Diaphorina citri psyllid: psy2648

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------71

MNDKSFRYSTGKSETGRGSENNISSSRLMSSRRESSRRERDEPