent deacety  29.7      61  0.0013   17.2   1.9   34   10-47    118-151 (244)
224 PF02748 PyrI_C:  Aspartate car  29.4      21 0.00047   14.1   0.2   13    9-21     33-45  (52)
225 KOG1280|consensus               29.3      65  0.0014   18.5   2.0   22   11-32     79-100 (381)
226 COG1066 Sms Predicted ATP-depe  28.8      27 0.00058   20.5   0.6   12   10-21      6-17  (456)
227 PF10071 DUF2310:  Zn-ribbon-co  28.8      29 0.00064   18.8   0.7   29   11-46    220-248 (258)
228 KOG3497|consensus               28.7      18 0.00039   14.9  -0.0   14   39-52      4-17  (69)
229 PF13248 zf-ribbon_3:  zinc-rib  28.6      18 0.00039   11.8  -0.1    7   13-19      4-10  (26)
230 PF02146 SIR2:  Sir2 family;  I  28.5      18 0.00039   17.8  -0.1   35   11-49    105-139 (178)
231 PRK12387 formate hydrogenlyase  27.7      48   0.001   16.6   1.3   18   38-55    113-130 (180)
232 KOG2857|consensus               27.4      33 0.00072   16.8   0.7   22   11-32     17-38  (157)
233 PF13240 zinc_ribbon_2:  zinc-r  27.4      24 0.00051   11.2   0.1    6   42-47     16-21  (23)
234 KOG3352|consensus               27.2      30 0.00065   17.1   0.5   14   10-23    132-145 (153)
235 PF14446 Prok-RING_1:  Prokaryo  26.9      24 0.00052   14.2   0.1   11   40-50      6-16  (54)
236 PRK00481 NAD-dependent deacety  26.8      55  0.0012   17.2   1.5   19    6-24    117-135 (242)
237 PF08271 TF_Zn_Ribbon:  TFIIB z  26.7      29 0.00062   12.8   0.3    7   41-47      2-8   (43)
238 CHL00174 accD acetyl-CoA carbo  26.6      35 0.00076   18.9   0.8   13   38-50     56-68  (296)
239 PF01780 Ribosomal_L37ae:  Ribo  26.4      19 0.00041   16.1  -0.2   30   11-50     35-64  (90)
240 PRK14892 putative transcriptio  26.3      19  0.0004   16.4  -0.2   34   10-50     20-53  (99)
241 PF03966 Trm112p:  Trm112p-like  26.3      22 0.00047   14.6  -0.0   12   11-22     53-64  (68)
242 PF12760 Zn_Tnp_IS1595:  Transp  26.3      52  0.0011   12.3   2.5    8   40-47     19-26  (46)
243 TIGR02159 PA_CoA_Oxy4 phenylac  26.0     9.4  0.0002   18.5  -1.2   12   39-50    130-141 (146)
244 TIGR00319 desulf_FeS4 desulfof  26.0      27 0.00059   12.1   0.2   10   39-48      7-16  (34)
245 PRK04016 DNA-directed RNA poly  25.9      28 0.00062   14.4   0.3   14   38-51      3-16  (62)
246 PRK12496 hypothetical protein;  25.7      29 0.00063   17.2   0.4   11   40-50    128-138 (164)
247 KOG2747|consensus               25.7      45 0.00097   19.3   1.1   25   37-61    156-180 (396)
248 COG1579 Zn-ribbon protein, pos  25.7      56  0.0012   17.5   1.4   34   12-49    198-231 (239)
249 PF01096 TFIIS_C:  Transcriptio  25.6      20 0.00044   13.0  -0.2   10   40-49     29-38  (39)
250 PF13821 DUF4187:  Domain of un  25.3      40 0.00087   13.5   0.7   19   11-29     27-45  (55)
251 TIGR00280 L37a ribosomal prote  25.1      26 0.00057   15.7   0.1   31   10-50     34-64  (91)
252 cd00974 DSRD Desulforedoxin (D  24.9      32 0.00069   11.9   0.3   11   39-49      4-14  (34)
253 PF06220 zf-U1:  U1 zinc finger  24.6      54  0.0012   11.9   1.3   10   40-49      4-13  (38)
254 PLN00032 DNA-directed RNA poly  24.5      27 0.00058   14.9   0.1   15   38-52      3-17  (71)
255 PF15616 TerY-C:  TerY-C metal   24.3     9.4  0.0002   18.3  -1.4   11   37-47    103-113 (131)
256 PF04438 zf-HIT:  HIT zinc fing  24.2      37 0.00079   11.6   0.4   12   11-22     13-24  (30)
257 PF02591 DUF164:  Putative zinc  24.2      17 0.00038   14.3  -0.5   10   38-47     45-54  (56)
258 COG5236 Uncharacterized conser  23.8      68  0.0015   18.5   1.5   23   41-63    222-244 (493)
259 COG1644 RPB10 DNA-directed RNA  23.4      28 0.00061   14.4   0.1   15   38-52      3-17  (63)
260 PRK01343 zinc-binding protein;  23.4      49  0.0011   13.5   0.7   11   40-50     10-20  (57)
261 PF14169 YdjO:  Cold-inducible   23.2      73  0.0016   13.1   1.2    8   40-47     40-47  (59)
262 smart00132 LIM Zinc-binding do  22.9      39 0.00084   11.3   0.4   10   40-49     28-37  (39)
263 cd01412 SIRT5_Af1_CobB SIRT5_A  22.9      97  0.0021   16.0   1.9   14   10-23    108-121 (224)
264 TIGR03830 CxxCG_CxxCG_HTH puta  22.8      81  0.0018   14.4   1.5   20   11-30     31-50  (127)
265 smart00661 RPOL9 RNA polymeras  22.6      59  0.0013   12.2   0.9   12   39-50     20-31  (52)
266 PF13453 zf-TFIIB:  Transcripti  22.4      61  0.0013   11.7   1.0   19   39-57     19-37  (41)
267 KOG3362|consensus               22.4      19 0.00042   17.6  -0.6   22   39-60    129-150 (156)
268 COG5319 Uncharacterized protei  22.4 1.1E+02  0.0024   14.9   1.8   27   19-49     16-42  (142)
269 PRK03976 rpl37ae 50S ribosomal  22.3      33 0.00071   15.4   0.1   12   39-50     54-65  (90)
270 COG5152 Uncharacterized conser  22.1      45 0.00097   17.5   0.6   16   37-52    194-209 (259)
271 COG5188 PRP9 Splicing factor 3  22.1      52  0.0011   18.9   0.9   22   39-60    238-259 (470)
272 PF10367 Vps39_2:  Vacuolar sor  22.1      45 0.00099   14.6   0.6   12   40-51     79-90  (109)
273 COG1885 Uncharacterized protei  22.1      43 0.00092   15.5   0.5   11   40-50     50-60  (115)
274 PF09943 DUF2175:  Uncharacteri  21.9      24 0.00053   16.2  -0.3    8   40-47      3-10  (101)
275 COG3478 Predicted nucleic-acid  21.8      54  0.0012   13.8   0.7    8   40-47      5-12  (68)
276 KOG1088|consensus               21.8      27 0.00058   16.5  -0.2   11   12-22     99-109 (124)
277 PF07295 DUF1451:  Protein of u  21.7      29 0.00063   17.0  -0.1   28   10-47    111-138 (146)
278 COG1656 Uncharacterized conser  21.7      40 0.00086   17.0   0.4   18   39-56    130-147 (165)
279 PF04328 DUF466:  Protein of un  21.5      85  0.0018   13.0   2.2   13   57-69     30-42  (65)
280 PF06170 DUF983:  Protein of un  21.5      45 0.00097   14.7   0.5   11   40-50      9-19  (86)
281 COG2879 Uncharacterized small   21.5      86  0.0019   13.1   2.4   15   53-67     26-40  (65)
282 PF01844 HNH:  HNH endonuclease  21.4      39 0.00084   12.2   0.3    9   42-50      1-9   (47)
283 KOG3456|consensus               21.4      40 0.00088   15.7   0.3   13   39-51    104-116 (120)
284 PF03884 DUF329:  Domain of unk  21.3      35 0.00075   13.9   0.1   11   40-50      3-13  (57)
285 COG5027 SAS2 Histone acetyltra  21.1      62  0.0013   18.6   1.0   24   38-61    157-180 (395)
286 PRK05654 acetyl-CoA carboxylas  21.0      47   0.001   18.3   0.6   12   39-50     46-57  (292)
287 PF14375 Cys_rich_CWC:  Cystein  20.9      45 0.00097   12.9   0.4    7   43-49      2-8   (50)
288 KOG3277|consensus               20.7      25 0.00054   17.5  -0.4   34   11-47     79-112 (165)
289 KOG0402|consensus               20.7      31 0.00067   15.3  -0.1   10   39-48     36-45  (92)
290 PRK06450 threonine synthase; V  20.6      64  0.0014   18.1   1.0   10   12-21      4-13  (338)
291 PF14205 Cys_rich_KTR:  Cystein  20.6      23  0.0005   14.3  -0.4   11   37-47     26-36  (55)
292 PRK05580 primosome assembly pr  20.5      30 0.00064   21.3  -0.2   12   37-48    419-430 (679)
293 PF14599 zinc_ribbon_6:  Zinc-r  20.4      18 0.00039   14.9  -0.8    6   14-19     33-38  (61)
294 PF10058 DUF2296:  Predicted in  20.3      43 0.00093   13.3   0.3   10   38-47     43-52  (54)
295 TIGR03829 YokU_near_AblA uncha  20.3      67  0.0015   14.4   0.9   18   12-29     36-53  (89)
296 COG4847 Uncharacterized protei  20.2      36 0.00078   15.5   0.1   13    8-20      3-15  (103)

No 1  
>KOG2462|consensus
Probab=99.87  E-value=6.7e-23  Score=101.56  Aligned_cols=64  Identities=42%  Similarity=0.819  Sum_probs=59.7

Q ss_pred             CCCcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCChHHHHHHHHHhccCCCCCCCC
Q psy2647           8 GEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRKVDLRRHKETQHTEMRPVPVT   72 (72)
Q Consensus         8 ~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~H~~~~~~~~~p~~~~   72 (72)
                      ..-++.|..||+.|...+.|+.|+++|+|++||.|+.|++.|.++++|..|+++ |++.++|.|.
T Consensus       184 H~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQT-HS~~K~~qC~  247 (279)
T KOG2462|consen  184 HTLPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQT-HSDVKKHQCP  247 (279)
T ss_pred             cCCCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHh-hcCCccccCc
Confidence            345789999999999999999999999999999999999999999999999999 8888899873


No 2  
>KOG2462|consensus
Probab=99.76  E-value=5e-19  Score=88.04  Aligned_cols=60  Identities=40%  Similarity=0.747  Sum_probs=56.6

Q ss_pred             ccccccCCCcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCChHHHHHHHHH
Q psy2647           2 ISNIWHGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus         2 ~~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      +-++|+|+|||.|..|++.|..+.+|..|+.+|.+.++|+|..|++.|...+.|..|...
T Consensus       206 HiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  206 HIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             ccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            357899999999999999999999999999999999999999999999999999999764


No 3  
>KOG3623|consensus
Probab=99.65  E-value=7.8e-17  Score=88.87  Aligned_cols=63  Identities=33%  Similarity=0.720  Sum_probs=51.3

Q ss_pred             CCcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCChHHHHHHHHHhccCCCCCCCC
Q psy2647           9 EKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRKVDLRRHKETQHTEMRPVPVT   72 (72)
Q Consensus         9 ~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~H~~~~~~~~~p~~~~   72 (72)
                      +.+|.|+.|++.|.-...|.+|.-.|+|.+||+|.+|.+.|..+..|..|+|+ |+|++||-|+
T Consensus       892 ~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRL-HSGEKPfQCd  954 (1007)
T KOG3623|consen  892 DGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRL-HSGEKPFQCD  954 (1007)
T ss_pred             cccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhh-ccCCCcchhh
Confidence            45688888888888888888888888888888888888888888888888888 8888888774


No 4  
>KOG3623|consensus
Probab=99.61  E-value=2.5e-16  Score=86.96  Aligned_cols=62  Identities=32%  Similarity=0.680  Sum_probs=56.8

Q ss_pred             cccccCCCcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCChHHHHHHHHHhcc
Q psy2647           3 SNIWHGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRKVDLRRHKETQHT   64 (72)
Q Consensus         3 ~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~H~~~~~~   64 (72)
                      ..-|+|.+||.|.+|.+.|+.+-+|..|++.|.|++||+|.+|+++|+...+..+|+....+
T Consensus       914 KYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHMNHRYS  975 (1007)
T KOG3623|consen  914 KYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMNHRYS  975 (1007)
T ss_pred             hhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhhccchh
Confidence            34589999999999999999999999999999999999999999999999999999874333


No 5  
>KOG3576|consensus
Probab=99.43  E-value=1.7e-14  Score=69.90  Aligned_cols=52  Identities=40%  Similarity=0.925  Sum_probs=26.9

Q ss_pred             CCcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCChHHHHHHHH
Q psy2647           9 EKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRKVDLRRHKE   60 (72)
Q Consensus         9 ~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~H~~   60 (72)
                      .+.+.|..|+++|.....|++|+++|+|-+||+|..|++.|.++-+|..|++
T Consensus       143 vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  143 VKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             HHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHH
Confidence            3444455555555555555555555555555555555555555555555544


No 6  
>KOG3576|consensus
Probab=99.36  E-value=6.6e-14  Score=67.92  Aligned_cols=63  Identities=37%  Similarity=0.772  Sum_probs=58.2

Q ss_pred             CCcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCChHHHHHHHHHhccCCCCCCCC
Q psy2647           9 EKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRKVDLRRHKETQHTEMRPVPVT   72 (72)
Q Consensus         9 ~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~H~~~~~~~~~p~~~~   72 (72)
                      ...+.|..|++.|.....|.+|++.|..-+.+.|..||+.|...-.|++|.++ |++-+||.|+
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rt-htgvrpykc~  177 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRT-HTGVRPYKCS  177 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhcc-ccCccccchh
Confidence            45688999999999999999999999888889999999999999999999999 9999999985


No 7  
>PHA02768 hypothetical protein; Provisional
Probab=99.34  E-value=3.3e-13  Score=53.19  Aligned_cols=44  Identities=27%  Similarity=0.546  Sum_probs=39.0

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCChHHHH
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRKVDLR   56 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~   56 (72)
                      -|.|+.|++.|....+|..|++.|+  ++++|..|++.|...+.|+
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            3789999999999999999999998  6899999999998776653


No 8  
>KOG1074|consensus
Probab=99.34  E-value=1.4e-13  Score=77.06  Aligned_cols=56  Identities=43%  Similarity=0.851  Sum_probs=51.0

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCChHHHHHHHHHhccCCC
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRKVDLRRHKETQHTEMR   67 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~H~~~~~~~~~   67 (72)
                      +++|..|.+.|.+...|+.|.++|+|++||+|.+||..|..+.+|+.|... |.+..
T Consensus       353 khkCr~CakvfgS~SaLqiHlRSHTGERPfqCnvCG~~FSTkGNLKvH~~r-H~e~~  408 (958)
T KOG1074|consen  353 KHKCRFCAKVFGSDSALQIHLRSHTGERPFQCNVCGNRFSTKGNLKVHFQR-HREKY  408 (958)
T ss_pred             cchhhhhHhhcCchhhhhhhhhccCCCCCeeecccccccccccceeeeeee-ccccC
Confidence            467999999999999999999999999999999999999999999999887 44443


No 9  
>PHA00733 hypothetical protein
Probab=99.25  E-value=2.3e-11  Score=55.93  Aligned_cols=56  Identities=27%  Similarity=0.485  Sum_probs=48.8

Q ss_pred             cCCCcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCChHHHHHHHHHhcc
Q psy2647           7 HGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRKVDLRRHKETQHT   64 (72)
Q Consensus         7 ~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~H~~~~~~   64 (72)
                      .+.++|.|..|++.|.....|..|++.+  ..++.|..|++.|.....|..|+...|.
T Consensus        69 ~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         69 KAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            3478999999999999999999998865  3579999999999999999999887665


No 10 
>KOG1074|consensus
Probab=99.18  E-value=8.1e-12  Score=70.31  Aligned_cols=58  Identities=41%  Similarity=0.843  Sum_probs=48.1

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCChHHHHHHHHHhccCCCCC
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRKVDLRRHKETQHTEMRPV   69 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~H~~~~~~~~~p~   69 (72)
                      |..|-.|.+...-...|+.|.++|+|++||+|.+||+.|..+.+|+.|+.+ |...-|+
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~v-Hka~p~~  662 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSV-HKAKPPA  662 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccc-cccCccc
Confidence            567888888888888888898899999999999999999988888888887 5555444


No 11 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.14  E-value=3.6e-11  Score=41.09  Aligned_cols=25  Identities=52%  Similarity=1.081  Sum_probs=22.5

Q ss_pred             HHHHhHHHhcCCCCccCCcchhhcC
Q psy2647          26 NLITHSRKHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus        26 ~l~~~~~~~~~~~~~~c~~c~~~~~   50 (72)
                      +|..|++.|++++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4788999999999999999999886


No 12 
>KOG3608|consensus
Probab=99.08  E-value=1e-10  Score=61.07  Aligned_cols=62  Identities=23%  Similarity=0.486  Sum_probs=45.7

Q ss_pred             CCcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCChHHHHHHHHHhccCCCCCCCC
Q psy2647           9 EKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRKVDLRRHKETQHTEMRPVPVT   72 (72)
Q Consensus         9 ~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~H~~~~~~~~~p~~~~   72 (72)
                      .++|.|..|.+.|..+..|..|+..|..  .|+|+.|..+....+.|..|++..|..++|++|+
T Consensus       235 ~n~fqC~~C~KrFaTeklL~~Hv~rHvn--~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd  296 (467)
T KOG3608|consen  235 TNSFQCAQCFKRFATEKLLKSHVVRHVN--CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCD  296 (467)
T ss_pred             CCchHHHHHHHHHhHHHHHHHHHHHhhh--cccccccccCCCChHHHHHHHHhhhccCCCcccc
Confidence            3456666677777666667666666643  4778888888888888888888888888888875


No 13 
>PHA00616 hypothetical protein
Probab=99.03  E-value=2.2e-10  Score=43.30  Aligned_cols=31  Identities=19%  Similarity=0.446  Sum_probs=16.6

Q ss_pred             CccCCcchhhcCChHHHHHHHHHhccCCCCCC
Q psy2647          39 PFACDLCGRAFQRKVDLRRHKETQHTEMRPVP   70 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~H~~~~~~~~~p~~   70 (72)
                      ||+|..||+.|.+.+.+..|++. +.++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~-~hg~~~~~   31 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLS-VHKQNKLT   31 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHH-hcCCCccc
Confidence            35555566666655666666555 33334443


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=98.82  E-value=4.6e-09  Score=41.52  Aligned_cols=25  Identities=16%  Similarity=0.656  Sum_probs=23.1

Q ss_pred             CccCCcchhhcCChHHHHHHHHHhc
Q psy2647          39 PFACDLCGRAFQRKVDLRRHKETQH   63 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~H~~~~~   63 (72)
                      .|+|+.||+.|...+.|..|+++|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~   29 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN   29 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC
Confidence            4799999999999999999999955


No 15 
>PHA00616 hypothetical protein
Probab=98.81  E-value=3.5e-09  Score=40.05  Aligned_cols=34  Identities=18%  Similarity=0.353  Sum_probs=31.4

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCc
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDL   44 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~   44 (72)
                      ||.|..||..|.....+..|++.+++++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            6889999999999999999999999999988764


No 16 
>KOG3608|consensus
Probab=98.75  E-value=2.4e-08  Score=52.54  Aligned_cols=51  Identities=39%  Similarity=0.675  Sum_probs=31.9

Q ss_pred             cccCcccchhccCcHHHHHhHHH-hcCCCCccCCcchhhcCChHHHHHHHHH
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRK-HTGFKPFACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~-~~~~~~~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      .|.|+.|+........|..|++. |...+|++|..|.+.+...+.|+.|..+
T Consensus       263 ~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~  314 (467)
T KOG3608|consen  263 CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQV  314 (467)
T ss_pred             cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHh
Confidence            45666666666666666666654 5555666666666666666666666665


No 17 
>PHA00732 hypothetical protein
Probab=98.68  E-value=1.4e-08  Score=43.25  Aligned_cols=45  Identities=31%  Similarity=0.659  Sum_probs=37.0

Q ss_pred             cccCcccchhccCcHHHHHhHHH-hcCCCCccCCcchhhcCChHHHHHHHHH
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRK-HTGFKPFACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~-~~~~~~~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      ||.|..|++.|.....|..|++. |.   ++.|+.|++.|..   +..|.+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~~---l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYRR---LNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeCC---hhhhhcc
Confidence            57899999999999999999984 54   3589999999973   5667654


No 18 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.64  E-value=1.4e-07  Score=37.42  Aligned_cols=51  Identities=31%  Similarity=0.605  Sum_probs=38.9

Q ss_pred             cccCcccchhccCcHHHHHhHHH-hcC-CCCccCCcchhhcCChHHHHHHHHHhcc
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRK-HTG-FKPFACDLCGRAFQRKVDLRRHKETQHT   64 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~-~~~-~~~~~c~~c~~~~~~~~~l~~H~~~~~~   64 (72)
                      .|.|+.|++ ..+...|..|... |.. .+.+.|+.|...+.  .+|..|+..+|+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            478999999 4567889999775 544 35789999998644  488899887653


No 19 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.61  E-value=8.9e-08  Score=53.15  Aligned_cols=57  Identities=23%  Similarity=0.630  Sum_probs=37.4

Q ss_pred             CCcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCChHHHHHHHHHhccCCCCCCC
Q psy2647           9 EKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRKVDLRRHKETQHTEMRPVPV   71 (72)
Q Consensus         9 ~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~H~~~~~~~~~p~~~   71 (72)
                      ++++.|..|+..|. ...+..|+..++  .++.|+ |+..+ .+..|..|+.+ +..++|+.|
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~t-hCp~Kpi~C  507 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQAS-TCPLRLITC  507 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhc-cCCCCceeC
Confidence            45567777777774 456777776653  567777 77544 45677777766 666677666


No 20 
>PHA00733 hypothetical protein
Probab=98.54  E-value=7.5e-08  Score=44.48  Aligned_cols=54  Identities=20%  Similarity=0.292  Sum_probs=41.8

Q ss_pred             CCCcccCcccchhccCcHHHHHh--HH---HhcCCCCccCCcchhhcCChHHHHHHHHH
Q psy2647           8 GEKPHKCQVCGKAFSQSSNLITH--SR---KHTGFKPFACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus         8 ~~~~~~c~~c~~~~~~~~~l~~~--~~---~~~~~~~~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      ..+++.|..|...+.....+..+  ..   ...+.+||.|..|++.|.....|..|++.
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~   95 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRY   95 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhc
Confidence            35678899998887776665554  11   22346799999999999999999999986


No 21 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.54  E-value=6.3e-08  Score=31.87  Aligned_cols=22  Identities=36%  Similarity=1.026  Sum_probs=16.1

Q ss_pred             ccCCcchhhcCChHHHHHHHHH
Q psy2647          40 FACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        40 ~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      |+|+.|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4677777777777777777765


No 22 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.51  E-value=1.3e-08  Score=34.62  Aligned_cols=21  Identities=52%  Similarity=0.933  Sum_probs=18.5

Q ss_pred             ccccccCCCcccCcccchhcc
Q psy2647           2 ISNIWHGEKPHKCQVCGKAFS   22 (72)
Q Consensus         2 ~~~~~~~~~~~~c~~c~~~~~   22 (72)
                      ++++|++++||.|+.|++.|.
T Consensus         5 H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    5 HMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHSSSSSEEESSSSEEES
T ss_pred             HhhhcCCCCCCCCCCCcCeeC
Confidence            456899999999999999885


No 23 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.44  E-value=2.2e-07  Score=30.61  Aligned_cols=24  Identities=46%  Similarity=1.115  Sum_probs=16.4

Q ss_pred             ccCCcchhhcCChHHHHHHHHHhc
Q psy2647          40 FACDLCGRAFQRKVDLRRHKETQH   63 (72)
Q Consensus        40 ~~c~~c~~~~~~~~~l~~H~~~~~   63 (72)
                      |.|+.|++.|.....+..|+..+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            467788888888888888877643


No 24 
>KOG3993|consensus
Probab=98.41  E-value=2e-07  Score=50.04  Aligned_cols=54  Identities=37%  Similarity=0.732  Sum_probs=35.6

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcC--------CC-------------------------CccCCcchhhcCChHHHHH
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTG--------FK-------------------------PFACDLCGRAFQRKVDLRR   57 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~--------~~-------------------------~~~c~~c~~~~~~~~~l~~   57 (72)
                      -|.|.+|++.|.-..+|..|.++|-.        ..                         .|.|..|++.|.....|..
T Consensus       295 EYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrK  374 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRK  374 (500)
T ss_pred             eecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHH
Confidence            36777777777777777777765521        11                         2567777777777777777


Q ss_pred             HHHHhcc
Q psy2647          58 HKETQHT   64 (72)
Q Consensus        58 H~~~~~~   64 (72)
                      |+-+|+.
T Consensus       375 Hqlthq~  381 (500)
T KOG3993|consen  375 HQLTHQR  381 (500)
T ss_pred             hHHhhhc
Confidence            7666543


No 25 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.39  E-value=1.2e-07  Score=32.35  Aligned_cols=24  Identities=46%  Similarity=1.032  Sum_probs=17.2

Q ss_pred             CccCCcchhhcCChHHHHHHHHHh
Q psy2647          39 PFACDLCGRAFQRKVDLRRHKETQ   62 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~H~~~~   62 (72)
                      +++|..|++.|.....|..|++.|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHh
Confidence            466777777777777777777654


No 26 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.37  E-value=5.2e-07  Score=50.28  Aligned_cols=58  Identities=21%  Similarity=0.588  Sum_probs=46.8

Q ss_pred             CcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCC----------hHHHHHHHHHhccCCCCCCC
Q psy2647          10 KPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQR----------KVDLRRHKETQHTEMRPVPV   71 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~----------~~~l~~H~~~~~~~~~p~~~   71 (72)
                      +++.|+ |+..+ ....|..|+..+.+.+++.|..|+..+..          .+.|..|...  .+.+++.|
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~--CG~rt~~C  544 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESI--CGSRTAPC  544 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHh--cCCcceEc
Confidence            678898 99655 56889999988999999999999988842          3578889886  47777776


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.29  E-value=4.7e-07  Score=29.71  Aligned_cols=23  Identities=57%  Similarity=1.057  Sum_probs=20.6

Q ss_pred             ccCcccchhccCcHHHHHhHHHh
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKH   34 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~   34 (72)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            57999999999999999998763


No 28 
>KOG3993|consensus
Probab=98.29  E-value=9.8e-08  Score=51.18  Aligned_cols=52  Identities=19%  Similarity=0.454  Sum_probs=45.5

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCChHHHHHHHHHh
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRKVDLRRHKETQ   62 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~H~~~~   62 (72)
                      -|.|..|...|.....|.+|.-.......|+|+.|++.|+...+|..|+|.|
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWH  318 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWH  318 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhccc
Confidence            4889999999999999999876555556799999999999999999999984


No 29 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.03  E-value=1.6e-06  Score=45.34  Aligned_cols=52  Identities=29%  Similarity=0.680  Sum_probs=42.6

Q ss_pred             CCcccCcc--cchhccCcHHHHHhHHHhc-------------------CCCCccCCcchhhcCChHHHHHHHH
Q psy2647           9 EKPHKCQV--CGKAFSQSSNLITHSRKHT-------------------GFKPFACDLCGRAFQRKVDLRRHKE   60 (72)
Q Consensus         9 ~~~~~c~~--c~~~~~~~~~l~~~~~~~~-------------------~~~~~~c~~c~~~~~~~~~l~~H~~   60 (72)
                      ++||.|+.  |.+.|+....|+-|+....                   ..+||+|++|++++.....|+-|+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            48999977  9999999988888876421                   1389999999999998888887765


No 30 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.93  E-value=1.9e-05  Score=26.09  Aligned_cols=22  Identities=36%  Similarity=0.881  Sum_probs=15.8

Q ss_pred             ccCCcchhhcCChHHHHHHHHH
Q psy2647          40 FACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        40 ~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      ++|..|++.|.....+..|++.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~   22 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRT   22 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHH
Confidence            3577777777777777777764


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.91  E-value=4.3e-06  Score=28.39  Aligned_cols=25  Identities=48%  Similarity=0.909  Sum_probs=22.1

Q ss_pred             cccCcccchhccCcHHHHHhHHHhc
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHT   35 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~   35 (72)
                      +|.|..|+..|.....+..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5789999999999999999987653


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.85  E-value=1.5e-05  Score=25.95  Aligned_cols=23  Identities=43%  Similarity=0.947  Sum_probs=18.8

Q ss_pred             ccCcccchhccCcHHHHHhHHHh
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKH   34 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~   34 (72)
                      |.|+.|+..|.....+..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            57999999999999999998864


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.80  E-value=3e-05  Score=33.97  Aligned_cols=49  Identities=29%  Similarity=0.717  Sum_probs=20.8

Q ss_pred             CcccchhccCcHHHHHhHHH-hcC----------------------CCCccCCcchhhcCChHHHHHHHHHh
Q psy2647          14 CQVCGKAFSQSSNLITHSRK-HTG----------------------FKPFACDLCGRAFQRKVDLRRHKETQ   62 (72)
Q Consensus        14 c~~c~~~~~~~~~l~~~~~~-~~~----------------------~~~~~c~~c~~~~~~~~~l~~H~~~~   62 (72)
                      |..|+..|.....+..|+.. |.-                      ...+.|..|++.|.....|..|++.+
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -----------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            55666666666666666542 210                      12478999999999999999999864


No 34 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.78  E-value=4e-05  Score=29.89  Aligned_cols=29  Identities=34%  Similarity=0.747  Sum_probs=19.5

Q ss_pred             CCCCccCCcchhhcCChHHHHHHHHHhcc
Q psy2647          36 GFKPFACDLCGRAFQRKVDLRRHKETQHT   64 (72)
Q Consensus        36 ~~~~~~c~~c~~~~~~~~~l~~H~~~~~~   64 (72)
                      .+.|-.|+.|+..+.+..+|.+|+.+.|.
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhc
Confidence            35678899999999999999999987444


No 35 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.77  E-value=3e-05  Score=25.54  Aligned_cols=23  Identities=30%  Similarity=0.735  Sum_probs=14.8

Q ss_pred             ccCCcchhhcCChHHHHHHHHHhc
Q psy2647          40 FACDLCGRAFQRKVDLRRHKETQH   63 (72)
Q Consensus        40 ~~c~~c~~~~~~~~~l~~H~~~~~   63 (72)
                      |+|..|+.... ...|..|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            46777777666 777777777655


No 36 
>PHA00732 hypothetical protein
Probab=97.72  E-value=4e-05  Score=32.75  Aligned_cols=26  Identities=31%  Similarity=0.645  Sum_probs=22.4

Q ss_pred             CccCCcchhhcCChHHHHHHHHHhcc
Q psy2647          39 PFACDLCGRAFQRKVDLRRHKETQHT   64 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~H~~~~~~   64 (72)
                      ||.|..|++.|.....|..|++.+|.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~   26 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT   26 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC
Confidence            57899999999999999999984344


No 37 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.70  E-value=6.7e-05  Score=29.27  Aligned_cols=32  Identities=38%  Similarity=0.626  Sum_probs=22.3

Q ss_pred             CCCcccCcccchhccCcHHHHHhHHHhcCCCC
Q psy2647           8 GEKPHKCQVCGKAFSQSSNLITHSRKHTGFKP   39 (72)
Q Consensus         8 ~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~   39 (72)
                      .+.|..|+.|+....+..+|.+|+....+.+|
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            45688999999999999999999987666554


No 38 
>PRK04860 hypothetical protein; Provisional
Probab=97.69  E-value=3.2e-05  Score=37.17  Aligned_cols=37  Identities=24%  Similarity=0.630  Sum_probs=29.4

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCC
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQR   51 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~   51 (72)
                      +|.|. |+.   ....+..|.+.+.++++|.|..|+..|..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            57887 876   45667888889999889999999887654


No 39 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.37  E-value=9.3e-05  Score=24.51  Aligned_cols=22  Identities=36%  Similarity=0.939  Sum_probs=14.4

Q ss_pred             ccCCcchhhcCChHHHHHHHHH
Q psy2647          40 FACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        40 ~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      |.|..|...|.....+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            3566677777777777766653


No 40 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.87  E-value=0.0014  Score=21.85  Aligned_cols=20  Identities=35%  Similarity=0.923  Sum_probs=12.3

Q ss_pred             ccCCcchhhcCChHHHHHHHH
Q psy2647          40 FACDLCGRAFQRKVDLRRHKE   60 (72)
Q Consensus        40 ~~c~~c~~~~~~~~~l~~H~~   60 (72)
                      ..|+.||+.| ....+..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3577777777 3555566654


No 41 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.85  E-value=0.00034  Score=23.67  Aligned_cols=21  Identities=33%  Similarity=0.687  Sum_probs=11.1

Q ss_pred             ccCcccchhccCcHHHHHhHH
Q psy2647          12 HKCQVCGKAFSQSSNLITHSR   32 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~   32 (72)
                      |.|..|++.|.+...+..|+.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            345555555555555555543


No 42 
>KOG2893|consensus
Probab=96.60  E-value=0.00046  Score=35.29  Aligned_cols=43  Identities=30%  Similarity=0.709  Sum_probs=31.3

Q ss_pred             CCcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCChHHHH
Q psy2647           9 EKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRKVDLR   56 (72)
Q Consensus         9 ~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~   56 (72)
                      .++| |.+|++.|..+.-|..|++    .+.|+|-+|-+.+.+-..|.
T Consensus         9 ~kpw-cwycnrefddekiliqhqk----akhfkchichkkl~sgpgls   51 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQK----AKHFKCHICHKKLFSGPGLS   51 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhh----hccceeeeehhhhccCCCce
Confidence            3454 6789999999999988876    45789999986554443333


No 43 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=96.53  E-value=0.0051  Score=24.28  Aligned_cols=32  Identities=28%  Similarity=0.528  Sum_probs=23.5

Q ss_pred             CccCCcchhhcCChHHHHHHHHHhccCC-CCCCC
Q psy2647          39 PFACDLCGRAFQRKVDLRRHKETQHTEM-RPVPV   71 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~H~~~~~~~~-~p~~~   71 (72)
                      .|.|+.|++ ......|..|....|..+ +.+.|
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~C   34 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVC   34 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccC
Confidence            478999999 456788999988767665 33433


No 44 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.11  E-value=0.0045  Score=21.96  Aligned_cols=22  Identities=27%  Similarity=0.726  Sum_probs=15.9

Q ss_pred             CccCCcchhhcCChHHHHHHHH
Q psy2647          39 PFACDLCGRAFQRKVDLRRHKE   60 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~H~~   60 (72)
                      ++.|..|+..|.....+..|++
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4667888888877777777754


No 45 
>PRK04860 hypothetical protein; Provisional
Probab=95.58  E-value=0.0081  Score=29.11  Aligned_cols=28  Identities=21%  Similarity=0.571  Sum_probs=23.1

Q ss_pred             CccCCcchhhcCChHHHHHHHHHhccCCCCCCC
Q psy2647          39 PFACDLCGRAFQRKVDLRRHKETQHTEMRPVPV   71 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~H~~~~~~~~~p~~~   71 (72)
                      +|.|. |+.   ....+..|.++ +.++++|.|
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri-~~g~~~YrC  146 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRV-VRGEAVYRC  146 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHH-hcCCccEEC
Confidence            68897 876   56677899999 888889887


No 46 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.55  E-value=0.0083  Score=21.30  Aligned_cols=24  Identities=33%  Similarity=0.999  Sum_probs=16.6

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      |.|..|+..+....            .++.|+.|+.
T Consensus         2 ~~C~~CGy~y~~~~------------~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------APWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------CCCcCcCCCC
Confidence            67888887654322            5788999874


No 47 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=95.36  E-value=0.0025  Score=34.29  Aligned_cols=56  Identities=46%  Similarity=0.842  Sum_probs=46.7

Q ss_pred             cccCcccchhccCcHHHHHhHH--HhcCC--CCccCC--cchhhcCChHHHHHHHHHhccCCC
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSR--KHTGF--KPFACD--LCGRAFQRKVDLRRHKETQHTEMR   67 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~--~~~~~--~~~~c~--~c~~~~~~~~~l~~H~~~~~~~~~   67 (72)
                      ++.|..|...+.....+..+.+  .|.++  +++.|+  .|++.|.....+..|..+ +....
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~-~~~~~  350 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILL-HTSIS  350 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCccc-ccCCC
Confidence            5778888899999999999999  78888  899999  799999998888888777 44443


No 48 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=95.21  E-value=0.013  Score=26.65  Aligned_cols=30  Identities=30%  Similarity=0.811  Sum_probs=22.9

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCCh
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRK   52 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~   52 (72)
                      ..|+.||..|.-           .+..|..|++||..|...
T Consensus        10 R~Cp~CG~kFYD-----------Lnk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYD-----------LNKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhcc-----------CCCCCccCCCCCCccCcc
Confidence            479999988754           224688999999888755


No 49 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=95.16  E-value=0.016  Score=23.13  Aligned_cols=25  Identities=36%  Similarity=0.707  Sum_probs=14.7

Q ss_pred             CCCCccCCcchhhcCChHHHHHHHH
Q psy2647          36 GFKPFACDLCGRAFQRKVDLRRHKE   60 (72)
Q Consensus        36 ~~~~~~c~~c~~~~~~~~~l~~H~~   60 (72)
                      |+.-+.|+-|+..|.......+|..
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVN   38 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVN   38 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhh
Confidence            4445566666666666655555554


No 50 
>KOG1146|consensus
Probab=95.06  E-value=0.022  Score=35.71  Aligned_cols=55  Identities=24%  Similarity=0.386  Sum_probs=44.0

Q ss_pred             cCCCcccCcccchhccCcHHHHHhHHHhc-------------------------CCCCccCCcchhhcCChHHHHHHHHH
Q psy2647           7 HGEKPHKCQVCGKAFSQSSNLITHSRKHT-------------------------GFKPFACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus         7 ~~~~~~~c~~c~~~~~~~~~l~~~~~~~~-------------------------~~~~~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      +-.+.+.|+.|++.|+....|..|++..+                         +.++|.|..|...+....+|..|+..
T Consensus       461 S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  461 SFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             cccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHHH
Confidence            33477899999999999999999998711                         12568888999999888888888763


No 51 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=93.59  E-value=0.046  Score=26.75  Aligned_cols=23  Identities=39%  Similarity=0.936  Sum_probs=17.4

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcch
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCG   46 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~   46 (72)
                      -|.|..||..+             .++.|.+|+.||
T Consensus       134 ~~vC~vCGy~~-------------~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYTH-------------EGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCcc-------------cCCCCCcCCCCC
Confidence            58899997542             346688999998


No 52 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=93.36  E-value=0.039  Score=22.33  Aligned_cols=32  Identities=22%  Similarity=0.504  Sum_probs=17.7

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      .|.|+.|+...-.+-     .+......+|+|+.||.
T Consensus        27 ~F~CPnCGe~~I~Rc-----~~CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          27 KFPCPNCGEVEIYRC-----AKCRKLGNPYRCPKCGF   58 (61)
T ss_pred             EeeCCCCCceeeehh-----hhHHHcCCceECCCcCc
Confidence            467777775432221     22222346788888873


No 53 
>KOG2186|consensus
Probab=93.00  E-value=0.065  Score=27.97  Aligned_cols=47  Identities=28%  Similarity=0.682  Sum_probs=33.3

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCChHHHHHHHH
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRKVDLRRHKE   60 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~H~~   60 (72)
                      .|.|..|+.... ...+..|+..-.+ .-|.|..|++.|-. .....|..
T Consensus         3 ~FtCnvCgEsvK-Kp~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    3 FFTCNVCGESVK-KPQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             EEehhhhhhhcc-ccchHHHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            467999998766 4446677765444 46899999999976 45556654


No 54 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=92.97  E-value=0.07  Score=20.30  Aligned_cols=29  Identities=21%  Similarity=0.422  Sum_probs=20.0

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcC
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~   50 (72)
                      .|.|..|+..+...           ...+..|+.||....
T Consensus         2 ~Y~C~~Cg~~~~~~-----------~~~~irC~~CG~rIl   30 (44)
T smart00659        2 IYICGECGRENEIK-----------SKDVVRCRECGYRIL   30 (44)
T ss_pred             EEECCCCCCEeecC-----------CCCceECCCCCceEE
Confidence            37899999876533           234689999986543


No 55 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=92.97  E-value=0.076  Score=19.33  Aligned_cols=33  Identities=24%  Similarity=0.626  Sum_probs=21.8

Q ss_pred             cCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcC
Q psy2647          13 KCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus        13 ~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~   50 (72)
                      .|+.|+..|.....-     ...+....+|+.|+..|.
T Consensus         4 ~CP~C~~~f~v~~~~-----l~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    4 TCPNCQTRFRVPDDK-----LPAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             ECCCCCceEEcCHHH-----cccCCcEEECCCCCcEee
Confidence            588888888765542     112344688999987764


No 56 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=92.61  E-value=0.021  Score=28.95  Aligned_cols=42  Identities=33%  Similarity=0.641  Sum_probs=27.6

Q ss_pred             CcccCcccchhccCcHHHHHhHHH---h-------cCCCC-----ccCCcchhhcCC
Q psy2647          10 KPHKCQVCGKAFSQSSNLITHSRK---H-------TGFKP-----FACDLCGRAFQR   51 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~~~l~~~~~~---~-------~~~~~-----~~c~~c~~~~~~   51 (72)
                      +...|+.|+..|..........+.   .       .+..|     +.|+.||.++..
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~   60 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFE   60 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCcccc
Confidence            567899999999877554444432   1       12233     489999987753


No 57 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=92.39  E-value=0.018  Score=27.82  Aligned_cols=13  Identities=31%  Similarity=0.749  Sum_probs=9.8

Q ss_pred             CccCCcchhhcCC
Q psy2647          39 PFACDLCGRAFQR   51 (72)
Q Consensus        39 ~~~c~~c~~~~~~   51 (72)
                      .++|+.||.+|..
T Consensus        28 ~~~c~~c~~~f~~   40 (154)
T PRK00464         28 RRECLACGKRFTT   40 (154)
T ss_pred             eeeccccCCcceE
Confidence            3788888888764


No 58 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.12  E-value=0.097  Score=18.72  Aligned_cols=25  Identities=32%  Similarity=0.733  Sum_probs=16.4

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      .|.|..||..+...            ..|..|+.|+.
T Consensus         2 ~~~C~~CG~i~~g~------------~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE------------EAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC------------cCCCcCcCCCC
Confidence            37788888654321            24668888874


No 59 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=92.03  E-value=0.11  Score=24.37  Aligned_cols=30  Identities=20%  Similarity=0.403  Sum_probs=22.5

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCCh
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRK   52 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~   52 (72)
                      ..|+.|+..|.-           .+..|..|++||..+...
T Consensus        10 r~Cp~cg~kFYD-----------Lnk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYD-----------LNRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCccccc-----------cCCCCccCCCcCCccCcc
Confidence            579999987753           234688999999887655


No 60 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=91.89  E-value=0.084  Score=25.58  Aligned_cols=33  Identities=18%  Similarity=0.376  Sum_probs=24.2

Q ss_pred             CCcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcC
Q psy2647           9 EKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus         9 ~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~   50 (72)
                      ..-|.|+.|+..|+...++.         ..|.|+.||....
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAME---------LNFTCPRCGAMLD  139 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEee
Confidence            34578999998887766653         2589999997543


No 61 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=91.33  E-value=0.047  Score=21.22  Aligned_cols=29  Identities=24%  Similarity=0.596  Sum_probs=18.7

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      |.|..|+..|.....+.      . .....|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~~------~-~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKMS------D-DPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEecC------C-CCCCCCCCCCC
Confidence            77999998776432211      1 34567999985


No 62 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=91.06  E-value=0.1  Score=25.79  Aligned_cols=32  Identities=22%  Similarity=0.498  Sum_probs=23.7

Q ss_pred             CcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcC
Q psy2647          10 KPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~   50 (72)
                      .-|.|+.|+..|....++.         ..|.|+.||....
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLE  147 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCe
Confidence            4588999998887666542         3699999997554


No 63 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=91.01  E-value=0.16  Score=18.40  Aligned_cols=33  Identities=21%  Similarity=0.545  Sum_probs=21.2

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhc
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAF   49 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~   49 (72)
                      ..|+.|...|.......     .......+|..|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~i-----p~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEKI-----PPKGRKVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHHC-----CCCCcEEECCCCCCEe
Confidence            35888888877655422     1223457899998766


No 64 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=90.87  E-value=0.31  Score=16.28  Aligned_cols=20  Identities=20%  Similarity=0.454  Sum_probs=12.2

Q ss_pred             ccCCcchhhcCChHHHHHHHH
Q psy2647          40 FACDLCGRAFQRKVDLRRHKE   60 (72)
Q Consensus        40 ~~c~~c~~~~~~~~~l~~H~~   60 (72)
                      ..|+.|++.+ ....+..|..
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            3577777766 4455566654


No 65 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=90.64  E-value=0.062  Score=29.05  Aligned_cols=24  Identities=33%  Similarity=0.758  Sum_probs=20.0

Q ss_pred             CCCcccCcccchhccCcHHHHHhH
Q psy2647           8 GEKPHKCQVCGKAFSQSSNLITHS   31 (72)
Q Consensus         8 ~~~~~~c~~c~~~~~~~~~l~~~~   31 (72)
                      ..|||.|+.|++.|+....|+-|.
T Consensus       395 ~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         395 KDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             cCCceeccccchhhccCccceecc
Confidence            468999999999999887777664


No 66 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=90.13  E-value=0.068  Score=19.56  Aligned_cols=29  Identities=24%  Similarity=0.595  Sum_probs=18.7

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      |.|..|+..|.......      . .....|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~~------~-~~~~~CP~Cg~   34 (41)
T smart00834        6 YRCEDCGHTFEVLQKIS------D-DPLATCPECGG   34 (41)
T ss_pred             EEcCCCCCEEEEEEecC------C-CCCCCCCCCCC
Confidence            67999998775433221      1 34567999886


No 67 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=90.10  E-value=0.27  Score=18.35  Aligned_cols=25  Identities=28%  Similarity=0.642  Sum_probs=13.9

Q ss_pred             CCCccCCcchhhcCC----hHHHHHHHHH
Q psy2647          37 FKPFACDLCGRAFQR----KVDLRRHKET   61 (72)
Q Consensus        37 ~~~~~c~~c~~~~~~----~~~l~~H~~~   61 (72)
                      .....|..|++.+..    .+.|..|++.
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~~   42 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLKK   42 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhhh
Confidence            345677778776654    3677777743


No 68 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=90.07  E-value=0.13  Score=19.59  Aligned_cols=31  Identities=23%  Similarity=0.505  Sum_probs=19.7

Q ss_pred             CcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcC
Q psy2647          10 KPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~   50 (72)
                      ..|.|..|+..+.....          .....|+.||..+.
T Consensus         2 ~~y~C~~CG~~~~~~~~----------~~~~~Cp~CG~~~~   32 (46)
T PRK00398          2 AEYKCARCGREVELDEY----------GTGVRCPYCGYRIL   32 (46)
T ss_pred             CEEECCCCCCEEEECCC----------CCceECCCCCCeEE
Confidence            35789999876644221          11578999986543


No 69 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=90.00  E-value=0.19  Score=17.82  Aligned_cols=28  Identities=25%  Similarity=0.572  Sum_probs=16.2

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcC
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~   50 (72)
                      |.|..|+..+...           ...+.+|..||....
T Consensus         1 Y~C~~Cg~~~~~~-----------~~~~irC~~CG~RIl   28 (32)
T PF03604_consen    1 YICGECGAEVELK-----------PGDPIRCPECGHRIL   28 (32)
T ss_dssp             EBESSSSSSE-BS-----------TSSTSSBSSSS-SEE
T ss_pred             CCCCcCCCeeEcC-----------CCCcEECCcCCCeEE
Confidence            4677787655421           134678999986543


No 70 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=89.84  E-value=0.22  Score=23.56  Aligned_cols=24  Identities=38%  Similarity=0.722  Sum_probs=14.6

Q ss_pred             CccCCcchhhcCChHHHHHHHHHhccC
Q psy2647          39 PFACDLCGRAFQRKVDLRRHKETQHTE   65 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~H~~~~~~~   65 (72)
                      -..|-.||+.|..   |.+|++.||+.
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~gl   95 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHHGL   95 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT-S
T ss_pred             eeEEccCCcccch---HHHHHHHccCC
Confidence            4689999998875   48899986543


No 71 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=89.77  E-value=0.13  Score=26.26  Aligned_cols=25  Identities=32%  Similarity=0.727  Sum_probs=13.1

Q ss_pred             CccCCcchhhcCChHHHHHHHHHhc
Q psy2647          39 PFACDLCGRAFQRKVDLRRHKETQH   63 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~H~~~~~   63 (72)
                      .|.|..|+|.|.-..-...|+...|
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             EECCCCCCcccCChHHHHHHHhhcC
Confidence            4566666666666655566655444


No 72 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=89.68  E-value=0.23  Score=19.42  Aligned_cols=38  Identities=21%  Similarity=0.456  Sum_probs=23.3

Q ss_pred             CCcccCcccchhccCcHHHHHhHHHh-cCCCCccCCcch
Q psy2647           9 EKPHKCQVCGKAFSQSSNLITHSRKH-TGFKPFACDLCG   46 (72)
Q Consensus         9 ~~~~~c~~c~~~~~~~~~l~~~~~~~-~~~~~~~c~~c~   46 (72)
                      ++.+.|..|+..|.....-+..-..- ....|-.|..|-
T Consensus         2 Dk~l~C~dCg~~FvfTa~EQ~fy~eKgf~n~p~RC~~CR   40 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAGEQKFYAEKGFDNEPKRCPSCR   40 (49)
T ss_pred             CeeEEcccCCCeEEEehhHHHHHHhcCCcCCCccCHHHH
Confidence            45678999998887766544443331 123466777664


No 73 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=89.61  E-value=0.22  Score=17.97  Aligned_cols=34  Identities=18%  Similarity=0.487  Sum_probs=21.0

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcC
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~   50 (72)
                      ..|+.|+..|........     .....+.|+.|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~~~-----~~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQLG-----ANGGKVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHHcC-----CCCCEEECCCCCCEEE
Confidence            468888887765543211     1122578999987664


No 74 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=89.16  E-value=0.44  Score=21.51  Aligned_cols=25  Identities=28%  Similarity=0.658  Sum_probs=21.4

Q ss_pred             ccC----CcchhhcCChHHHHHHHHHhcc
Q psy2647          40 FAC----DLCGRAFQRKVDLRRHKETQHT   64 (72)
Q Consensus        40 ~~c----~~c~~~~~~~~~l~~H~~~~~~   64 (72)
                      |.|    ..|+....+...+..|.+.+|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            688    8899999999999999887664


No 75 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=88.71  E-value=0.18  Score=24.15  Aligned_cols=38  Identities=18%  Similarity=0.388  Sum_probs=23.9

Q ss_pred             CCcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcC
Q psy2647           9 EKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus         9 ~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~   50 (72)
                      ..-|.|+.|+..|.....+..-   .. ...|.|+.||....
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~~---d~-~~~f~Cp~Cg~~l~  134 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQLL---DM-DGTFTCPRCGEELE  134 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHhc---CC-CCcEECCCCCCEEE
Confidence            3458899999888754433210   11 23489999987553


No 76 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=88.32  E-value=0.16  Score=20.60  Aligned_cols=32  Identities=22%  Similarity=0.588  Sum_probs=16.4

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      .|.|+.|+.....+     -.+......+|.|+.||.
T Consensus        25 ~F~CPnCG~~~I~R-----C~~CRk~~~~Y~CP~CGF   56 (59)
T PRK14890         25 KFLCPNCGEVIIYR-----CEKCRKQSNPYTCPKCGF   56 (59)
T ss_pred             EeeCCCCCCeeEee-----chhHHhcCCceECCCCCC
Confidence            46677776542111     111222245788888763


No 77 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=87.97  E-value=0.24  Score=19.36  Aligned_cols=30  Identities=23%  Similarity=0.623  Sum_probs=19.7

Q ss_pred             CcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhc
Q psy2647          10 KPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAF   49 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~   49 (72)
                      ..|.|..|++.+...          .....+.|+.||...
T Consensus         5 ~~Y~C~~Cg~~~~~~----------~~~~~irCp~Cg~rI   34 (49)
T COG1996           5 MEYKCARCGREVELD----------QETRGIRCPYCGSRI   34 (49)
T ss_pred             EEEEhhhcCCeeehh----------hccCceeCCCCCcEE
Confidence            458899999877211          123467899998643


No 78 
>KOG2893|consensus
Probab=87.09  E-value=0.31  Score=25.49  Aligned_cols=26  Identities=35%  Similarity=0.718  Sum_probs=21.1

Q ss_pred             CCCccCCcchhhcCChHHHHHHHHHhc
Q psy2647          37 FKPFACDLCGRAFQRKVDLRRHKETQH   63 (72)
Q Consensus        37 ~~~~~c~~c~~~~~~~~~l~~H~~~~~   63 (72)
                      .++| |.+|++-|.....|++|++..|
T Consensus         9 ~kpw-cwycnrefddekiliqhqkakh   34 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQKAKH   34 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhhhcc
Confidence            3455 7899999999999999987533


No 79 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=86.02  E-value=0.93  Score=17.48  Aligned_cols=21  Identities=38%  Similarity=0.882  Sum_probs=14.0

Q ss_pred             ccCCcchhhcCCh-----HHHHHHHH
Q psy2647          40 FACDLCGRAFQRK-----VDLRRHKE   60 (72)
Q Consensus        40 ~~c~~c~~~~~~~-----~~l~~H~~   60 (72)
                      ..|..|++.+...     ++|.+|+.
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            4677777666443     57778877


No 80 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=85.65  E-value=0.52  Score=20.88  Aligned_cols=12  Identities=42%  Similarity=1.176  Sum_probs=6.4

Q ss_pred             cccCcccchhcc
Q psy2647          11 PHKCQVCGKAFS   22 (72)
Q Consensus        11 ~~~c~~c~~~~~   22 (72)
                      |-.|..||..|.
T Consensus        58 Pa~CkkCGfef~   69 (97)
T COG3357          58 PARCKKCGFEFR   69 (97)
T ss_pred             ChhhcccCcccc
Confidence            445566655543


No 81 
>PF12907 zf-met2:  Zinc-binding
Probab=85.44  E-value=0.22  Score=18.62  Aligned_cols=20  Identities=30%  Similarity=0.845  Sum_probs=8.5

Q ss_pred             cCCcchhhcCC---hHHHHHHHH
Q psy2647          41 ACDLCGRAFQR---KVDLRRHKE   60 (72)
Q Consensus        41 ~c~~c~~~~~~---~~~l~~H~~   60 (72)
                      .|.+|...|..   ...|..|..
T Consensus         3 ~C~iC~qtF~~t~~~~~L~eH~e   25 (40)
T PF12907_consen    3 ICKICRQTFMQTTNEPQLKEHAE   25 (40)
T ss_pred             CcHHhhHHHHhcCCHHHHHHHHH
Confidence            45555433332   233445544


No 82 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=83.12  E-value=0.94  Score=24.67  Aligned_cols=53  Identities=40%  Similarity=0.824  Sum_probs=42.4

Q ss_pred             CCcccCcccchhccCcHHHHHhHHHhcCCCCccCCc--chhhcCChHHHHHHHHH
Q psy2647           9 EKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDL--CGRAFQRKVDLRRHKET   61 (72)
Q Consensus         9 ~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~--c~~~~~~~~~l~~H~~~   61 (72)
                      ...+.|..|...|........+...+.++++..|..  |...+.....+..+.+.
T Consensus        31 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   85 (467)
T COG5048          31 PRPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSYSGCDKSFSRPLELSRHLRT   85 (467)
T ss_pred             CchhhcccccccccccchhhhhcccccccCCccccccccccccCCcchhhhhccc
Confidence            345778999999999999999999999999998875  55666666677777665


No 83 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=82.09  E-value=0.64  Score=20.45  Aligned_cols=30  Identities=30%  Similarity=0.717  Sum_probs=19.1

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcC
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~   50 (72)
                      .|.|+.|++.-        ..+..  ...|.|..|+..|.
T Consensus        35 ~~~Cp~C~~~~--------VkR~a--~GIW~C~kCg~~fA   64 (89)
T COG1997          35 KHVCPFCGRTT--------VKRIA--TGIWKCRKCGAKFA   64 (89)
T ss_pred             CCcCCCCCCcc--------eeeec--cCeEEcCCCCCeec
Confidence            57888887541        11222  33689999988775


No 84 
>PHA00626 hypothetical protein
Probab=81.14  E-value=0.86  Score=18.36  Aligned_cols=16  Identities=19%  Similarity=0.447  Sum_probs=12.7

Q ss_pred             CCCccCCcchhhcCCh
Q psy2647          37 FKPFACDLCGRAFQRK   52 (72)
Q Consensus        37 ~~~~~c~~c~~~~~~~   52 (72)
                      ...|.|..||..|...
T Consensus        21 snrYkCkdCGY~ft~~   36 (59)
T PHA00626         21 SDDYVCCDCGYNDSKD   36 (59)
T ss_pred             CcceEcCCCCCeechh
Confidence            4579999999988643


No 85 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=80.56  E-value=0.85  Score=15.28  Aligned_cols=10  Identities=40%  Similarity=1.042  Sum_probs=7.5

Q ss_pred             cCCcchhhcC
Q psy2647          41 ACDLCGRAFQ   50 (72)
Q Consensus        41 ~c~~c~~~~~   50 (72)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            6888887774


No 86 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=80.45  E-value=0.69  Score=15.28  Aligned_cols=9  Identities=56%  Similarity=1.446  Sum_probs=5.7

Q ss_pred             CCccCCcch
Q psy2647          38 KPFACDLCG   46 (72)
Q Consensus        38 ~~~~c~~c~   46 (72)
                      .+|.|+.||
T Consensus        15 v~f~CPnCG   23 (24)
T PF07754_consen   15 VPFPCPNCG   23 (24)
T ss_pred             ceEeCCCCC
Confidence            356677665


No 87 
>KOG4167|consensus
Probab=80.17  E-value=0.47  Score=28.74  Aligned_cols=24  Identities=29%  Similarity=0.623  Sum_probs=21.1

Q ss_pred             CccCCcchhhcCChHHHHHHHHHh
Q psy2647          39 PFACDLCGRAFQRKVDLRRHKETQ   62 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~H~~~~   62 (72)
                      -|.|..|++.|-...++..|+++|
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHH
Confidence            478999999999989999999885


No 88 
>KOG1842|consensus
Probab=79.43  E-value=1.7  Score=24.93  Aligned_cols=21  Identities=24%  Similarity=0.392  Sum_probs=10.5

Q ss_pred             ccCcccchhccCcHHHHHhHH
Q psy2647          12 HKCQVCGKAFSQSSNLITHSR   32 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~   32 (72)
                      +.|+.|...|.....|..|..
T Consensus        16 flCPiC~~dl~~~~~L~~H~d   36 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLD   36 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHh
Confidence            445555555555555544443


No 89 
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=78.67  E-value=0.46  Score=19.45  Aligned_cols=42  Identities=14%  Similarity=0.279  Sum_probs=22.7

Q ss_pred             cccCCCcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcC
Q psy2647           5 IWHGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus         5 ~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~   50 (72)
                      ++.+..++.|.--+-.+........   . ..+....|+.|+..|.
T Consensus        18 I~~~~~~l~C~g~~~p~~HPrV~L~---m-g~~gev~CPYC~t~y~   59 (62)
T COG4391          18 IEIGDLPLMCPGPEPPNDHPRVFLD---M-GDEGEVVCPYCSTRYR   59 (62)
T ss_pred             EEeCCeeEEcCCCCCCCCCCEEEEE---c-CCCCcEecCccccEEE
Confidence            4556667777655444333221111   1 2234568999988775


No 90 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=78.04  E-value=0.66  Score=19.66  Aligned_cols=39  Identities=18%  Similarity=0.371  Sum_probs=20.3

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCC--cchhhcCCh
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACD--LCGRAFQRK   52 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~--~c~~~~~~~   52 (72)
                      +.|+.|+..-.....  +.+.....+.-++|.  .||.+|...
T Consensus         2 m~CP~Cg~~a~irtS--r~~s~~~~~~Y~qC~N~eCg~tF~t~   42 (72)
T PRK09678          2 FHCPLCQHAAHARTS--RYITDTTKERYHQCQNVNCSATFITY   42 (72)
T ss_pred             ccCCCCCCccEEEEC--hhcChhhheeeeecCCCCCCCEEEEE
Confidence            467888754322211  111112334556787  788888643


No 91 
>KOG1146|consensus
Probab=77.94  E-value=0.56  Score=30.18  Aligned_cols=47  Identities=19%  Similarity=0.357  Sum_probs=31.8

Q ss_pred             cchhccCcHHHHHhHHH-hcCCCCccCCcchhhcCChHHHHHHHHHhc
Q psy2647          17 CGKAFSQSSNLITHSRK-HTGFKPFACDLCGRAFQRKVDLRRHKETQH   63 (72)
Q Consensus        17 c~~~~~~~~~l~~~~~~-~~~~~~~~c~~c~~~~~~~~~l~~H~~~~~   63 (72)
                      ++..+.+...+..++.. +...+-+.|++|+..+.....|..|+|..|
T Consensus       442 ~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskh  489 (1406)
T KOG1146|consen  442 AEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKH  489 (1406)
T ss_pred             hhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccc
Confidence            33334444444444432 344567899999999999999999998744


No 92 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=77.11  E-value=0.84  Score=21.65  Aligned_cols=15  Identities=33%  Similarity=0.736  Sum_probs=11.2

Q ss_pred             CcccCcccchhccCc
Q psy2647          10 KPHKCQVCGKAFSQS   24 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~   24 (72)
                      ..+.|..|+..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            457899999877654


No 93 
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=76.50  E-value=2  Score=24.48  Aligned_cols=29  Identities=28%  Similarity=0.723  Sum_probs=19.5

Q ss_pred             cCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCCh
Q psy2647          13 KCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRK   52 (72)
Q Consensus        13 ~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~   52 (72)
                      .|+.|+....+.           |.+-|+|..||..+...
T Consensus       352 ~Cp~Cg~~m~S~-----------G~~g~rC~kCg~~~~~~  380 (421)
T COG1571         352 VCPRCGGRMKSA-----------GRNGFRCKKCGTRARET  380 (421)
T ss_pred             CCCccCCchhhc-----------CCCCcccccccccCCcc
Confidence            688888654332           23378999998877654


No 94 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=76.41  E-value=0.38  Score=16.54  Aligned_cols=8  Identities=38%  Similarity=1.041  Sum_probs=3.8

Q ss_pred             CCcchhhc
Q psy2647          42 CDLCGRAF   49 (72)
Q Consensus        42 c~~c~~~~   49 (72)
                      |..|++.|
T Consensus         3 CiDC~~~F   10 (28)
T PF08790_consen    3 CIDCSKDF   10 (28)
T ss_dssp             ETTTTEEE
T ss_pred             eecCCCCc
Confidence            44444444


No 95 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=75.72  E-value=2.9  Score=19.40  Aligned_cols=20  Identities=30%  Similarity=0.735  Sum_probs=12.8

Q ss_pred             cccCcccchhccCcHHHHHh
Q psy2647          11 PHKCQVCGKAFSQSSNLITH   30 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~   30 (72)
                      |-.|+.|+-...+..+|.+.
T Consensus        15 P~~CpiCgLtLVss~HLARS   34 (112)
T TIGR00622        15 PVECPICGLTLILSTHLARS   34 (112)
T ss_pred             CCcCCcCCCEEeccchHHHh
Confidence            55677777666666666554


No 96 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=75.52  E-value=0.96  Score=16.85  Aligned_cols=12  Identities=33%  Similarity=1.146  Sum_probs=8.3

Q ss_pred             ccCCcchhhcCC
Q psy2647          40 FACDLCGRAFQR   51 (72)
Q Consensus        40 ~~c~~c~~~~~~   51 (72)
                      |.|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (42)
T PF09723_consen    6 YRCEECGHEFEV   17 (42)
T ss_pred             EEeCCCCCEEEE
Confidence            678888876653


No 97 
>KOG3408|consensus
Probab=75.50  E-value=2.6  Score=19.83  Aligned_cols=24  Identities=33%  Similarity=0.531  Sum_probs=19.1

Q ss_pred             CCccCCcchhhcCChHHHHHHHHH
Q psy2647          38 KPFACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        38 ~~~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      -.|-|..|.+-|.....+..|.++
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHHhc
Confidence            346788899999999888888653


No 98 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=75.40  E-value=2.4  Score=16.26  Aligned_cols=22  Identities=23%  Similarity=0.384  Sum_probs=15.2

Q ss_pred             ccCCcchhhcCChHHHHHHHHH
Q psy2647          40 FACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        40 ~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      |+|-.|+....-.+.|-.|+..
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            4666777776677777777763


No 99 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=75.19  E-value=0.63  Score=16.87  Aligned_cols=31  Identities=26%  Similarity=0.559  Sum_probs=15.8

Q ss_pred             cCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCC
Q psy2647          13 KCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQR   51 (72)
Q Consensus        13 ~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~   51 (72)
                      .|..|+..|-....        .....-.|..||..+.+
T Consensus         3 ~C~~Cg~~Yh~~~~--------pP~~~~~Cd~cg~~L~q   33 (36)
T PF05191_consen    3 ICPKCGRIYHIEFN--------PPKVEGVCDNCGGELVQ   33 (36)
T ss_dssp             EETTTTEEEETTTB----------SSTTBCTTTTEBEBE
T ss_pred             CcCCCCCccccccC--------CCCCCCccCCCCCeeEe
Confidence            56777766542221        12334567777765443


No 100
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=74.98  E-value=3.2  Score=24.04  Aligned_cols=26  Identities=23%  Similarity=0.501  Sum_probs=19.5

Q ss_pred             CccCCcchhhcCChHHHHHHHHHhcc
Q psy2647          39 PFACDLCGRAFQRKVDLRRHKETQHT   64 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~H~~~~~~   64 (72)
                      -+.|+.|.+.|.....+..|+...|.
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~   82 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHP   82 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhh
Confidence            35788888888888888888764443


No 101
>KOG4167|consensus
Probab=74.67  E-value=0.82  Score=27.81  Aligned_cols=25  Identities=28%  Similarity=0.573  Sum_probs=21.5

Q ss_pred             cccCcccchhccCcHHHHHhHHHhc
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHT   35 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~   35 (72)
                      -|.|.+|++.|.-...+..||++|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            4889999999988888889988774


No 102
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=73.63  E-value=2  Score=19.84  Aligned_cols=27  Identities=19%  Similarity=0.332  Sum_probs=18.8

Q ss_pred             cCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcC
Q psy2647          13 KCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus        13 ~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~   50 (72)
                      .|+.|++.|..           ....|..|++||++|.
T Consensus        11 idPetg~KFYD-----------LNrdPiVsPytG~s~P   37 (129)
T COG4530          11 IDPETGKKFYD-----------LNRDPIVSPYTGKSYP   37 (129)
T ss_pred             cCccccchhhc-----------cCCCccccCcccccch
Confidence            57777766532           2346888999999884


No 103
>KOG2482|consensus
Probab=72.46  E-value=2.7  Score=23.43  Aligned_cols=22  Identities=27%  Similarity=0.650  Sum_probs=20.2

Q ss_pred             ccCCcchhhcCChHHHHHHHHH
Q psy2647          40 FACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        40 ~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      ++|-.|-+.|..+..|..|++.
T Consensus       196 ~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHh
Confidence            5899999999999999999984


No 104
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=70.80  E-value=2.1  Score=19.27  Aligned_cols=13  Identities=46%  Similarity=1.265  Sum_probs=7.6

Q ss_pred             CcccCcccchhcc
Q psy2647          10 KPHKCQVCGKAFS   22 (72)
Q Consensus        10 ~~~~c~~c~~~~~   22 (72)
                      ++..|..|+..|.
T Consensus        78 ~~~rC~eCG~~fk   90 (97)
T cd00924          78 KPKRCPECGHVFK   90 (97)
T ss_pred             CceeCCCCCcEEE
Confidence            4566666665554


No 105
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=70.24  E-value=2.1  Score=20.50  Aligned_cols=20  Identities=35%  Similarity=0.589  Sum_probs=13.0

Q ss_pred             cCCcchhhcCChHHHHHHHHHhc
Q psy2647          41 ACDLCGRAFQRKVDLRRHKETQH   63 (72)
Q Consensus        41 ~c~~c~~~~~~~~~l~~H~~~~~   63 (72)
                      .|-.+|+.|.   +|++|+.+|+
T Consensus        78 icLEDGkkfK---SLKRHL~t~~   97 (148)
T COG4957          78 ICLEDGKKFK---SLKRHLTTHY   97 (148)
T ss_pred             EEeccCcchH---HHHHHHhccc
Confidence            5666676654   5777887743


No 106
>KOG2785|consensus
Probab=70.15  E-value=7.4  Score=22.07  Aligned_cols=51  Identities=29%  Similarity=0.585  Sum_probs=37.5

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCC-----------------------CCccCCcch---hhcCChHHHHHHHHH
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGF-----------------------KPFACDLCG---RAFQRKVDLRRHKET   61 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~-----------------------~~~~c~~c~---~~~~~~~~l~~H~~~   61 (72)
                      |=.|-.|+..++.-.....||..+.+-                       .-+.|..|+   +.|.+......|+..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            445788988888888888888765431                       235777787   888888888888874


No 107
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=69.21  E-value=2.6  Score=20.09  Aligned_cols=14  Identities=43%  Similarity=1.115  Sum_probs=7.8

Q ss_pred             CccCCcchhhcCCh
Q psy2647          39 PFACDLCGRAFQRK   52 (72)
Q Consensus        39 ~~~c~~c~~~~~~~   52 (72)
                      |++|..||+.|..-
T Consensus         1 PH~Ct~Cg~~f~dg   14 (131)
T PF09845_consen    1 PHQCTKCGRVFEDG   14 (131)
T ss_pred             CcccCcCCCCcCCC
Confidence            34566666666543


No 108
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=68.58  E-value=1.9  Score=15.03  Aligned_cols=11  Identities=27%  Similarity=0.682  Sum_probs=6.7

Q ss_pred             CCCccCCcchh
Q psy2647          37 FKPFACDLCGR   47 (72)
Q Consensus        37 ~~~~~c~~c~~   47 (72)
                      ...+.|+.|+.
T Consensus        17 ~~~~vCp~C~~   27 (30)
T PF08274_consen   17 GELLVCPECGH   27 (30)
T ss_dssp             SSSEEETTTTE
T ss_pred             CCEEeCCcccc
Confidence            34567777753


No 109
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=68.07  E-value=1.9  Score=21.07  Aligned_cols=33  Identities=27%  Similarity=0.759  Sum_probs=16.7

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhh
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRA   48 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~   48 (72)
                      +|.|. |+..|..   ..+|.....|+ .|.|..|+..
T Consensus       117 ~Y~C~-C~q~~l~---~RRhn~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         117 PYRCQ-CQQHYLR---IRRHNTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             eEEee-cCCccch---hhhcccccccc-eEEeccCCce
Confidence            46666 6655433   22333333344 5777777643


No 110
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=67.71  E-value=2.4  Score=19.57  Aligned_cols=24  Identities=21%  Similarity=0.639  Sum_probs=15.4

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      ..|..|+..|.....            .+.|+.||.
T Consensus        71 ~~C~~Cg~~~~~~~~------------~~~CP~Cgs   94 (115)
T TIGR00100        71 CECEDCSEEVSPEID------------LYRCPKCHG   94 (115)
T ss_pred             EEcccCCCEEecCCc------------CccCcCCcC
Confidence            568888866654321            357888874


No 111
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=66.89  E-value=2.7  Score=15.46  Aligned_cols=13  Identities=38%  Similarity=0.899  Sum_probs=10.3

Q ss_pred             CccCCcchhhcCC
Q psy2647          39 PFACDLCGRAFQR   51 (72)
Q Consensus        39 ~~~c~~c~~~~~~   51 (72)
                      |+.|..|+..|-.
T Consensus        12 ~f~C~~C~~~FC~   24 (39)
T smart00154       12 GFKCRHCGNLFCG   24 (39)
T ss_pred             CeECCccCCcccc
Confidence            7889888887754


No 112
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=66.72  E-value=5.6  Score=20.38  Aligned_cols=34  Identities=18%  Similarity=0.412  Sum_probs=20.0

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhc
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAF   49 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~   49 (72)
                      +.|+.|+.    ......-++....+..+.|..||..+
T Consensus         7 ~~Cp~Cg~----eev~hEVik~~g~~~lvrC~eCG~V~   40 (201)
T COG1326           7 IECPSCGS----EEVSHEVIKERGREPLVRCEECGTVH   40 (201)
T ss_pred             EECCCCCc----chhhHHHHHhcCCceEEEccCCCcEe
Confidence            56999982    22222333333334467899999766


No 113
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=66.55  E-value=3  Score=19.04  Aligned_cols=13  Identities=38%  Similarity=1.096  Sum_probs=9.1

Q ss_pred             CccCCcchhhcCC
Q psy2647          39 PFACDLCGRAFQR   51 (72)
Q Consensus        39 ~~~c~~c~~~~~~   51 (72)
                      |.+|..||..|..
T Consensus         2 pH~CtrCG~vf~~   14 (112)
T COG3364           2 PHQCTRCGEVFDD   14 (112)
T ss_pred             Cceeccccccccc
Confidence            5677777777765


No 114
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=66.16  E-value=2.7  Score=25.68  Aligned_cols=28  Identities=36%  Similarity=0.829  Sum_probs=17.3

Q ss_pred             CcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          14 CQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        14 c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      |+.|.+.|....+-.-|      ..|..|+.||.
T Consensus       154 C~~C~~EY~dP~nRRfH------AQp~aCp~CGP  181 (750)
T COG0068         154 CPFCDKEYKDPLNRRFH------AQPIACPKCGP  181 (750)
T ss_pred             CHHHHHHhcCccccccc------cccccCcccCC
Confidence            77777766655543222      34678888875


No 115
>KOG0717|consensus
Probab=65.77  E-value=3.9  Score=23.79  Aligned_cols=22  Identities=23%  Similarity=0.776  Sum_probs=18.5

Q ss_pred             ccCCcchhhcCChHHHHHHHHH
Q psy2647          40 FACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        40 ~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      +-|.+|.+.|.+...+..|...
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6799999999999888888653


No 116
>PLN02294 cytochrome c oxidase subunit Vb
Probab=65.42  E-value=3.3  Score=20.70  Aligned_cols=14  Identities=36%  Similarity=0.826  Sum_probs=9.5

Q ss_pred             CcccCcccchhccC
Q psy2647          10 KPHKCQVCGKAFSQ   23 (72)
Q Consensus        10 ~~~~c~~c~~~~~~   23 (72)
                      +++.|+.|+..|..
T Consensus       140 kp~RCpeCG~~fkL  153 (174)
T PLN02294        140 KSFECPVCTQYFEL  153 (174)
T ss_pred             CceeCCCCCCEEEE
Confidence            56777777776653


No 117
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=65.25  E-value=5.2  Score=14.24  Aligned_cols=20  Identities=30%  Similarity=0.620  Sum_probs=10.8

Q ss_pred             ccCCcchhhcCChHHHHHHHH
Q psy2647          40 FACDLCGRAFQRKVDLRRHKE   60 (72)
Q Consensus        40 ~~c~~c~~~~~~~~~l~~H~~   60 (72)
                      +.|+.|++.+. .+.+..|+.
T Consensus         5 ~~C~nC~R~v~-a~RfA~HLe   24 (33)
T PF08209_consen    5 VECPNCGRPVA-ASRFAPHLE   24 (33)
T ss_dssp             EE-TTTSSEEE-GGGHHHHHH
T ss_pred             EECCCCcCCcc-hhhhHHHHH
Confidence            56777776543 444556654


No 118
>KOG0978|consensus
Probab=64.93  E-value=2.5  Score=25.69  Aligned_cols=18  Identities=22%  Similarity=0.368  Sum_probs=13.3

Q ss_pred             CCccCCcchhhcCChHHH
Q psy2647          38 KPFACDLCGRAFQRKVDL   55 (72)
Q Consensus        38 ~~~~c~~c~~~~~~~~~l   55 (72)
                      +--.||.|+..|.....+
T Consensus       677 RqRKCP~Cn~aFganDv~  694 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGANDVH  694 (698)
T ss_pred             hcCCCCCCCCCCCccccc
Confidence            345899999999866443


No 119
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=64.83  E-value=0.85  Score=23.83  Aligned_cols=25  Identities=24%  Similarity=0.446  Sum_probs=17.6

Q ss_pred             CCcccCcccchhccCcHHHHHhHHH
Q psy2647           9 EKPHKCQVCGKAFSQSSNLITHSRK   33 (72)
Q Consensus         9 ~~~~~c~~c~~~~~~~~~l~~~~~~   33 (72)
                      ++...|+.|+..|..........+.
T Consensus        17 kk~ieCPvC~tkFkkeev~tgsiRi   41 (267)
T COG1655          17 KKTIECPVCNTKFKKEEVKTGSIRI   41 (267)
T ss_pred             hceeccCcccchhhhhheeccceeE
Confidence            3567899999988777655555443


No 120
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=64.73  E-value=3.5  Score=18.99  Aligned_cols=24  Identities=17%  Similarity=0.403  Sum_probs=15.0

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      ..|..|+..|....            ..+.|+.||.
T Consensus        71 ~~C~~Cg~~~~~~~------------~~~~CP~Cgs   94 (113)
T PRK12380         71 AWCWDCSQVVEIHQ------------HDAQCPHCHG   94 (113)
T ss_pred             EEcccCCCEEecCC------------cCccCcCCCC
Confidence            56888886654322            2356888874


No 121
>KOG2071|consensus
Probab=64.00  E-value=6.6  Score=23.51  Aligned_cols=25  Identities=24%  Similarity=0.542  Sum_probs=19.5

Q ss_pred             CCCccCCcchhhcCChHHHHHHHHH
Q psy2647          37 FKPFACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        37 ~~~~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      ..+-+|..||.+|........|+..
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~  440 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDI  440 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhh
Confidence            4567999999999988776666655


No 122
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=62.10  E-value=4.2  Score=16.07  Aligned_cols=13  Identities=23%  Similarity=0.672  Sum_probs=3.7

Q ss_pred             ccCcccchhccCc
Q psy2647          12 HKCQVCGKAFSQS   24 (72)
Q Consensus        12 ~~c~~c~~~~~~~   24 (72)
                      |.|+.|...|-..
T Consensus        22 y~C~~C~~~FC~d   34 (51)
T PF07975_consen   22 YRCPKCKNHFCID   34 (51)
T ss_dssp             E--TTTT--B-HH
T ss_pred             EECCCCCCccccC
Confidence            4455555444433


No 123
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=62.03  E-value=5.8  Score=17.13  Aligned_cols=32  Identities=22%  Similarity=0.616  Sum_probs=19.0

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhc
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAF   49 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~   49 (72)
                      .|.|..|+..|.    +.+++..   .....|+.|+-.+
T Consensus        12 ~Y~c~~cg~~~d----vvq~~~d---dplt~ce~c~a~~   43 (82)
T COG2331          12 SYECTECGNRFD----VVQAMTD---DPLTTCEECGARL   43 (82)
T ss_pred             EEeecccchHHH----HHHhccc---CccccChhhChHH
Confidence            378999987654    3444432   2234688887543


No 124
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=61.93  E-value=7.9  Score=15.16  Aligned_cols=11  Identities=27%  Similarity=1.081  Sum_probs=5.6

Q ss_pred             ccCCcchhhcC
Q psy2647          40 FACDLCGRAFQ   50 (72)
Q Consensus        40 ~~c~~c~~~~~   50 (72)
                      ++|..|+..+.
T Consensus        29 W~C~~Cgh~w~   39 (55)
T PF14311_consen   29 WKCPKCGHEWK   39 (55)
T ss_pred             EECCCCCCeeE
Confidence            45555554443


No 125
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=61.85  E-value=1.9  Score=16.09  Aligned_cols=15  Identities=47%  Similarity=1.103  Sum_probs=8.7

Q ss_pred             CCccCCcchhhcCCh
Q psy2647          38 KPFACDLCGRAFQRK   52 (72)
Q Consensus        38 ~~~~c~~c~~~~~~~   52 (72)
                      .++.|..|+..|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            468898888887543


No 126
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=61.79  E-value=3.9  Score=16.07  Aligned_cols=39  Identities=21%  Similarity=0.519  Sum_probs=19.5

Q ss_pred             cccCcc--cchhccCcHHHHHhHHHhcCCCCccCCc----chhhcC
Q psy2647          11 PHKCQV--CGKAFSQSSNLITHSRKHTGFKPFACDL----CGRAFQ   50 (72)
Q Consensus        11 ~~~c~~--c~~~~~~~~~l~~~~~~~~~~~~~~c~~----c~~~~~   50 (72)
                      +-.|+.  |...+. +..|..|....=...+..|..    |+..+.
T Consensus         9 ~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    9 PVPCPNGCCNEMIP-RKELDDHLENECPKRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             EEE-TT--S-BEEE-CCCHHHHHHTTSTTSEEE-SS----S--EEE
T ss_pred             EeeCCCCCccccee-HHHHHHHHHccCCCCcEECCCCCCCCCCccc
Confidence            345655  433333 456777877444455677877    766554


No 127
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=61.20  E-value=3.9  Score=15.88  Aligned_cols=10  Identities=20%  Similarity=1.006  Sum_probs=3.6

Q ss_pred             CCccCCcchh
Q psy2647          38 KPFACDLCGR   47 (72)
Q Consensus        38 ~~~~c~~c~~   47 (72)
                      ..|.|+.|++
T Consensus        40 ~~W~CPiC~~   49 (50)
T PF02891_consen   40 PKWKCPICNK   49 (50)
T ss_dssp             ---B-TTT--
T ss_pred             CCeECcCCcC
Confidence            3489999864


No 128
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=60.38  E-value=9.7  Score=14.11  Aligned_cols=22  Identities=27%  Similarity=0.555  Sum_probs=13.1

Q ss_pred             ccCCcchhhcC--ChHHHHHHHHH
Q psy2647          40 FACDLCGRAFQ--RKVDLRRHKET   61 (72)
Q Consensus        40 ~~c~~c~~~~~--~~~~l~~H~~~   61 (72)
                      ..|..||..+.  ....-..|.+.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~y   37 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKY   37 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHH
Confidence            47777776554  34455566664


No 129
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=59.83  E-value=7.2  Score=19.64  Aligned_cols=33  Identities=21%  Similarity=0.496  Sum_probs=20.1

Q ss_pred             CCCcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhc
Q psy2647           8 GEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAF   49 (72)
Q Consensus         8 ~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~   49 (72)
                      ...-|.|+.|.-.++...+..         ..|.|+.||...
T Consensus       110 ~~~~y~C~~~~~r~sfdeA~~---------~~F~Cp~Cg~~L  142 (176)
T COG1675         110 ENNYYVCPNCHVKYSFDEAME---------LGFTCPKCGEDL  142 (176)
T ss_pred             cCCceeCCCCCCcccHHHHHH---------hCCCCCCCCchh
Confidence            345578877766554433321         138999998644


No 130
>KOG3507|consensus
Probab=59.80  E-value=4.1  Score=16.62  Aligned_cols=31  Identities=26%  Similarity=0.403  Sum_probs=19.5

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCCh
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQRK   52 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~   52 (72)
                      .|.|..|+..-    .|+       ....++|..||.....+
T Consensus        20 iYiCgdC~~en----~lk-------~~D~irCReCG~RIlyK   50 (62)
T KOG3507|consen   20 IYICGDCGQEN----TLK-------RGDVIRCRECGYRILYK   50 (62)
T ss_pred             EEEeccccccc----ccc-------CCCcEehhhcchHHHHH
Confidence            47888887532    111       13468999999776544


No 131
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=59.34  E-value=3.5  Score=16.13  Aligned_cols=12  Identities=42%  Similarity=1.190  Sum_probs=6.2

Q ss_pred             cCCcchhhcCCh
Q psy2647          41 ACDLCGRAFQRK   52 (72)
Q Consensus        41 ~c~~c~~~~~~~   52 (72)
                      .|+.|+..|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            899999888643


No 132
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=59.29  E-value=1.4  Score=15.94  Aligned_cols=12  Identities=25%  Similarity=0.797  Sum_probs=6.0

Q ss_pred             CccCCcchhhcC
Q psy2647          39 PFACDLCGRAFQ   50 (72)
Q Consensus        39 ~~~c~~c~~~~~   50 (72)
                      +..|..||..+.
T Consensus        21 ~isC~~CGPr~~   32 (35)
T PF07503_consen   21 FISCTNCGPRYS   32 (35)
T ss_dssp             T--BTTCC-SCC
T ss_pred             CccCCCCCCCEE
Confidence            457788886553


No 133
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=58.72  E-value=2.6  Score=18.73  Aligned_cols=12  Identities=17%  Similarity=0.600  Sum_probs=8.9

Q ss_pred             CccCCcchhhcC
Q psy2647          39 PFACDLCGRAFQ   50 (72)
Q Consensus        39 ~~~c~~c~~~~~   50 (72)
                      .|.|..|++.|.
T Consensus        54 IW~C~~C~~~~A   65 (90)
T PTZ00255         54 IWRCKGCKKTVA   65 (90)
T ss_pred             EEEcCCCCCEEe
Confidence            578888887664


No 134
>KOG4173|consensus
Probab=58.33  E-value=11  Score=19.71  Aligned_cols=52  Identities=25%  Similarity=0.472  Sum_probs=31.4

Q ss_pred             cCcccchhccCcHHHHHhHHHhc----------CCCCccCC--cchhhcCChHHHHHHHHHhcc
Q psy2647          13 KCQVCGKAFSQSSNLITHSRKHT----------GFKPFACD--LCGRAFQRKVDLRRHKETQHT   64 (72)
Q Consensus        13 ~c~~c~~~~~~~~~l~~~~~~~~----------~~~~~~c~--~c~~~~~~~~~l~~H~~~~~~   64 (72)
                      .|..|.+.|++...|..|+....          |..-|+|.  .|+..|......+.|+-..|.
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHMIRMHK  171 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHHHHhcc
Confidence            57777777777766666665321          12235664  477777777666666655443


No 135
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=57.67  E-value=8  Score=20.93  Aligned_cols=8  Identities=38%  Similarity=0.937  Sum_probs=4.1

Q ss_pred             cCCcchhh
Q psy2647          41 ACDLCGRA   48 (72)
Q Consensus        41 ~c~~c~~~   48 (72)
                      .|..|+-.
T Consensus       271 ~C~~Cgt~  278 (279)
T TIGR00627       271 ICKTCKTA  278 (279)
T ss_pred             CCCCCCCC
Confidence            55555543


No 136
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=56.94  E-value=0.5  Score=17.49  Aligned_cols=10  Identities=30%  Similarity=1.208  Sum_probs=6.9

Q ss_pred             ccCCcchhhc
Q psy2647          40 FACDLCGRAF   49 (72)
Q Consensus        40 ~~c~~c~~~~   49 (72)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            6777777654


No 137
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=56.93  E-value=6.6  Score=16.02  Aligned_cols=30  Identities=27%  Similarity=0.680  Sum_probs=18.1

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCC
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQR   51 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~   51 (72)
                      ..|+.|+.....          ......+.|+.||.....
T Consensus        29 q~C~~CG~~~~~----------~~~~r~~~C~~Cg~~~~r   58 (69)
T PF07282_consen   29 QTCPRCGHRNKK----------RRSGRVFTCPNCGFEMDR   58 (69)
T ss_pred             cCccCccccccc----------ccccceEEcCCCCCEECc
Confidence            457777754332          123456889999876543


No 138
>KOG2907|consensus
Probab=56.81  E-value=3.6  Score=19.11  Aligned_cols=11  Identities=27%  Similarity=0.896  Sum_probs=7.5

Q ss_pred             ccCCcchhhcC
Q psy2647          40 FACDLCGRAFQ   50 (72)
Q Consensus        40 ~~c~~c~~~~~   50 (72)
                      |.|..|++.|.
T Consensus       103 YTC~kC~~k~~  113 (116)
T KOG2907|consen  103 YTCPKCKYKFT  113 (116)
T ss_pred             EEcCccceeee
Confidence            67777776654


No 139
>KOG2593|consensus
Probab=56.37  E-value=13  Score=21.56  Aligned_cols=35  Identities=23%  Similarity=0.485  Sum_probs=16.9

Q ss_pred             CcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          10 KPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      ..|.|+.|.+.|.....+.--   ....-.|.|..|+.
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~~L~---~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEALQLL---DNETGEFHCENCGG  161 (436)
T ss_pred             ccccCCccccchhhhHHHHhh---cccCceEEEecCCC
Confidence            346666666666554433221   11112456666653


No 140
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=55.94  E-value=1.4  Score=15.77  Aligned_cols=11  Identities=27%  Similarity=0.791  Sum_probs=6.4

Q ss_pred             CCccCCcchhh
Q psy2647          38 KPFACDLCGRA   48 (72)
Q Consensus        38 ~~~~c~~c~~~   48 (72)
                      ..+.|+.|+..
T Consensus        21 ~R~vC~~Cg~I   31 (34)
T PF14803_consen   21 ERLVCPACGFI   31 (34)
T ss_dssp             -EEEETTTTEE
T ss_pred             cceECCCCCCE
Confidence            34667777653


No 141
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=55.86  E-value=6.4  Score=18.66  Aligned_cols=35  Identities=20%  Similarity=0.524  Sum_probs=20.1

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcCC
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQR   51 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~   51 (72)
                      -.|+.|+... ..    ..-....+...|.|..|++.|..
T Consensus        31 ~~cP~C~s~~-~~----k~g~~~~~~qRyrC~~C~~tf~~   65 (129)
T COG3677          31 VNCPRCKSSN-VV----KIGGIRRGHQRYKCKSCGSTFTV   65 (129)
T ss_pred             CcCCCCCccc-ee----eECCccccccccccCCcCcceee
Confidence            3577777543 11    11111223457999999998864


No 142
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=55.43  E-value=5.1  Score=18.57  Aligned_cols=13  Identities=23%  Similarity=0.728  Sum_probs=8.5

Q ss_pred             cccCcccchhccC
Q psy2647          11 PHKCQVCGKAFSQ   23 (72)
Q Consensus        11 ~~~c~~c~~~~~~   23 (72)
                      ...|..|+..|..
T Consensus        71 ~~~C~~Cg~~~~~   83 (117)
T PRK00564         71 ELECKDCSHVFKP   83 (117)
T ss_pred             EEEhhhCCCcccc
Confidence            3568888866543


No 143
>KOG2636|consensus
Probab=54.75  E-value=12  Score=21.92  Aligned_cols=27  Identities=22%  Similarity=0.555  Sum_probs=19.3

Q ss_pred             HhcCCCCccCCcch-hhcCChHHHHHHH
Q psy2647          33 KHTGFKPFACDLCG-RAFQRKVDLRRHK   59 (72)
Q Consensus        33 ~~~~~~~~~c~~c~-~~~~~~~~l~~H~   59 (72)
                      .|.-...|.|.+|| +++.-+..+.+|.
T Consensus       395 LHGL~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  395 LHGLDIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             hcCCCcccceeeccCccccCcHHHHHHh
Confidence            45556678888888 6777777777774


No 144
>COG1773 Rubredoxin [Energy production and conversion]
Probab=52.95  E-value=5.8  Score=15.96  Aligned_cols=15  Identities=33%  Similarity=0.911  Sum_probs=10.8

Q ss_pred             CcccCcccchhccCc
Q psy2647          10 KPHKCQVCGKAFSQS   24 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~   24 (72)
                      +.|.|..|+..|.-.
T Consensus         2 ~~~~C~~CG~vYd~e   16 (55)
T COG1773           2 KRWRCSVCGYVYDPE   16 (55)
T ss_pred             CceEecCCceEeccc
Confidence            357899998877543


No 145
>KOG0562|consensus
Probab=51.35  E-value=16  Score=18.40  Aligned_cols=27  Identities=15%  Similarity=0.139  Sum_probs=20.4

Q ss_pred             CCCccCCcchhhcCChHHHHHHHHHhc
Q psy2647          37 FKPFACDLCGRAFQRKVDLRRHKETQH   63 (72)
Q Consensus        37 ~~~~~c~~c~~~~~~~~~l~~H~~~~~   63 (72)
                      +.+..|..|+..-.....|+.|++.++
T Consensus       151 k~dLrC~~Cq~~~~~~~kLK~Hl~~~~  177 (184)
T KOG0562|consen  151 KEDLRCWRCQTFGPHFPKLKAHLREEY  177 (184)
T ss_pred             ccceeehhhhhcccccHHHHHHHHHHH
Confidence            346789999855567788999998744


No 146
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=51.33  E-value=6.5  Score=15.40  Aligned_cols=11  Identities=27%  Similarity=1.228  Sum_probs=7.1

Q ss_pred             ccCCcchhhcC
Q psy2647          40 FACDLCGRAFQ   50 (72)
Q Consensus        40 ~~c~~c~~~~~   50 (72)
                      |+|..||..+.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            56777776554


No 147
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=50.64  E-value=4.1  Score=18.72  Aligned_cols=25  Identities=32%  Similarity=0.926  Sum_probs=13.5

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhh
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRA   48 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~   48 (72)
                      ..|..|+..|.....            .+.|+.|+..
T Consensus        71 ~~C~~Cg~~~~~~~~------------~~~CP~Cgs~   95 (113)
T PF01155_consen   71 ARCRDCGHEFEPDEF------------DFSCPRCGSP   95 (113)
T ss_dssp             EEETTTS-EEECHHC------------CHH-SSSSSS
T ss_pred             EECCCCCCEEecCCC------------CCCCcCCcCC
Confidence            567888877654321            2458877753


No 148
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=50.60  E-value=9.6  Score=14.44  Aligned_cols=14  Identities=36%  Similarity=0.956  Sum_probs=10.7

Q ss_pred             cCcccchhccCcHH
Q psy2647          13 KCQVCGKAFSQSSN   26 (72)
Q Consensus        13 ~c~~c~~~~~~~~~   26 (72)
                      .|..|++.|.....
T Consensus        10 ~C~~C~rpf~WRKK   23 (42)
T PF10013_consen   10 ICPVCGRPFTWRKK   23 (42)
T ss_pred             cCcccCCcchHHHH
Confidence            58999998876554


No 149
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=49.89  E-value=6.1  Score=14.74  Aligned_cols=9  Identities=33%  Similarity=1.047  Sum_probs=4.0

Q ss_pred             ccCCcchhh
Q psy2647          40 FACDLCGRA   48 (72)
Q Consensus        40 ~~c~~c~~~   48 (72)
                      ..|+.|+..
T Consensus        30 ~~CpYCg~~   38 (40)
T PF10276_consen   30 VVCPYCGTR   38 (40)
T ss_dssp             EEETTTTEE
T ss_pred             EECCCCCCE
Confidence            344444443


No 150
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=49.43  E-value=9.4  Score=17.61  Aligned_cols=23  Identities=26%  Similarity=0.627  Sum_probs=18.2

Q ss_pred             CcccCcccchhccCcHHHHHhHH
Q psy2647          10 KPHKCQVCGKAFSQSSNLITHSR   32 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~~~l~~~~~   32 (72)
                      ..+.|-.|.+-|.+...|..|.+
T Consensus        54 GqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          54 GQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             ceeeeehhHHHHHHHHHHHHHhc
Confidence            34678889998988888888865


No 151
>PF14353 CpXC:  CpXC protein
Probab=48.71  E-value=7.4  Score=18.11  Aligned_cols=15  Identities=33%  Similarity=0.871  Sum_probs=11.2

Q ss_pred             CCccCCcchhhcCCh
Q psy2647          38 KPFACDLCGRAFQRK   52 (72)
Q Consensus        38 ~~~~c~~c~~~~~~~   52 (72)
                      ..+.|+.||..|.-.
T Consensus        37 ~~~~CP~Cg~~~~~~   51 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLE   51 (128)
T ss_pred             CEEECCCCCCceecC
Confidence            357999999877543


No 152
>PHA02998 RNA polymerase subunit; Provisional
Probab=48.43  E-value=1.8  Score=21.77  Aligned_cols=13  Identities=31%  Similarity=0.738  Sum_probs=10.1

Q ss_pred             ccCCcchhhcCCh
Q psy2647          40 FACDLCGRAFQRK   52 (72)
Q Consensus        40 ~~c~~c~~~~~~~   52 (72)
                      |.|..||..+..+
T Consensus       172 YkC~~CG~~wkpp  184 (195)
T PHA02998        172 HACRDCKKHFKPP  184 (195)
T ss_pred             EEcCCCCCccCCc
Confidence            6899999887654


No 153
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=47.75  E-value=6.5  Score=18.78  Aligned_cols=10  Identities=30%  Similarity=1.109  Sum_probs=6.2

Q ss_pred             ccCCcchhhc
Q psy2647          40 FACDLCGRAF   49 (72)
Q Consensus        40 ~~c~~c~~~~   49 (72)
                      +.|..|+..+
T Consensus       144 ~~C~~C~~~l  153 (157)
T PF10263_consen  144 YRCGRCGGPL  153 (157)
T ss_pred             EECCCCCCEE
Confidence            6677776544


No 154
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=46.77  E-value=17  Score=14.03  Aligned_cols=10  Identities=50%  Similarity=1.245  Sum_probs=5.4

Q ss_pred             cCcccchhcc
Q psy2647          13 KCQVCGKAFS   22 (72)
Q Consensus        13 ~c~~c~~~~~   22 (72)
                      .|..|++.|.
T Consensus         4 ~C~~C~~~F~   13 (57)
T cd00065           4 SCMGCGKPFT   13 (57)
T ss_pred             cCcccCcccc
Confidence            3555665554


No 155
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=46.35  E-value=5.9  Score=22.97  Aligned_cols=39  Identities=18%  Similarity=0.353  Sum_probs=21.3

Q ss_pred             CCcccCcccchhccCcHHH-HHhHHHhc----CCCCccCCcchh
Q psy2647           9 EKPHKCQVCGKAFSQSSNL-ITHSRKHT----GFKPFACDLCGR   47 (72)
Q Consensus         9 ~~~~~c~~c~~~~~~~~~l-~~~~~~~~----~~~~~~c~~c~~   47 (72)
                      ...|.|..|+..|.-..-- ..-+...+    -...|.|+.|+.
T Consensus       423 ~~~~~c~~c~~~yd~~~g~~~~~~~~gt~~~~lp~~~~cp~c~~  466 (479)
T PRK05452        423 GPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSL  466 (479)
T ss_pred             CCeEEECCCCeEECCCCCCcccCCCCCCChhhCCCCCcCcCCCC
Confidence            4568999999887643211 11111110    012479999974


No 156
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=45.86  E-value=6.4  Score=18.17  Aligned_cols=26  Identities=15%  Similarity=0.427  Sum_probs=14.9

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      ...|..|+..|.....           ..+.|+.||.
T Consensus        70 ~~~C~~Cg~~~~~~~~-----------~~~~CP~Cgs   95 (114)
T PRK03681         70 ECWCETCQQYVTLLTQ-----------RVRRCPQCHG   95 (114)
T ss_pred             EEEcccCCCeeecCCc-----------cCCcCcCcCC
Confidence            3568888865532111           1256888874


No 157
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=45.85  E-value=8.4  Score=13.86  Aligned_cols=12  Identities=42%  Similarity=1.107  Sum_probs=5.1

Q ss_pred             cCCcchhhcCCh
Q psy2647          41 ACDLCGRAFQRK   52 (72)
Q Consensus        41 ~c~~c~~~~~~~   52 (72)
                      .|..|++.|..+
T Consensus         5 ~C~eC~~~f~dS   16 (34)
T PF01286_consen    5 KCDECGKPFMDS   16 (34)
T ss_dssp             E-TTT--EES-S
T ss_pred             hHhHhCCHHHHH
Confidence            567777766543


No 158
>PRK12860 transcriptional activator FlhC; Provisional
Probab=45.07  E-value=15  Score=18.78  Aligned_cols=27  Identities=33%  Similarity=0.787  Sum_probs=16.6

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcch
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCG   46 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~   46 (72)
                      ..|..|+..|....        +.....+.|+.|.
T Consensus       135 ~~C~~Cgg~fv~~~--------~e~~~~f~CplC~  161 (189)
T PRK12860        135 ARCCRCGGKFVTHA--------HDLRHNFVCGLCQ  161 (189)
T ss_pred             ccCCCCCCCeeccc--------cccCCCCcCCCCC
Confidence            45778887775322        1223468888885


No 159
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=44.35  E-value=8.2  Score=17.63  Aligned_cols=10  Identities=40%  Similarity=1.026  Sum_probs=6.6

Q ss_pred             cccCcccchh
Q psy2647          11 PHKCQVCGKA   20 (72)
Q Consensus        11 ~~~c~~c~~~   20 (72)
                      |-.|+.|+..
T Consensus         2 p~~CpYCg~~   11 (102)
T PF11672_consen    2 PIICPYCGGP   11 (102)
T ss_pred             CcccCCCCCe
Confidence            4567888753


No 160
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=44.28  E-value=11  Score=13.85  Aligned_cols=11  Identities=36%  Similarity=0.912  Sum_probs=4.6

Q ss_pred             CCcccCcccch
Q psy2647           9 EKPHKCQVCGK   19 (72)
Q Consensus         9 ~~~~~c~~c~~   19 (72)
                      .+.|.|..|+.
T Consensus        22 ~~~w~C~~C~~   32 (40)
T PF04810_consen   22 GKTWICNFCGT   32 (40)
T ss_dssp             TTEEEETTT--
T ss_pred             CCEEECcCCCC
Confidence            34455555543


No 161
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=44.22  E-value=8.9  Score=18.43  Aligned_cols=13  Identities=23%  Similarity=0.728  Sum_probs=10.1

Q ss_pred             CccCCcchhhcCC
Q psy2647          39 PFACDLCGRAFQR   51 (72)
Q Consensus        39 ~~~c~~c~~~~~~   51 (72)
                      -+.|+.|++.|=.
T Consensus       124 f~~C~~C~kiyW~  136 (147)
T PF01927_consen  124 FWRCPGCGKIYWE  136 (147)
T ss_pred             EEECCCCCCEecc
Confidence            4789999987743


No 162
>PRK12722 transcriptional activator FlhC; Provisional
Probab=44.10  E-value=16  Score=18.64  Aligned_cols=28  Identities=29%  Similarity=0.791  Sum_probs=17.2

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      ..|..|+..|.....        .....+.|+.|..
T Consensus       135 ~~C~~Cgg~fv~~~~--------e~~~~f~CplC~~  162 (187)
T PRK12722        135 SSCNCCGGHFVTHAH--------DPVGSFVCGLCQP  162 (187)
T ss_pred             ccCCCCCCCeecccc--------ccCCCCcCCCCCC
Confidence            458888877753221        2234688888864


No 163
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=43.95  E-value=11  Score=14.97  Aligned_cols=9  Identities=33%  Similarity=1.125  Sum_probs=5.3

Q ss_pred             cCCcchhhc
Q psy2647          41 ACDLCGRAF   49 (72)
Q Consensus        41 ~c~~c~~~~   49 (72)
                      .|+.||..+
T Consensus         2 ~CPyCge~~   10 (52)
T PF14255_consen    2 QCPYCGEPI   10 (52)
T ss_pred             CCCCCCCee
Confidence            466676544


No 164
>PRK04351 hypothetical protein; Provisional
Probab=43.76  E-value=9.6  Score=18.59  Aligned_cols=12  Identities=25%  Similarity=0.761  Sum_probs=7.0

Q ss_pred             CCccCCcchhhc
Q psy2647          38 KPFACDLCGRAF   49 (72)
Q Consensus        38 ~~~~c~~c~~~~   49 (72)
                      ..|.|..|+..+
T Consensus       131 ~~yrCg~C~g~L  142 (149)
T PRK04351        131 KRYRCGKCRGKL  142 (149)
T ss_pred             CcEEeCCCCcEe
Confidence            346676666544


No 165
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=43.36  E-value=14  Score=15.18  Aligned_cols=14  Identities=36%  Similarity=0.885  Sum_probs=9.6

Q ss_pred             CccCCcchhhcCCh
Q psy2647          39 PFACDLCGRAFQRK   52 (72)
Q Consensus        39 ~~~c~~c~~~~~~~   52 (72)
                      |..|..||+.....
T Consensus         4 PVRCFTCGkvi~~~   17 (60)
T PF01194_consen    4 PVRCFTCGKVIGNK   17 (60)
T ss_dssp             SSS-STTTSBTCGH
T ss_pred             ceecCCCCCChhHh
Confidence            77888898876544


No 166
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=43.32  E-value=7.7  Score=18.70  Aligned_cols=14  Identities=43%  Similarity=1.172  Sum_probs=9.6

Q ss_pred             CcccCcccchhccC
Q psy2647          10 KPHKCQVCGKAFSQ   23 (72)
Q Consensus        10 ~~~~c~~c~~~~~~   23 (72)
                      ++..|..|+..|..
T Consensus       111 ~~~RCpeCG~~fkL  124 (136)
T PF01215_consen  111 KPQRCPECGQVFKL  124 (136)
T ss_dssp             SEEEETTTEEEEEE
T ss_pred             CccCCCCCCeEEEE
Confidence            46778778777654


No 167
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=42.93  E-value=13  Score=19.71  Aligned_cols=16  Identities=19%  Similarity=0.376  Sum_probs=12.4

Q ss_pred             CCcccCcccchhccCc
Q psy2647           9 EKPHKCQVCGKAFSQS   24 (72)
Q Consensus         9 ~~~~~c~~c~~~~~~~   24 (72)
                      .++..|..|+..|...
T Consensus       179 GkpqRCpECGqVFKLV  194 (268)
T PTZ00043        179 GFLYRCGECDQIFMLV  194 (268)
T ss_pred             CCCccCCCCCcEEEEE
Confidence            4578999999888653


No 168
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=42.86  E-value=27  Score=19.25  Aligned_cols=25  Identities=28%  Similarity=0.575  Sum_probs=21.4

Q ss_pred             CCCccCCcchhhcCChHHHHHHHHH
Q psy2647          37 FKPFACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        37 ~~~~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      ...|.|..|-+-|.....+.+|+..
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~~   70 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLAK   70 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHHh
Confidence            4568999999999999999999773


No 169
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=42.35  E-value=13  Score=15.13  Aligned_cols=10  Identities=60%  Similarity=1.481  Sum_probs=3.9

Q ss_pred             cCcccchhcc
Q psy2647          13 KCQVCGKAFS   22 (72)
Q Consensus        13 ~c~~c~~~~~   22 (72)
                      .|..|++.|.
T Consensus        11 ~C~~C~~~F~   20 (69)
T PF01363_consen   11 NCMICGKKFS   20 (69)
T ss_dssp             B-TTT--B-B
T ss_pred             cCcCcCCcCC
Confidence            5677777774


No 170
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=41.34  E-value=1.8  Score=19.66  Aligned_cols=38  Identities=24%  Similarity=0.540  Sum_probs=19.8

Q ss_pred             CCcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcC
Q psy2647           9 EKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus         9 ~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~   50 (72)
                      .+.|.|+.|+..-.+.-.+..-    ...-...|..||..|.
T Consensus        20 ~k~FtCp~Cghe~vs~ctvkk~----~~~g~~~Cg~CGls~e   57 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTVKKT----VNIGTAVCGNCGLSFE   57 (104)
T ss_pred             CceEecCccCCeeeeEEEEEec----CceeEEEcccCcceEE
Confidence            4568899888643332221111    1111346888887664


No 171
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the KOG1994|consensus
Probab=40.83  E-value=15  Score=19.50  Aligned_cols=22  Identities=23%  Similarity=0.582  Sum_probs=18.3

Q ss_pred             CcccCcccchhccCcHHHHHhH
Q psy2647          10 KPHKCQVCGKAFSQSSNLITHS   31 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~~~l~~~~   31 (72)
                      ..|.|-.||-.|.....|..|-
T Consensus       238 eh~YC~fCG~~y~~~edl~ehC  259 (268)
T KOG1994|consen  238 EHYYCFFCGIKYKDEEDLYEHC  259 (268)
T ss_pred             cceEEEEeccccCCHHHHHHhC
Confidence            4688999999999999888763


No 173
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=40.06  E-value=18  Score=14.57  Aligned_cols=13  Identities=23%  Similarity=0.549  Sum_probs=8.9

Q ss_pred             CCcccCcccchhc
Q psy2647           9 EKPHKCQVCGKAF   21 (72)
Q Consensus         9 ~~~~~c~~c~~~~   21 (72)
                      ...|.|+.||..+
T Consensus        12 ~v~~~Cp~cGipt   24 (55)
T PF13824_consen   12 HVNFECPDCGIPT   24 (55)
T ss_pred             ccCCcCCCCCCcC
Confidence            4567888887643


No 174
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=39.32  E-value=1.4  Score=18.42  Aligned_cols=35  Identities=20%  Similarity=0.497  Sum_probs=17.2

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhh
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRA   48 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~   48 (72)
                      .|.|..|+..-...   .....-+.|-...+|+.|...
T Consensus         4 ~FTC~~C~~Rs~~~---~sk~aY~~GvViv~C~gC~~~   38 (66)
T PF05180_consen    4 TFTCNKCGTRSAKM---FSKQAYHKGVVIVQCPGCKNR   38 (66)
T ss_dssp             EEEETTTTEEEEEE---EEHHHHHTSEEEEE-TTS--E
T ss_pred             EEEcCCCCCcccee---eCHHHHhCCeEEEECCCCcce
Confidence            36788887432211   122233455556788888653


No 175
>PRK14873 primosome assembly protein PriA; Provisional
Probab=38.91  E-value=25  Score=21.69  Aligned_cols=11  Identities=27%  Similarity=0.845  Sum_probs=7.5

Q ss_pred             CCccCCcchhh
Q psy2647          38 KPFACDLCGRA   48 (72)
Q Consensus        38 ~~~~c~~c~~~   48 (72)
                      .++.|+.|+..
T Consensus       421 ~p~~Cp~Cgs~  431 (665)
T PRK14873        421 PDWRCPRCGSD  431 (665)
T ss_pred             cCccCCCCcCC
Confidence            46778888753


No 176
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=38.83  E-value=10  Score=19.49  Aligned_cols=23  Identities=17%  Similarity=0.694  Sum_probs=0.0

Q ss_pred             CCCccCCcchh-hcCChHHHHHHH
Q psy2647          37 FKPFACDLCGR-AFQRKVDLRRHK   59 (72)
Q Consensus        37 ~~~~~c~~c~~-~~~~~~~l~~H~   59 (72)
                      .+.|.|.+||. .+.-+..+..|.
T Consensus        99 ~~ey~CEICGN~~Y~GrkaFekHF  122 (196)
T PF11931_consen   99 GVEYKCEICGNQSYKGRKAFEKHF  122 (196)
T ss_dssp             ------------------------
T ss_pred             CCeeeeEeCCCcceecHHHHHHhc
Confidence            34578888874 444455555553


No 177
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=38.55  E-value=44  Score=15.26  Aligned_cols=37  Identities=11%  Similarity=0.303  Sum_probs=22.9

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhh
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRA   48 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~   48 (72)
                      .|.|+..+..|.........+.... ++.|.|...|+.
T Consensus         3 Vf~i~~T~EiF~dYe~Y~~R~~~y~-~~vwtC~~TGk~   39 (102)
T PF10537_consen    3 VFYIPFTGEIFRDYEEYLKRMILYN-QRVWTCEITGKS   39 (102)
T ss_pred             eEEeCCCCcccCCHHHHHHHHHHHh-CCeeEEecCCCC
Confidence            3566666777777766665554433 356777776653


No 178
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=38.35  E-value=13  Score=18.17  Aligned_cols=13  Identities=23%  Similarity=0.444  Sum_probs=10.6

Q ss_pred             CccCCcchhhcCC
Q psy2647          39 PFACDLCGRAFQR   51 (72)
Q Consensus        39 ~~~c~~c~~~~~~   51 (72)
                      .-+|..|++.|.+
T Consensus        28 RReC~~C~~RFTT   40 (147)
T TIGR00244        28 RRECLECHERFTT   40 (147)
T ss_pred             cccCCccCCccce
Confidence            4589999999975


No 179
>PLN02748 tRNA dimethylallyltransferase
Probab=38.24  E-value=30  Score=20.39  Aligned_cols=23  Identities=22%  Similarity=0.746  Sum_probs=17.9

Q ss_pred             CCccCCcchh-hcCChHHHHHHHH
Q psy2647          38 KPFACDLCGR-AFQRKVDLRRHKE   60 (72)
Q Consensus        38 ~~~~c~~c~~-~~~~~~~l~~H~~   60 (72)
                      +.|.|..|+. .+........|++
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlk  440 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQ  440 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhc
Confidence            4578999997 7887777777764


No 180
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=38.24  E-value=18  Score=20.99  Aligned_cols=10  Identities=40%  Similarity=0.906  Sum_probs=6.4

Q ss_pred             cccCcccchh
Q psy2647          11 PHKCQVCGKA   20 (72)
Q Consensus        11 ~~~c~~c~~~   20 (72)
                      .|.|..|+..
T Consensus         7 ~y~C~~Cg~~   16 (454)
T TIGR00416         7 KFVCQHCGAD   16 (454)
T ss_pred             eEECCcCCCC
Confidence            4677777653


No 181
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=38.08  E-value=11  Score=15.30  Aligned_cols=38  Identities=21%  Similarity=0.532  Sum_probs=18.5

Q ss_pred             cCcccchhccCcHHHHHhHH-HhcCCCCccCCcchhhcC
Q psy2647          13 KCQVCGKAFSQSSNLITHSR-KHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus        13 ~c~~c~~~~~~~~~l~~~~~-~~~~~~~~~c~~c~~~~~   50 (72)
                      .|..|++.+..........+ ..-....|.|..|.....
T Consensus         4 kC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~RI~   42 (56)
T PF09963_consen    4 KCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKERIR   42 (56)
T ss_pred             EEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHHHHh
Confidence            46667665443322222211 122334588888875544


No 182
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=37.84  E-value=15  Score=20.68  Aligned_cols=12  Identities=25%  Similarity=0.833  Sum_probs=8.0

Q ss_pred             CccCCcchhhcC
Q psy2647          39 PFACDLCGRAFQ   50 (72)
Q Consensus        39 ~~~c~~c~~~~~   50 (72)
                      .+.|+.||..+.
T Consensus       265 ~wrCpkCGg~ik  276 (403)
T COG1379         265 RWRCPKCGGKIK  276 (403)
T ss_pred             cccCcccccchh
Confidence            467888876543


No 183
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=37.62  E-value=16  Score=19.56  Aligned_cols=15  Identities=33%  Similarity=0.687  Sum_probs=10.5

Q ss_pred             CCCccCCcchhhcCC
Q psy2647          37 FKPFACDLCGRAFQR   51 (72)
Q Consensus        37 ~~~~~c~~c~~~~~~   51 (72)
                      .+.+.|+.||..+..
T Consensus       320 ~r~~~C~~cg~~~~r  334 (364)
T COG0675         320 GRLFKCPRCGFVHDR  334 (364)
T ss_pred             ceeEECCCCCCeehh
Confidence            346889999876543


No 184
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=37.39  E-value=45  Score=16.45  Aligned_cols=26  Identities=19%  Similarity=0.347  Sum_probs=14.4

Q ss_pred             hccCcHHHHHhHHHhcCCCCccCCcchhhc
Q psy2647          20 AFSQSSNLITHSRKHTGFKPFACDLCGRAF   49 (72)
Q Consensus        20 ~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~   49 (72)
                      +|.+...+.....    ...+.|+.||..-
T Consensus        17 WF~ss~~fd~Q~~----~glv~CP~Cgs~~   42 (148)
T PF06676_consen   17 WFRSSAAFDRQQA----RGLVSCPVCGSTE   42 (148)
T ss_pred             ecCCHHHHHHHHH----cCCccCCCCCCCe
Confidence            4555555554433    2356777777543


No 185
>PRK11823 DNA repair protein RadA; Provisional
Probab=37.08  E-value=21  Score=20.69  Aligned_cols=11  Identities=36%  Similarity=0.803  Sum_probs=7.1

Q ss_pred             CcccCcccchh
Q psy2647          10 KPHKCQVCGKA   20 (72)
Q Consensus        10 ~~~~c~~c~~~   20 (72)
                      ..|.|..|+..
T Consensus         6 ~~y~C~~Cg~~   16 (446)
T PRK11823          6 TAYVCQECGAE   16 (446)
T ss_pred             CeEECCcCCCC
Confidence            34777777754


No 186
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=36.86  E-value=19  Score=17.90  Aligned_cols=21  Identities=33%  Similarity=0.800  Sum_probs=15.2

Q ss_pred             CCcccCcccchhccCcHHHHH
Q psy2647           9 EKPHKCQVCGKAFSQSSNLIT   29 (72)
Q Consensus         9 ~~~~~c~~c~~~~~~~~~l~~   29 (72)
                      ..|..|..||+.|++......
T Consensus        66 ~~PsYC~~CGkpyPWt~~~L~   86 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPWTENALE   86 (158)
T ss_pred             CCChhHHhCCCCCchHHHHHH
Confidence            357788999999988755433


No 187
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=36.33  E-value=14  Score=13.45  Aligned_cols=10  Identities=30%  Similarity=1.026  Sum_probs=4.8

Q ss_pred             CccCCcchhh
Q psy2647          39 PFACDLCGRA   48 (72)
Q Consensus        39 ~~~c~~c~~~   48 (72)
                      -|+|..||..
T Consensus         6 ~YkC~~CGni   15 (36)
T PF06397_consen    6 FYKCEHCGNI   15 (36)
T ss_dssp             EEE-TTT--E
T ss_pred             EEEccCCCCE
Confidence            4778888754


No 188
>KOG2231|consensus
Probab=36.30  E-value=66  Score=20.16  Aligned_cols=47  Identities=26%  Similarity=0.519  Sum_probs=23.2

Q ss_pred             cCcccchhccCcHHHHHhHHHhcCCCCccCCcc------hhhcCChHHHHHHHHHhc
Q psy2647          13 KCQVCGKAFSQSSNLITHSRKHTGFKPFACDLC------GRAFQRKVDLRRHKETQH   63 (72)
Q Consensus        13 ~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c------~~~~~~~~~l~~H~~~~~   63 (72)
                      .|..|...|.....+..|++.+    .+.|..|      +.-|..-..|..|-+.+|
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~----h~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFD----HEFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccc----eeheeecCcccccchhcccchHHHHHhhhcC
Confidence            4556666666666666665532    1233333      233444455555555444


No 189
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=36.22  E-value=12  Score=19.41  Aligned_cols=22  Identities=14%  Similarity=0.375  Sum_probs=0.0

Q ss_pred             CccCCcchhhcCChHHHHHHHHH
Q psy2647          39 PFACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      -..|+.||.... .+.+..|+|+
T Consensus       168 ~~~cPitGe~IP-~~e~~eHmRi  189 (229)
T PF12230_consen  168 MIICPITGEMIP-ADEMDEHMRI  189 (229)
T ss_dssp             -----------------------
T ss_pred             cccccccccccc-cccccccccc
Confidence            357888887654 4566777776


No 190
>PF12773 DZR:  Double zinc ribbon
Probab=36.13  E-value=21  Score=13.42  Aligned_cols=11  Identities=27%  Similarity=0.531  Sum_probs=7.3

Q ss_pred             CccCCcchhhc
Q psy2647          39 PFACDLCGRAF   49 (72)
Q Consensus        39 ~~~c~~c~~~~   49 (72)
                      ...|+.|+...
T Consensus        29 ~~~C~~Cg~~~   39 (50)
T PF12773_consen   29 KKICPNCGAEN   39 (50)
T ss_pred             CCCCcCCcCCC
Confidence            45688887653


No 191
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=35.96  E-value=14  Score=13.09  Aligned_cols=12  Identities=33%  Similarity=0.794  Sum_probs=7.8

Q ss_pred             CccCCcchhhcC
Q psy2647          39 PFACDLCGRAFQ   50 (72)
Q Consensus        39 ~~~c~~c~~~~~   50 (72)
                      -+.|..|+..|.
T Consensus        21 ~~~C~~Cg~~~~   32 (33)
T PF08792_consen   21 YEVCIFCGSSFP   32 (33)
T ss_pred             eEEcccCCcEee
Confidence            356788876653


No 192
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=35.59  E-value=21  Score=19.09  Aligned_cols=34  Identities=24%  Similarity=0.472  Sum_probs=18.8

Q ss_pred             CcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          10 KPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      ....|..|+..+..... ...  ... ..+-.|+.|+.
T Consensus       121 ~~~~C~~C~~~~~~~~~-~~~--~~~-~~~p~C~~Cg~  154 (250)
T COG0846         121 KRVRCSKCGNQYYDEDV-IKF--IED-GLIPRCPKCGG  154 (250)
T ss_pred             eeeEeCCCcCccchhhh-hhh--ccc-CCCCcCccCCC
Confidence            45678889876653331 111  111 13556888886


No 193
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=35.34  E-value=34  Score=17.21  Aligned_cols=19  Identities=21%  Similarity=0.483  Sum_probs=14.1

Q ss_pred             CCccCCcchhhcCChHHHH
Q psy2647          38 KPFACDLCGRAFQRKVDLR   56 (72)
Q Consensus        38 ~~~~c~~c~~~~~~~~~l~   56 (72)
                      ....|..||+.|.....+.
T Consensus       113 ~~~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        113 HLQRCSRCERPFAPQKTVA  131 (181)
T ss_pred             ccCcCcccCCccCcHhHHH
Confidence            4678999999998654443


No 194
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=35.31  E-value=12  Score=17.91  Aligned_cols=11  Identities=27%  Similarity=0.963  Sum_probs=6.1

Q ss_pred             CccCCcchhhc
Q psy2647          39 PFACDLCGRAF   49 (72)
Q Consensus        39 ~~~c~~c~~~~   49 (72)
                      .+.|..|+..+
T Consensus       133 ~y~C~~C~g~l  143 (146)
T smart00731      133 RYRCGKCGGKL  143 (146)
T ss_pred             eEEcCCCCCEE
Confidence            46666665443


No 195
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=35.18  E-value=18  Score=14.99  Aligned_cols=8  Identities=38%  Similarity=1.323  Sum_probs=4.2

Q ss_pred             ccCCcchh
Q psy2647          40 FACDLCGR   47 (72)
Q Consensus        40 ~~c~~c~~   47 (72)
                      |.|+.|+.
T Consensus         1 y~C~KCg~    8 (64)
T PF09855_consen    1 YKCPKCGN    8 (64)
T ss_pred             CCCCCCCC
Confidence            35666653


No 196
>PF14369 zf-RING_3:  zinc-finger
Probab=35.14  E-value=17  Score=12.99  Aligned_cols=10  Identities=30%  Similarity=0.813  Sum_probs=7.8

Q ss_pred             cCcccchhcc
Q psy2647          13 KCQVCGKAFS   22 (72)
Q Consensus        13 ~c~~c~~~~~   22 (72)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            4999988774


No 197
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=35.00  E-value=5.8  Score=14.38  Aligned_cols=12  Identities=25%  Similarity=0.874  Sum_probs=6.5

Q ss_pred             hcCCCCccCCcc
Q psy2647          34 HTGFKPFACDLC   45 (72)
Q Consensus        34 ~~~~~~~~c~~c   45 (72)
                      ..|...|.|..|
T Consensus        24 ~~G~qryrC~~C   35 (36)
T PF03811_consen   24 PSGHQRYRCKDC   35 (36)
T ss_pred             CCCCEeEecCcC
Confidence            344455666655


No 198
>KOG4727|consensus
Probab=34.97  E-value=22  Score=18.05  Aligned_cols=22  Identities=27%  Similarity=0.507  Sum_probs=18.6

Q ss_pred             cccCcccchhccCcHHHHHhHH
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSR   32 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~   32 (72)
                      -|.|..|+-.+....++..|+.
T Consensus        75 GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ceeeeecceeehhhHHHHHHhc
Confidence            4889999999998888888875


No 199
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.66  E-value=13  Score=14.53  Aligned_cols=11  Identities=36%  Similarity=0.996  Sum_probs=5.7

Q ss_pred             cCCcchhhcCC
Q psy2647          41 ACDLCGRAFQR   51 (72)
Q Consensus        41 ~c~~c~~~~~~   51 (72)
                      .|+.|+..|..
T Consensus        14 ICpvCqRPFsW   24 (54)
T COG4338          14 ICPVCQRPFSW   24 (54)
T ss_pred             hhhhhcCchHH
Confidence            35555555543


No 200
>PTZ00448 hypothetical protein; Provisional
Probab=34.55  E-value=41  Score=19.30  Aligned_cols=23  Identities=13%  Similarity=0.401  Sum_probs=17.0

Q ss_pred             CccCCcchhhcCChHHHHHHHHH
Q psy2647          39 PFACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      .+.|..|+-.|........|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57799999999776666666553


No 201
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=33.81  E-value=16  Score=13.26  Aligned_cols=11  Identities=27%  Similarity=0.863  Sum_probs=7.3

Q ss_pred             ccCcccchhcc
Q psy2647          12 HKCQVCGKAFS   22 (72)
Q Consensus        12 ~~c~~c~~~~~   22 (72)
                      +.|+.|+..+-
T Consensus        33 ~~C~~CGE~~~   43 (46)
T TIGR03831        33 LVCPQCGEEYL   43 (46)
T ss_pred             cccccCCCEee
Confidence            56888876543


No 202
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional
Probab=33.65  E-value=62  Score=17.58  Aligned_cols=15  Identities=20%  Similarity=0.490  Sum_probs=9.3

Q ss_pred             CcccCcccchhccCc
Q psy2647          10 KPHKCQVCGKAFSQS   24 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~   24 (72)
                      ....|..|+..+...
T Consensus       136 ~~~~C~~C~~~~~~~  150 (271)
T PTZ00409        136 FEARCCTCRKTIQLN  150 (271)
T ss_pred             CcceeCCCCCCcccC
Confidence            345688887766543


No 203
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=33.61  E-value=35  Score=20.09  Aligned_cols=24  Identities=33%  Similarity=0.743  Sum_probs=20.7

Q ss_pred             CCccCCcchhhcCChHHHHHHHHH
Q psy2647          38 KPFACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        38 ~~~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      ..|.|..|-+-|.....+..|+..
T Consensus       197 ~lyiCe~Cl~y~~~~~~~~~H~~~  220 (450)
T PLN00104        197 KLYFCEFCLKFMKRKEQLQRHMKK  220 (450)
T ss_pred             eEEEchhhhhhhcCHHHHHHHHhc
Confidence            468999999999999999999863


No 204
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=33.47  E-value=37  Score=20.10  Aligned_cols=10  Identities=40%  Similarity=0.996  Sum_probs=6.6

Q ss_pred             CCccCCcchh
Q psy2647          38 KPFACDLCGR   47 (72)
Q Consensus        38 ~~~~c~~c~~   47 (72)
                      .|..|+.|+.
T Consensus       252 ~~~~Cp~C~s  261 (505)
T TIGR00595       252 IPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCC
Confidence            4567777764


No 205
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=33.33  E-value=13  Score=14.32  Aligned_cols=36  Identities=19%  Similarity=0.499  Sum_probs=16.0

Q ss_pred             ccCcccchhccCcHHHHHh-----HHHhcCCCCccCCcchh
Q psy2647          12 HKCQVCGKAFSQSSNLITH-----SRKHTGFKPFACDLCGR   47 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~-----~~~~~~~~~~~c~~c~~   47 (72)
                      |.|..|+..|.-...-...     +.-..-..-|.|+.|+.
T Consensus         2 y~C~~CgyvYd~~~Gd~~~~i~pGt~F~~Lp~~w~CP~C~a   42 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKGDPENGIPPGTPFEDLPDDWVCPVCGA   42 (47)
T ss_dssp             EEETTTSBEEETTTBBGGGTB-TT--GGGS-TT-B-TTTSS
T ss_pred             cCCCCCCEEEcCCcCCcccCcCCCCCHHHCCCCCcCcCCCC
Confidence            6788888776544321111     11111123478888864


No 206
>PRK05978 hypothetical protein; Provisional
Probab=33.30  E-value=16  Score=17.94  Aligned_cols=11  Identities=36%  Similarity=0.905  Sum_probs=7.4

Q ss_pred             ccCCcchhhcC
Q psy2647          40 FACDLCGRAFQ   50 (72)
Q Consensus        40 ~~c~~c~~~~~   50 (72)
                      -.|+.||..|.
T Consensus        53 ~~C~~CG~~~~   63 (148)
T PRK05978         53 DHCAACGEDFT   63 (148)
T ss_pred             CCccccCCccc
Confidence            46777876654


No 207
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=33.11  E-value=73  Score=16.42  Aligned_cols=36  Identities=17%  Similarity=0.405  Sum_probs=17.8

Q ss_pred             CcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhh
Q psy2647          10 KPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRA   48 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~   48 (72)
                      ....|..|+..+.......   ..........|+.|+..
T Consensus        94 ~~~~C~~C~~~~~~~~~~~---~~~~~~~~p~C~~Cgg~  129 (206)
T cd01410          94 FIEVCKSCGPEYVRDDVVE---TRGDKETGRRCHACGGI  129 (206)
T ss_pred             CcccCCCCCCccchHHHHH---HhhcCCCCCcCCCCcCc
Confidence            3456888886654332221   11112223468888643


No 208
>PRK06260 threonine synthase; Validated
Probab=32.79  E-value=21  Score=20.22  Aligned_cols=10  Identities=50%  Similarity=1.178  Sum_probs=4.6

Q ss_pred             ccCcccchhc
Q psy2647          12 HKCQVCGKAF   21 (72)
Q Consensus        12 ~~c~~c~~~~   21 (72)
                      +.|..|+..|
T Consensus         4 ~~C~~cg~~~   13 (397)
T PRK06260          4 LKCIECGKEY   13 (397)
T ss_pred             EEECCCCCCC
Confidence            3455555443


No 209
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=32.18  E-value=20  Score=14.31  Aligned_cols=10  Identities=40%  Similarity=1.075  Sum_probs=5.7

Q ss_pred             ccCCcchhhc
Q psy2647          40 FACDLCGRAF   49 (72)
Q Consensus        40 ~~c~~c~~~~   49 (72)
                      +.|+.|+..+
T Consensus         3 ~~CP~CG~~i   12 (54)
T TIGR01206         3 FECPDCGAEI   12 (54)
T ss_pred             cCCCCCCCEE
Confidence            4566666544


No 210
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=31.96  E-value=5.8  Score=18.35  Aligned_cols=10  Identities=30%  Similarity=1.109  Sum_probs=6.9

Q ss_pred             ccCCcchhhc
Q psy2647          40 FACDLCGRAF   49 (72)
Q Consensus        40 ~~c~~c~~~~   49 (72)
                      |.|..||..+
T Consensus       101 y~C~~Cg~~w  110 (113)
T COG1594         101 YKCTRCGYRW  110 (113)
T ss_pred             EEecccCCEe
Confidence            6777777654


No 211
>PLN03239 histone acetyltransferase; Provisional
Probab=31.58  E-value=43  Score=19.07  Aligned_cols=24  Identities=25%  Similarity=0.401  Sum_probs=20.1

Q ss_pred             CCCccCCcchhhcCChHHHHHHHH
Q psy2647          37 FKPFACDLCGRAFQRKVDLRRHKE   60 (72)
Q Consensus        37 ~~~~~c~~c~~~~~~~~~l~~H~~   60 (72)
                      ...|.|..|-+-|.....+.+|+.
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~  127 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQA  127 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHH
Confidence            346899999998899999988865


No 212
>PTZ00064 histone acetyltransferase; Provisional
Probab=31.44  E-value=45  Score=20.14  Aligned_cols=25  Identities=24%  Similarity=0.297  Sum_probs=21.2

Q ss_pred             CCCccCCcchhhcCChHHHHHHHHH
Q psy2647          37 FKPFACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        37 ~~~~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      ...|.|..|-+-|.....+.+|+..
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~~  302 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLSR  302 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHhc
Confidence            3468999999999999999999773


No 213
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=31.22  E-value=27  Score=19.09  Aligned_cols=12  Identities=17%  Similarity=0.476  Sum_probs=8.9

Q ss_pred             CccCCcchhhcC
Q psy2647          39 PFACDLCGRAFQ   50 (72)
Q Consensus        39 ~~~c~~c~~~~~   50 (72)
                      .+.|+.|+..|.
T Consensus        45 ~~vc~~c~~h~r   56 (285)
T TIGR00515        45 LEVCPKCDHHMR   56 (285)
T ss_pred             CCCCCCCCCcCc
Confidence            468888887665


No 214
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=31.17  E-value=40  Score=21.22  Aligned_cols=13  Identities=31%  Similarity=0.649  Sum_probs=8.9

Q ss_pred             CCCCccCCcchhh
Q psy2647          36 GFKPFACDLCGRA   48 (72)
Q Consensus        36 ~~~~~~c~~c~~~   48 (72)
                      ...|..|+.||..
T Consensus       472 ~~~p~~Cp~Cgs~  484 (730)
T COG1198         472 EPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCC
Confidence            3457788888754


No 215
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=31.09  E-value=79  Score=15.93  Aligned_cols=59  Identities=22%  Similarity=0.454  Sum_probs=35.0

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCc--chhhcCChHHHHHHHHHhccCCCCCCC
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDL--CGRAFQRKVDLRRHKETQHTEMRPVPV   71 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~--c~~~~~~~~~l~~H~~~~~~~~~p~~~   71 (72)
                      ...|+.|.........+ ..-+.+...++-.|..  |... ..-..|..|.+..|..-+|-.+
T Consensus        80 ~L~CPLCRG~V~GWtvv-e~AR~~LN~K~RsC~~e~C~F~-GtY~eLrKHar~~HP~~rP~~v  140 (162)
T PF07800_consen   80 ELACPLCRGEVKGWTVV-EPARRFLNAKKRSCSQESCSFS-GTYSELRKHARSEHPSARPSEV  140 (162)
T ss_pred             cccCccccCceeceEEc-hHHHHHhccCCccCcccccccc-cCHHHHHHHHHhhCCCCCCccC
Confidence            35688886543333222 2234445556666653  4321 2456788999988998888765


No 216
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=30.80  E-value=58  Score=16.93  Aligned_cols=33  Identities=18%  Similarity=0.417  Sum_probs=16.9

Q ss_pred             CcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          10 KPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      ....|..|+..+..... .    .......-.|+.|+.
T Consensus       112 ~~~~C~~C~~~~~~~~~-~----~~~~~~~p~C~~Cgg  144 (222)
T cd01413         112 QTAYCVNCGSKYDLEEV-K----YAKKHEVPRCPKCGG  144 (222)
T ss_pred             CcceECCCCCCcchhHH-H----HhccCCCCcCCCCCC
Confidence            34568888876654432 1    111122345777764


No 217
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=30.63  E-value=22  Score=17.63  Aligned_cols=14  Identities=29%  Similarity=0.524  Sum_probs=11.1

Q ss_pred             CccCCcchhhcCCh
Q psy2647          39 PFACDLCGRAFQRK   52 (72)
Q Consensus        39 ~~~c~~c~~~~~~~   52 (72)
                      .-.|..|+..|.+.
T Consensus        28 RReC~~C~~RFTTf   41 (156)
T COG1327          28 RRECLECGERFTTF   41 (156)
T ss_pred             hhcccccccccchh
Confidence            45899999999753


No 218
>KOG4118|consensus
Probab=30.59  E-value=41  Score=14.16  Aligned_cols=26  Identities=19%  Similarity=0.474  Sum_probs=19.1

Q ss_pred             CccCCcchhhcCChHHHHHHHHHhcc
Q psy2647          39 PFACDLCGRAFQRKVDLRRHKETQHT   64 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~H~~~~~~   64 (72)
                      .+.|.+|.........+.+|....|.
T Consensus        38 ~~kCtVC~~~mpdpktfkqhfe~kHp   63 (74)
T KOG4118|consen   38 HHKCTVCMVQMPDPKTFKQHFENKHP   63 (74)
T ss_pred             HhhhHhhHhhCCCCchHHHHHhhcCC
Confidence            46888888777777788888765443


No 219
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=30.59  E-value=28  Score=12.79  Aligned_cols=9  Identities=44%  Similarity=1.110  Sum_probs=6.2

Q ss_pred             CccCCcchh
Q psy2647          39 PFACDLCGR   47 (72)
Q Consensus        39 ~~~c~~c~~   47 (72)
                      |..|+.||.
T Consensus         2 ~~~Cp~Cg~   10 (47)
T PF14690_consen    2 PPRCPHCGS   10 (47)
T ss_pred             CccCCCcCC
Confidence            456888874


No 220
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=30.51  E-value=21  Score=13.06  Aligned_cols=12  Identities=33%  Similarity=0.969  Sum_probs=6.8

Q ss_pred             cCCcchhhcCCh
Q psy2647          41 ACDLCGRAFQRK   52 (72)
Q Consensus        41 ~c~~c~~~~~~~   52 (72)
                      .|+.|++.|...
T Consensus         4 ~CprC~kg~Hwa   15 (36)
T PF14787_consen    4 LCPRCGKGFHWA   15 (36)
T ss_dssp             C-TTTSSSCS-T
T ss_pred             cCcccCCCcchh
Confidence            577787776544


No 221
>KOG0227|consensus
Probab=29.83  E-value=32  Score=17.83  Aligned_cols=21  Identities=14%  Similarity=0.526  Sum_probs=12.8

Q ss_pred             cccCcccchhccCcHHHHHhH
Q psy2647          11 PHKCQVCGKAFSQSSNLITHS   31 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~   31 (72)
                      .|.|..|.....+..+...|.
T Consensus        53 ~yeCkLClT~H~ne~Syl~Ht   73 (222)
T KOG0227|consen   53 KYECKLCLTLHNNEGSYLAHT   73 (222)
T ss_pred             ceeehhhhhhhcchhhhhhhh
Confidence            467777776555555555553


No 222
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=29.81  E-value=11  Score=20.38  Aligned_cols=25  Identities=32%  Similarity=0.678  Sum_probs=15.7

Q ss_pred             CcccCcccchhccCcHHHHHhHHHh
Q psy2647          10 KPHKCQVCGKAFSQSSNLITHSRKH   34 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~~~l~~~~~~~   34 (72)
                      ++++|+.|+........|....+.|
T Consensus       208 k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  208 KPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCCCCCCCCcccccccceeeeecc
Confidence            5677888876665555555555544


No 223
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=29.71  E-value=61  Score=17.20  Aligned_cols=34  Identities=24%  Similarity=0.428  Sum_probs=17.7

Q ss_pred             CcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          10 KPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      ....|..|+..+.......    .......-.|+.|+.
T Consensus       118 ~~~~C~~C~~~~~~~~~~~----~~~~~~~p~Cp~Cgg  151 (244)
T PRK14138        118 EEYYCVRCGKRYTVEDVIE----KLEKSDVPRCDDCSG  151 (244)
T ss_pred             CeeEECCCCCcccHHHHHH----HHhcCCCCCCCCCCC
Confidence            3456888887765433222    111112345888864


No 224
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=29.43  E-value=21  Score=14.07  Aligned_cols=13  Identities=15%  Similarity=0.585  Sum_probs=6.1

Q ss_pred             CCcccCcccchhc
Q psy2647           9 EKPHKCQVCGKAF   21 (72)
Q Consensus         9 ~~~~~c~~c~~~~   21 (72)
                      ...+.|.+|++.+
T Consensus        33 ~~~~rC~YCe~~~   45 (52)
T PF02748_consen   33 PIKLRCHYCERII   45 (52)
T ss_dssp             TCEEEETTT--EE
T ss_pred             CCEEEeeCCCCEe
Confidence            3445666666544


No 225
>KOG1280|consensus
Probab=29.29  E-value=65  Score=18.47  Aligned_cols=22  Identities=23%  Similarity=0.326  Sum_probs=11.0

Q ss_pred             cccCcccchhccCcHHHHHhHH
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSR   32 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~   32 (72)
                      .|.|+.|+..-.....+..|..
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~  100 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVL  100 (381)
T ss_pred             cccCCcccccccchhHHHHHhh
Confidence            3555555554444444444443


No 226
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=28.82  E-value=27  Score=20.49  Aligned_cols=12  Identities=33%  Similarity=0.672  Sum_probs=8.0

Q ss_pred             CcccCcccchhc
Q psy2647          10 KPHKCQVCGKAF   21 (72)
Q Consensus        10 ~~~~c~~c~~~~   21 (72)
                      ..|.|..|+...
T Consensus         6 t~f~C~~CG~~s   17 (456)
T COG1066           6 TAFVCQECGYVS   17 (456)
T ss_pred             cEEEcccCCCCC
Confidence            347788887543


No 227
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=28.82  E-value=29  Score=18.75  Aligned_cols=29  Identities=31%  Similarity=0.715  Sum_probs=18.1

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcch
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCG   46 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~   46 (72)
                      .-.|+.|+..+.....+.       +--.|+|..|.
T Consensus       220 ~r~CP~Cg~~W~L~~plh-------~iFdFKCD~CR  248 (258)
T PF10071_consen  220 ARKCPSCGGDWRLKEPLH-------DIFDFKCDPCR  248 (258)
T ss_pred             CCCCCCCCCccccCCchh-------hceeccCCcce
Confidence            346888887666555441       22357888874


No 228
>KOG3497|consensus
Probab=28.71  E-value=18  Score=14.90  Aligned_cols=14  Identities=36%  Similarity=0.892  Sum_probs=9.9

Q ss_pred             CccCCcchhhcCCh
Q psy2647          39 PFACDLCGRAFQRK   52 (72)
Q Consensus        39 ~~~c~~c~~~~~~~   52 (72)
                      |..|..||+....+
T Consensus         4 PiRCFtCGKvig~K   17 (69)
T KOG3497|consen    4 PIRCFTCGKVIGDK   17 (69)
T ss_pred             eeEeeecccccccc
Confidence            66788888776554


No 229
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=28.55  E-value=18  Score=11.77  Aligned_cols=7  Identities=43%  Similarity=1.118  Sum_probs=3.9

Q ss_pred             cCcccch
Q psy2647          13 KCQVCGK   19 (72)
Q Consensus        13 ~c~~c~~   19 (72)
                      .|+.|+.
T Consensus         4 ~Cp~Cg~   10 (26)
T PF13248_consen    4 FCPNCGA   10 (26)
T ss_pred             CCcccCC
Confidence            4666654


No 230
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=28.55  E-value=18  Score=17.84  Aligned_cols=35  Identities=23%  Similarity=0.598  Sum_probs=19.3

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhc
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAF   49 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~   49 (72)
                      ...|..|+..+...... ...  . ....-.|+.|+...
T Consensus       105 ~~~C~~C~~~~~~~~~~-~~~--~-~~~~~~C~~C~~~l  139 (178)
T PF02146_consen  105 RLRCSKCGKEYDREDIV-DSI--D-EEEPPRCPKCGGLL  139 (178)
T ss_dssp             EEEETTTSBEEEGHHHH-HHH--H-TTSSCBCTTTSCBE
T ss_pred             eeeecCCCccccchhhc-ccc--c-ccccccccccCccC
Confidence            45788898877643322 111  1 12334788887643


No 231
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=27.67  E-value=48  Score=16.56  Aligned_cols=18  Identities=28%  Similarity=0.785  Sum_probs=13.6

Q ss_pred             CCccCCcchhhcCChHHH
Q psy2647          38 KPFACDLCGRAFQRKVDL   55 (72)
Q Consensus        38 ~~~~c~~c~~~~~~~~~l   55 (72)
                      .++.|..||+.|.....+
T Consensus       113 ~~~~C~~CG~~f~~~~~i  130 (180)
T PRK12387        113 ALCNCRVCGRPFAVQKEI  130 (180)
T ss_pred             CcccchhhCCccccHHHH
Confidence            467899999999765543


No 232
>KOG2857|consensus
Probab=27.43  E-value=33  Score=16.84  Aligned_cols=22  Identities=18%  Similarity=0.419  Sum_probs=18.1

Q ss_pred             cccCcccchhccCcHHHHHhHH
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSR   32 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~   32 (72)
                      .|.|+.|.-.|.+..-++.|..
T Consensus        17 KYKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   17 KYKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             hccCCCCCCccccchhhhhccC
Confidence            5899999988888888877765


No 233
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=27.41  E-value=24  Score=11.25  Aligned_cols=6  Identities=50%  Similarity=1.425  Sum_probs=3.4

Q ss_pred             CCcchh
Q psy2647          42 CDLCGR   47 (72)
Q Consensus        42 c~~c~~   47 (72)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            555554


No 234
>KOG3352|consensus
Probab=27.17  E-value=30  Score=17.12  Aligned_cols=14  Identities=29%  Similarity=0.871  Sum_probs=9.1

Q ss_pred             CcccCcccchhccC
Q psy2647          10 KPHKCQVCGKAFSQ   23 (72)
Q Consensus        10 ~~~~c~~c~~~~~~   23 (72)
                      +...|.+|+..|+.
T Consensus       132 e~~rc~eCG~~fkL  145 (153)
T KOG3352|consen  132 ETQRCPECGHYFKL  145 (153)
T ss_pred             CcccCCcccceEEe
Confidence            34567788876653


No 235
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=26.95  E-value=24  Score=14.19  Aligned_cols=11  Identities=36%  Similarity=1.219  Sum_probs=7.6

Q ss_pred             ccCCcchhhcC
Q psy2647          40 FACDLCGRAFQ   50 (72)
Q Consensus        40 ~~c~~c~~~~~   50 (72)
                      ..|..|++.|.
T Consensus         6 ~~C~~Cg~~~~   16 (54)
T PF14446_consen    6 CKCPVCGKKFK   16 (54)
T ss_pred             ccChhhCCccc
Confidence            36777877774


No 236
>PRK00481 NAD-dependent deacetylase; Provisional
Probab=26.84  E-value=55  Score=17.22  Aligned_cols=19  Identities=16%  Similarity=0.506  Sum_probs=11.0

Q ss_pred             ccCCCcccCcccchhccCc
Q psy2647           6 WHGEKPHKCQVCGKAFSQS   24 (72)
Q Consensus         6 ~~~~~~~~c~~c~~~~~~~   24 (72)
                      |-.-....|..|+..+...
T Consensus       117 HG~~~~~~C~~C~~~~~~~  135 (242)
T PRK00481        117 HGSLLRARCTKCGQTYDLD  135 (242)
T ss_pred             cCCcCceeeCCCCCCcChh
Confidence            3333446688887766543


No 237
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=26.74  E-value=29  Score=12.78  Aligned_cols=7  Identities=43%  Similarity=1.203  Sum_probs=3.5

Q ss_pred             cCCcchh
Q psy2647          41 ACDLCGR   47 (72)
Q Consensus        41 ~c~~c~~   47 (72)
                      .|+.|+.
T Consensus         2 ~Cp~Cg~    8 (43)
T PF08271_consen    2 KCPNCGS    8 (43)
T ss_dssp             SBTTTSS
T ss_pred             CCcCCcC
Confidence            4555543


No 238
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=26.63  E-value=35  Score=18.87  Aligned_cols=13  Identities=31%  Similarity=0.731  Sum_probs=9.2

Q ss_pred             CCccCCcchhhcC
Q psy2647          38 KPFACDLCGRAFQ   50 (72)
Q Consensus        38 ~~~~c~~c~~~~~   50 (72)
                      +.+.|+.|+..|.
T Consensus        56 ~~~vcp~c~~h~r   68 (296)
T CHL00174         56 KMNICEQCGYHLK   68 (296)
T ss_pred             cCCCCCCCCCCcC
Confidence            3468888887665


No 239
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=26.40  E-value=19  Score=16.14  Aligned_cols=30  Identities=33%  Similarity=0.773  Sum_probs=17.1

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcC
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~   50 (72)
                      .|.|+.|++.-..        +...  -.|.|..|++.|.
T Consensus        35 ky~Cp~Cgk~~vk--------R~a~--GIW~C~~C~~~~A   64 (90)
T PF01780_consen   35 KYTCPFCGKTSVK--------RVAT--GIWKCKKCGKKFA   64 (90)
T ss_dssp             -BEESSSSSSEEE--------EEET--TEEEETTTTEEEE
T ss_pred             CCcCCCCCCceeE--------Eeee--EEeecCCCCCEEe
Confidence            4778888753211        1112  2488999988774


No 240
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=26.32  E-value=19  Score=16.41  Aligned_cols=34  Identities=29%  Similarity=0.562  Sum_probs=17.9

Q ss_pred             CcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcC
Q psy2647          10 KPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~   50 (72)
                      .-+.|+.|+. ....-.+..      +.-...|..||..+.
T Consensus        20 t~f~CP~Cge-~~v~v~~~k------~~~h~~C~~CG~y~~   53 (99)
T PRK14892         20 KIFECPRCGK-VSISVKIKK------NIAIITCGNCGLYTE   53 (99)
T ss_pred             cEeECCCCCC-eEeeeecCC------CcceEECCCCCCccC
Confidence            3467888883 221111111      233467888886654


No 241
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=26.25  E-value=22  Score=14.64  Aligned_cols=12  Identities=25%  Similarity=0.866  Sum_probs=6.7

Q ss_pred             cccCcccchhcc
Q psy2647          11 PHKCQVCGKAFS   22 (72)
Q Consensus        11 ~~~c~~c~~~~~   22 (72)
                      ...|+.|++.|.
T Consensus        53 ~L~Cp~c~r~YP   64 (68)
T PF03966_consen   53 ELICPECGREYP   64 (68)
T ss_dssp             EEEETTTTEEEE
T ss_pred             EEEcCCCCCEEe
Confidence            445666665554


No 242
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=26.25  E-value=52  Score=12.30  Aligned_cols=8  Identities=50%  Similarity=1.410  Sum_probs=5.2

Q ss_pred             ccCCcchh
Q psy2647          40 FACDLCGR   47 (72)
Q Consensus        40 ~~c~~c~~   47 (72)
                      +.|+.||.
T Consensus        19 ~~CP~Cg~   26 (46)
T PF12760_consen   19 FVCPHCGS   26 (46)
T ss_pred             CCCCCCCC
Confidence            55777764


No 243
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=26.01  E-value=9.4  Score=18.54  Aligned_cols=12  Identities=25%  Similarity=0.888  Sum_probs=6.8

Q ss_pred             CccCCcchhhcC
Q psy2647          39 PFACDLCGRAFQ   50 (72)
Q Consensus        39 ~~~c~~c~~~~~   50 (72)
                      .|.|..|...|.
T Consensus       130 ~~~c~~c~epf~  141 (146)
T TIGR02159       130 LYRCRACKEPFE  141 (146)
T ss_pred             HhhhhhhCCcHh
Confidence            356666665554


No 244
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=26.00  E-value=27  Score=12.09  Aligned_cols=10  Identities=30%  Similarity=1.215  Sum_probs=5.9

Q ss_pred             CccCCcchhh
Q psy2647          39 PFACDLCGRA   48 (72)
Q Consensus        39 ~~~c~~c~~~   48 (72)
                      -|+|..|+..
T Consensus         7 ~ykC~~Cgni   16 (34)
T TIGR00319         7 VYKCEVCGNI   16 (34)
T ss_pred             EEEcCCCCcE
Confidence            4666666643


No 245
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=25.88  E-value=28  Score=14.42  Aligned_cols=14  Identities=29%  Similarity=0.781  Sum_probs=10.7

Q ss_pred             CCccCCcchhhcCC
Q psy2647          38 KPFACDLCGRAFQR   51 (72)
Q Consensus        38 ~~~~c~~c~~~~~~   51 (72)
                      .|..|..||+....
T Consensus         3 iPvRCFTCGkvi~~   16 (62)
T PRK04016          3 IPVRCFTCGKVIAE   16 (62)
T ss_pred             CCeEecCCCCChHH
Confidence            37789999987654


No 246
>PRK12496 hypothetical protein; Provisional
Probab=25.75  E-value=29  Score=17.21  Aligned_cols=11  Identities=18%  Similarity=0.667  Sum_probs=8.7

Q ss_pred             ccCCcchhhcC
Q psy2647          40 FACDLCGRAFQ   50 (72)
Q Consensus        40 ~~c~~c~~~~~   50 (72)
                      +.|..|++.|.
T Consensus       128 ~~C~gC~~~~~  138 (164)
T PRK12496        128 KVCKGCKKKYP  138 (164)
T ss_pred             EECCCCCcccc
Confidence            67888888874


No 247
>KOG2747|consensus
Probab=25.71  E-value=45  Score=19.34  Aligned_cols=25  Identities=24%  Similarity=0.614  Sum_probs=21.0

Q ss_pred             CCCccCCcchhhcCChHHHHHHHHH
Q psy2647          37 FKPFACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        37 ~~~~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      ...|.|..|-+-......|.+|+..
T Consensus       156 ~~lYiCEfCLkY~~s~~~l~rH~~k  180 (396)
T KOG2747|consen  156 DKLYICEFCLKYMKSRTSLQRHLKK  180 (396)
T ss_pred             CeEEEehHHHhHhchHHHHHHHHHh
Confidence            3467899999999999999999874


No 248
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=25.67  E-value=56  Score=17.53  Aligned_cols=34  Identities=26%  Similarity=0.548  Sum_probs=18.2

Q ss_pred             ccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhc
Q psy2647          12 HKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAF   49 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~   49 (72)
                      ..|.-|.-..+  .....-++.  +.....|+.||...
T Consensus       198 ~~C~GC~m~l~--~~~~~~V~~--~d~iv~CP~CgRIL  231 (239)
T COG1579         198 RVCGGCHMKLP--SQTLSKVRK--KDEIVFCPYCGRIL  231 (239)
T ss_pred             CcccCCeeeec--HHHHHHHhc--CCCCccCCccchHH
Confidence            34666654332  222222222  45577899998754


No 249
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=25.62  E-value=20  Score=13.04  Aligned_cols=10  Identities=30%  Similarity=1.072  Sum_probs=6.4

Q ss_pred             ccCCcchhhc
Q psy2647          40 FACDLCGRAF   49 (72)
Q Consensus        40 ~~c~~c~~~~   49 (72)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            5677776543


No 250
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=25.27  E-value=40  Score=13.46  Aligned_cols=19  Identities=21%  Similarity=0.567  Sum_probs=13.9

Q ss_pred             cccCcccchhccCcHHHHH
Q psy2647          11 PHKCQVCGKAFSQSSNLIT   29 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~   29 (72)
                      -+-|-+|+..|.+...|..
T Consensus        27 ~~YC~~Cg~~Y~d~~dL~~   45 (55)
T PF13821_consen   27 HNYCFWCGTKYDDEEDLER   45 (55)
T ss_pred             CceeeeeCCccCCHHHHHh
Confidence            3568889888888776654


No 251
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=25.07  E-value=26  Score=15.72  Aligned_cols=31  Identities=29%  Similarity=0.635  Sum_probs=18.0

Q ss_pred             CcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchhhcC
Q psy2647          10 KPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGRAFQ   50 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~   50 (72)
                      ..|.|+.|++.-.        .+..  .-.|.|..|++.|.
T Consensus        34 a~y~CpfCgk~~v--------kR~a--~GIW~C~~C~~~~A   64 (91)
T TIGR00280        34 AKYVCPFCGKKTV--------KRGS--TGIWTCRKCGAKFA   64 (91)
T ss_pred             cCccCCCCCCCce--------EEEe--eEEEEcCCCCCEEe
Confidence            3577888864211        0111  22588999988775


No 252
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=24.85  E-value=32  Score=11.92  Aligned_cols=11  Identities=27%  Similarity=1.138  Sum_probs=7.1

Q ss_pred             CccCCcchhhc
Q psy2647          39 PFACDLCGRAF   49 (72)
Q Consensus        39 ~~~c~~c~~~~   49 (72)
                      -|+|..|+...
T Consensus         4 ~ykC~~CGniv   14 (34)
T cd00974           4 VYKCEICGNIV   14 (34)
T ss_pred             EEEcCCCCcEE
Confidence            46777777543


No 253
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=24.58  E-value=54  Score=11.91  Aligned_cols=10  Identities=30%  Similarity=1.065  Sum_probs=2.6

Q ss_pred             ccCCcchhhc
Q psy2647          40 FACDLCGRAF   49 (72)
Q Consensus        40 ~~c~~c~~~~   49 (72)
                      |=|..|..-|
T Consensus         4 yyCdyC~~~~   13 (38)
T PF06220_consen    4 YYCDYCKKYL   13 (38)
T ss_dssp             -B-TTT--B-
T ss_pred             eeccccccee
Confidence            3455555544


No 254
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=24.49  E-value=27  Score=14.91  Aligned_cols=15  Identities=33%  Similarity=0.780  Sum_probs=10.5

Q ss_pred             CCccCCcchhhcCCh
Q psy2647          38 KPFACDLCGRAFQRK   52 (72)
Q Consensus        38 ~~~~c~~c~~~~~~~   52 (72)
                      .|..|-.||+.....
T Consensus         3 iPVRCFTCGkvig~~   17 (71)
T PLN00032          3 IPVRCFTCGKVIGNK   17 (71)
T ss_pred             CceeecCCCCCcHHH
Confidence            367888888876543


No 255
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=24.33  E-value=9.4  Score=18.29  Aligned_cols=11  Identities=27%  Similarity=0.718  Sum_probs=6.4

Q ss_pred             CCCccCCcchh
Q psy2647          37 FKPFACDLCGR   47 (72)
Q Consensus        37 ~~~~~c~~c~~   47 (72)
                      +....|+.|+.
T Consensus       103 ~~~~~CPwCg~  113 (131)
T PF15616_consen  103 EGEVTCPWCGN  113 (131)
T ss_pred             CCCEECCCCCC
Confidence            33456677664


No 256
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=24.22  E-value=37  Score=11.65  Aligned_cols=12  Identities=25%  Similarity=0.874  Sum_probs=4.9

Q ss_pred             cccCcccchhcc
Q psy2647          11 PHKCQVCGKAFS   22 (72)
Q Consensus        11 ~~~c~~c~~~~~   22 (72)
                      .|.|+.|+..+-
T Consensus        13 kY~Cp~C~~~~C   24 (30)
T PF04438_consen   13 KYRCPRCGARYC   24 (30)
T ss_dssp             SEE-TTT--EES
T ss_pred             EEECCCcCCcee
Confidence            456666665443


No 257
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=24.22  E-value=17  Score=14.25  Aligned_cols=10  Identities=40%  Similarity=0.899  Sum_probs=6.1

Q ss_pred             CCccCCcchh
Q psy2647          38 KPFACDLCGR   47 (72)
Q Consensus        38 ~~~~c~~c~~   47 (72)
                      ....|+.|+.
T Consensus        45 ~i~~Cp~CgR   54 (56)
T PF02591_consen   45 EIVFCPNCGR   54 (56)
T ss_pred             CeEECcCCCc
Confidence            4456777764


No 258
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=23.82  E-value=68  Score=18.48  Aligned_cols=23  Identities=35%  Similarity=0.621  Sum_probs=19.0

Q ss_pred             cCCcchhhcCChHHHHHHHHHhc
Q psy2647          41 ACDLCGRAFQRKVDLRRHKETQH   63 (72)
Q Consensus        41 ~c~~c~~~~~~~~~l~~H~~~~~   63 (72)
                      .|..|...|....-|..|.|..|
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~H  244 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRH  244 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhh
Confidence            68889999998888888888644


No 259
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=23.43  E-value=28  Score=14.43  Aligned_cols=15  Identities=33%  Similarity=0.769  Sum_probs=10.7

Q ss_pred             CCccCCcchhhcCCh
Q psy2647          38 KPFACDLCGRAFQRK   52 (72)
Q Consensus        38 ~~~~c~~c~~~~~~~   52 (72)
                      .|..|-.||+.....
T Consensus         3 iPiRCFsCGkvi~~~   17 (63)
T COG1644           3 IPVRCFSCGKVIGHK   17 (63)
T ss_pred             CceEeecCCCCHHHH
Confidence            377888898876543


No 260
>PRK01343 zinc-binding protein; Provisional
Probab=23.38  E-value=49  Score=13.49  Aligned_cols=11  Identities=27%  Similarity=0.709  Sum_probs=6.9

Q ss_pred             ccCCcchhhcC
Q psy2647          40 FACDLCGRAFQ   50 (72)
Q Consensus        40 ~~c~~c~~~~~   50 (72)
                      ..|+.|++.+.
T Consensus        10 ~~CP~C~k~~~   20 (57)
T PRK01343         10 RPCPECGKPST   20 (57)
T ss_pred             CcCCCCCCcCc
Confidence            45777776543


No 261
>PF14169 YdjO:  Cold-inducible protein YdjO
Probab=23.24  E-value=73  Score=13.11  Aligned_cols=8  Identities=38%  Similarity=0.887  Sum_probs=4.5

Q ss_pred             ccCCcchh
Q psy2647          40 FACDLCGR   47 (72)
Q Consensus        40 ~~c~~c~~   47 (72)
                      -.|+.|+.
T Consensus        40 p~CPlC~s   47 (59)
T PF14169_consen   40 PVCPLCKS   47 (59)
T ss_pred             ccCCCcCC
Confidence            35666653


No 262
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=22.92  E-value=39  Score=11.34  Aligned_cols=10  Identities=40%  Similarity=1.318  Sum_probs=5.7

Q ss_pred             ccCCcchhhc
Q psy2647          40 FACDLCGRAF   49 (72)
Q Consensus        40 ~~c~~c~~~~   49 (72)
                      +.|..|+..+
T Consensus        28 f~C~~C~~~L   37 (39)
T smart00132       28 FKCSKCGKPL   37 (39)
T ss_pred             CCCcccCCcC
Confidence            5666666543


No 263
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E. coli CobB; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. CobB is a bacterial sirtuin that deacetylates acetyl-CoA synthetase at an active site lysine to stimulate its enzymatic activity.
Probab=22.90  E-value=97  Score=16.04  Aligned_cols=14  Identities=21%  Similarity=0.453  Sum_probs=8.6

Q ss_pred             CcccCcccchhccC
Q psy2647          10 KPHKCQVCGKAFSQ   23 (72)
Q Consensus        10 ~~~~c~~c~~~~~~   23 (72)
                      ....|..|+..+..
T Consensus       108 ~~~~C~~C~~~~~~  121 (224)
T cd01412         108 FRVRCSSCGYVGEN  121 (224)
T ss_pred             CccccCCCCCCCCc
Confidence            34567778766544


No 264
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=22.78  E-value=81  Score=14.39  Aligned_cols=20  Identities=15%  Similarity=0.423  Sum_probs=13.7

Q ss_pred             cccCcccchhccCcHHHHHh
Q psy2647          11 PHKCQVCGKAFSQSSNLITH   30 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~   30 (72)
                      -+.|+.|+..+........-
T Consensus        31 ~~~C~~CGe~~~~~e~~~~~   50 (127)
T TIGR03830        31 GWYCPACGEELLDPEESKRN   50 (127)
T ss_pred             eeECCCCCCEEEcHHHHHHH
Confidence            46799999887766554433


No 265
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=22.62  E-value=59  Score=12.20  Aligned_cols=12  Identities=33%  Similarity=0.764  Sum_probs=7.5

Q ss_pred             CccCCcchhhcC
Q psy2647          39 PFACDLCGRAFQ   50 (72)
Q Consensus        39 ~~~c~~c~~~~~   50 (72)
                      .+.|+.|+..+.
T Consensus        20 ~~vC~~Cg~~~~   31 (52)
T smart00661       20 RFVCRKCGYEEP   31 (52)
T ss_pred             EEECCcCCCeEE
Confidence            466777775543


No 266
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=22.45  E-value=61  Score=11.73  Aligned_cols=19  Identities=21%  Similarity=0.436  Sum_probs=12.2

Q ss_pred             CccCCcchhhcCChHHHHH
Q psy2647          39 PFACDLCGRAFQRKVDLRR   57 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~   57 (72)
                      ...|+.|+..+.....+.+
T Consensus        19 id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EEECCCCCeEEccHHHHHH
Confidence            3567888777766655543


No 267
>KOG3362|consensus
Probab=22.44  E-value=19  Score=17.64  Aligned_cols=22  Identities=27%  Similarity=0.625  Sum_probs=12.4

Q ss_pred             CccCCcchhhcCChHHHHHHHH
Q psy2647          39 PFACDLCGRAFQRKVDLRRHKE   60 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~H~~   60 (72)
                      +|.|..||..+-+-..+..|..
T Consensus       129 ~ysC~~CG~kyCsv~C~~~Hne  150 (156)
T KOG3362|consen  129 KYSCVNCGTKYCSVRCLKTHNE  150 (156)
T ss_pred             hhHHHhcCCceeechhhhhccc
Confidence            3556666665555555555543


No 268
>COG5319 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.40  E-value=1.1e+02  Score=14.85  Aligned_cols=27  Identities=19%  Similarity=0.361  Sum_probs=16.1

Q ss_pred             hhccCcHHHHHhHHHhcCCCCccCCcchhhc
Q psy2647          19 KAFSQSSNLITHSRKHTGFKPFACDLCGRAF   49 (72)
Q Consensus        19 ~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~   49 (72)
                      .+|.+...+.+...    .....|+.|+..-
T Consensus        16 GWF~ssaDfd~Q~~----rgLv~CPvCgs~~   42 (142)
T COG5319          16 GWFGSSADFDRQRE----RGLVTCPVCGSTE   42 (142)
T ss_pred             ccccCchhHHHHHH----cCceeCCCCCcHH
Confidence            35666666655433    3457888887543


No 269
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=22.29  E-value=33  Score=15.41  Aligned_cols=12  Identities=33%  Similarity=0.944  Sum_probs=9.2

Q ss_pred             CccCCcchhhcC
Q psy2647          39 PFACDLCGRAFQ   50 (72)
Q Consensus        39 ~~~c~~c~~~~~   50 (72)
                      .|.|..|++.|.
T Consensus        54 IW~C~~C~~~~A   65 (90)
T PRK03976         54 IWECRKCGAKFA   65 (90)
T ss_pred             EEEcCCCCCEEe
Confidence            578888887765


No 270
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=22.15  E-value=45  Score=17.47  Aligned_cols=16  Identities=25%  Similarity=0.858  Sum_probs=11.6

Q ss_pred             CCCccCCcchhhcCCh
Q psy2647          37 FKPFACDLCGRAFQRK   52 (72)
Q Consensus        37 ~~~~~c~~c~~~~~~~   52 (72)
                      ..||.|..|.+.|..+
T Consensus       194 ~IPF~C~iCKkdy~sp  209 (259)
T COG5152         194 KIPFLCGICKKDYESP  209 (259)
T ss_pred             CCceeehhchhhccch
Confidence            3678898888777543


No 271
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=22.14  E-value=52  Score=18.93  Aligned_cols=22  Identities=36%  Similarity=0.638  Sum_probs=17.8

Q ss_pred             CccCCcchhhcCChHHHHHHHH
Q psy2647          39 PFACDLCGRAFQRKVDLRRHKE   60 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~~H~~   60 (72)
                      .+-|..|++-|...+-+..|+.
T Consensus       238 ~~YC~~C~r~f~~~~VFe~Hl~  259 (470)
T COG5188         238 KVYCVKCGREFSRSKVFEYHLE  259 (470)
T ss_pred             ceeeHhhhhHhhhhHHHHHHHh
Confidence            3568999999998888888864


No 272
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=22.09  E-value=45  Score=14.61  Aligned_cols=12  Identities=25%  Similarity=0.933  Sum_probs=9.1

Q ss_pred             ccCCcchhhcCC
Q psy2647          40 FACDLCGRAFQR   51 (72)
Q Consensus        40 ~~c~~c~~~~~~   51 (72)
                      -.|..|++.+..
T Consensus        79 ~~C~vC~k~l~~   90 (109)
T PF10367_consen   79 TKCSVCGKPLGN   90 (109)
T ss_pred             CCccCcCCcCCC
Confidence            369999987764


No 273
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=22.06  E-value=43  Score=15.54  Aligned_cols=11  Identities=36%  Similarity=1.062  Sum_probs=8.3

Q ss_pred             ccCCcchhhcC
Q psy2647          40 FACDLCGRAFQ   50 (72)
Q Consensus        40 ~~c~~c~~~~~   50 (72)
                      ..|+.||..|.
T Consensus        50 t~CP~Cg~~~e   60 (115)
T COG1885          50 TSCPKCGEPFE   60 (115)
T ss_pred             ccCCCCCCccc
Confidence            47899987664


No 274
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=21.93  E-value=24  Score=16.16  Aligned_cols=8  Identities=38%  Similarity=1.477  Sum_probs=4.6

Q ss_pred             ccCCcchh
Q psy2647          40 FACDLCGR   47 (72)
Q Consensus        40 ~~c~~c~~   47 (72)
                      |.|..||+
T Consensus         3 WkC~iCg~   10 (101)
T PF09943_consen    3 WKCYICGK   10 (101)
T ss_pred             eEEEecCC
Confidence            55666654


No 275
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=21.81  E-value=54  Score=13.78  Aligned_cols=8  Identities=50%  Similarity=1.402  Sum_probs=4.9

Q ss_pred             ccCCcchh
Q psy2647          40 FACDLCGR   47 (72)
Q Consensus        40 ~~c~~c~~   47 (72)
                      ++|+.||.
T Consensus         5 ~kCpKCgn   12 (68)
T COG3478           5 FKCPKCGN   12 (68)
T ss_pred             ccCCCcCC
Confidence            45777764


No 276
>KOG1088|consensus
Probab=21.78  E-value=27  Score=16.53  Aligned_cols=11  Identities=27%  Similarity=0.670  Sum_probs=5.0

Q ss_pred             ccCcccchhcc
Q psy2647          12 HKCQVCGKAFS   22 (72)
Q Consensus        12 ~~c~~c~~~~~   22 (72)
                      ..|+.||+.|+
T Consensus        99 l~CpetG~vfp  109 (124)
T KOG1088|consen   99 LVCPETGRVFP  109 (124)
T ss_pred             EecCCCCcEee
Confidence            34444444443


No 277
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=21.73  E-value=29  Score=16.98  Aligned_cols=28  Identities=25%  Similarity=0.600  Sum_probs=15.2

Q ss_pred             CcccCcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          10 KPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        10 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      ..+.|..|+.....         .++ ...-.|+.|+.
T Consensus       111 G~l~C~~Cg~~~~~---------~~~-~~l~~Cp~C~~  138 (146)
T PF07295_consen  111 GTLVCENCGHEVEL---------THP-ERLPPCPKCGH  138 (146)
T ss_pred             ceEecccCCCEEEe---------cCC-CcCCCCCCCCC
Confidence            34778888754221         112 23446888874


No 278
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=21.66  E-value=40  Score=16.99  Aligned_cols=18  Identities=22%  Similarity=0.682  Sum_probs=12.2

Q ss_pred             CccCCcchhhcCChHHHH
Q psy2647          39 PFACDLCGRAFQRKVDLR   56 (72)
Q Consensus        39 ~~~c~~c~~~~~~~~~l~   56 (72)
                      -+.|+.||+.|=.-+...
T Consensus       130 f~~C~~CgkiYW~GsHw~  147 (165)
T COG1656         130 FYRCPKCGKIYWKGSHWR  147 (165)
T ss_pred             eeECCCCcccccCchHHH
Confidence            467999998875444433


No 279
>PF04328 DUF466:  Protein of unknown function (DUF466);  InterPro: IPR007423 This is a small bacterial protein of unknown function.
Probab=21.51  E-value=85  Score=13.05  Aligned_cols=13  Identities=23%  Similarity=0.552  Sum_probs=8.2

Q ss_pred             HHHHHhccCCCCC
Q psy2647          57 RHKETQHTEMRPV   69 (72)
Q Consensus        57 ~H~~~~~~~~~p~   69 (72)
                      .|.+.+|.++.|.
T Consensus        30 ~H~~~~HP~~p~m   42 (65)
T PF04328_consen   30 EHMRRHHPDEPPM   42 (65)
T ss_pred             HHHHHHCcCCCCC
Confidence            4666667776554


No 280
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=21.50  E-value=45  Score=14.72  Aligned_cols=11  Identities=27%  Similarity=0.769  Sum_probs=7.3

Q ss_pred             ccCCcchhhcC
Q psy2647          40 FACDLCGRAFQ   50 (72)
Q Consensus        40 ~~c~~c~~~~~   50 (72)
                      -.|+.||..|.
T Consensus         9 ~~C~~CG~d~~   19 (86)
T PF06170_consen    9 PRCPHCGLDYS   19 (86)
T ss_pred             CcccccCCccc
Confidence            36778876654


No 281
>COG2879 Uncharacterized small protein [Function unknown]
Probab=21.50  E-value=86  Score=13.12  Aligned_cols=15  Identities=13%  Similarity=0.242  Sum_probs=7.4

Q ss_pred             HHHHHHHHHhccCCC
Q psy2647          53 VDLRRHKETQHTEMR   67 (72)
Q Consensus        53 ~~l~~H~~~~~~~~~   67 (72)
                      .+...|++.+|.+.-
T Consensus        26 dnYVehmr~~hPd~p   40 (65)
T COG2879          26 DNYVEHMRKKHPDKP   40 (65)
T ss_pred             HHHHHHHHHhCcCCC
Confidence            344555555454443


No 282
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=21.45  E-value=39  Score=12.23  Aligned_cols=9  Identities=33%  Similarity=1.054  Sum_probs=2.2

Q ss_pred             CCcchhhcC
Q psy2647          42 CDLCGRAFQ   50 (72)
Q Consensus        42 c~~c~~~~~   50 (72)
                      |..|+..+.
T Consensus         1 C~~C~~~~~    9 (47)
T PF01844_consen    1 CQYCGKPGS    9 (47)
T ss_dssp             -TTT--B--
T ss_pred             CCCCCCcCc
Confidence            455655543


No 283
>KOG3456|consensus
Probab=21.42  E-value=40  Score=15.68  Aligned_cols=13  Identities=38%  Similarity=1.040  Sum_probs=9.6

Q ss_pred             CccCCcchhhcCC
Q psy2647          39 PFACDLCGRAFQR   51 (72)
Q Consensus        39 ~~~c~~c~~~~~~   51 (72)
                      +..|.+||..|.+
T Consensus       104 ~~~CgYCGlrf~~  116 (120)
T KOG3456|consen  104 PHICGYCGLRFVQ  116 (120)
T ss_pred             Ccccccchhhhhh
Confidence            3578889888764


No 284
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=21.28  E-value=35  Score=13.87  Aligned_cols=11  Identities=27%  Similarity=1.096  Sum_probs=4.6

Q ss_pred             ccCCcchhhcC
Q psy2647          40 FACDLCGRAFQ   50 (72)
Q Consensus        40 ~~c~~c~~~~~   50 (72)
                      ..|+.|++.+.
T Consensus         3 v~CP~C~k~~~   13 (57)
T PF03884_consen    3 VKCPICGKPVE   13 (57)
T ss_dssp             EE-TTT--EEE
T ss_pred             ccCCCCCCeec
Confidence            45777776544


No 285
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics]
Probab=21.15  E-value=62  Score=18.61  Aligned_cols=24  Identities=21%  Similarity=0.650  Sum_probs=20.4

Q ss_pred             CCccCCcchhhcCChHHHHHHHHH
Q psy2647          38 KPFACDLCGRAFQRKVDLRRHKET   61 (72)
Q Consensus        38 ~~~~c~~c~~~~~~~~~l~~H~~~   61 (72)
                      ..|.|..|-+-+.....+.+|+..
T Consensus       157 ~vyICefClkY~~s~~~~~rH~~k  180 (395)
T COG5027         157 IVYICEFCLKYYGSQTSLVRHRKK  180 (395)
T ss_pred             eEEEhhhhHHHhcchhHHHHHHhc
Confidence            457899999999999999999874


No 286
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=20.96  E-value=47  Score=18.30  Aligned_cols=12  Identities=25%  Similarity=0.678  Sum_probs=8.9

Q ss_pred             CccCCcchhhcC
Q psy2647          39 PFACDLCGRAFQ   50 (72)
Q Consensus        39 ~~~c~~c~~~~~   50 (72)
                      .+.|+.|+..|.
T Consensus        46 ~~vc~~c~~h~r   57 (292)
T PRK05654         46 LNVCPKCGHHMR   57 (292)
T ss_pred             CCCCCCCCCCee
Confidence            468888887765


No 287
>PF14375 Cys_rich_CWC:  Cysteine-rich CWC
Probab=20.88  E-value=45  Score=12.85  Aligned_cols=7  Identities=43%  Similarity=1.042  Sum_probs=2.7

Q ss_pred             Ccchhhc
Q psy2647          43 DLCGRAF   49 (72)
Q Consensus        43 ~~c~~~~   49 (72)
                      +.||..|
T Consensus         2 P~Cg~~f    8 (50)
T PF14375_consen    2 PRCGAPF    8 (50)
T ss_pred             CCCCCcC
Confidence            3344333


No 288
>KOG3277|consensus
Probab=20.74  E-value=25  Score=17.52  Aligned_cols=34  Identities=18%  Similarity=0.491  Sum_probs=18.7

Q ss_pred             cccCcccchhccCcHHHHHhHHHhcCCCCccCCcchh
Q psy2647          11 PHKCQVCGKAFSQSSNLITHSRKHTGFKPFACDLCGR   47 (72)
Q Consensus        11 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   47 (72)
                      .|.|..|+..-...  + ..+.-+.|....+|+.|..
T Consensus        79 ~yTCkvCntRs~kt--i-sk~AY~~GvVivqC~gC~~  112 (165)
T KOG3277|consen   79 AYTCKVCNTRSTKT--I-SKQAYEKGVVIVQCPGCKN  112 (165)
T ss_pred             EEEeeccCCccccc--c-ChhhhhCceEEEECCCCcc
Confidence            47888887543211  1 1223344555678888853


No 289
>KOG0402|consensus
Probab=20.73  E-value=31  Score=15.28  Aligned_cols=10  Identities=30%  Similarity=1.315  Sum_probs=8.0

Q ss_pred             CccCCcchhh
Q psy2647          39 PFACDLCGRA   48 (72)
Q Consensus        39 ~~~c~~c~~~   48 (72)
                      .|.|+.||+.
T Consensus        36 ky~CsfCGK~   45 (92)
T KOG0402|consen   36 KYTCSFCGKK   45 (92)
T ss_pred             hhhhhhcchh
Confidence            5889999874


No 290
>PRK06450 threonine synthase; Validated
Probab=20.62  E-value=64  Score=18.06  Aligned_cols=10  Identities=40%  Similarity=0.853  Sum_probs=6.7

Q ss_pred             ccCcccchhc
Q psy2647          12 HKCQVCGKAF   21 (72)
Q Consensus        12 ~~c~~c~~~~   21 (72)
                      +.|..|++.|
T Consensus         4 ~~C~~Cg~~~   13 (338)
T PRK06450          4 EVCMKCGKER   13 (338)
T ss_pred             eEECCcCCcC
Confidence            5677777655


No 291
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=20.56  E-value=23  Score=14.27  Aligned_cols=11  Identities=27%  Similarity=0.655  Sum_probs=6.8

Q ss_pred             CCCccCCcchh
Q psy2647          37 FKPFACDLCGR   47 (72)
Q Consensus        37 ~~~~~c~~c~~   47 (72)
                      .-|.-|+.|.+
T Consensus        26 NfPlyCpKCK~   36 (55)
T PF14205_consen   26 NFPLYCPKCKQ   36 (55)
T ss_pred             cccccCCCCCc
Confidence            34666777754


No 292
>PRK05580 primosome assembly protein PriA; Validated
Probab=20.45  E-value=30  Score=21.33  Aligned_cols=12  Identities=42%  Similarity=0.758  Sum_probs=7.6

Q ss_pred             CCCccCCcchhh
Q psy2647          37 FKPFACDLCGRA   48 (72)
Q Consensus        37 ~~~~~c~~c~~~   48 (72)
                      ..+..|+.|+..
T Consensus       419 ~~~~~Cp~Cg~~  430 (679)
T PRK05580        419 PIPKACPECGST  430 (679)
T ss_pred             CCCCCCCCCcCC
Confidence            346678888653


No 293
>PF14599 zinc_ribbon_6:  Zinc-ribbon; PDB: 2K2D_A.
Probab=20.36  E-value=18  Score=14.86  Aligned_cols=6  Identities=33%  Similarity=1.154  Sum_probs=2.3

Q ss_pred             Ccccch
Q psy2647          14 CQVCGK   19 (72)
Q Consensus        14 c~~c~~   19 (72)
                      |..|+.
T Consensus        33 CNDC~~   38 (61)
T PF14599_consen   33 CNDCNA   38 (61)
T ss_dssp             ESSS--
T ss_pred             CCCCCC
Confidence            555554


No 294
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=20.28  E-value=43  Score=13.32  Aligned_cols=10  Identities=30%  Similarity=1.016  Sum_probs=7.5

Q ss_pred             CCccCCcchh
Q psy2647          38 KPFACDLCGR   47 (72)
Q Consensus        38 ~~~~c~~c~~   47 (72)
                      ..|.|..|+.
T Consensus        43 i~y~C~~Cg~   52 (54)
T PF10058_consen   43 IQYRCPYCGA   52 (54)
T ss_pred             eEEEcCCCCC
Confidence            4688998874


No 295
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=20.27  E-value=67  Score=14.41  Aligned_cols=18  Identities=17%  Similarity=0.604  Sum_probs=13.1

Q ss_pred             ccCcccchhccCcHHHHH
Q psy2647          12 HKCQVCGKAFSQSSNLIT   29 (72)
Q Consensus        12 ~~c~~c~~~~~~~~~l~~   29 (72)
                      ..|..||..|.....+..
T Consensus        36 ~~C~~CGe~y~~dev~~e   53 (89)
T TIGR03829        36 ISCSHCGMEYQDDTTVKE   53 (89)
T ss_pred             ccccCCCcEeecHHHHHH
Confidence            569999998877665443


No 296
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=20.18  E-value=36  Score=15.47  Aligned_cols=13  Identities=54%  Similarity=1.017  Sum_probs=9.2

Q ss_pred             CCCcccCcccchh
Q psy2647           8 GEKPHKCQVCGKA   20 (72)
Q Consensus         8 ~~~~~~c~~c~~~   20 (72)
                      +.+.|.|..|+..
T Consensus         3 ~lkewkC~VCg~~   15 (103)
T COG4847           3 GLKEWKCYVCGGT   15 (103)
T ss_pred             ccceeeEeeeCCE
Confidence            4466888888864


Done!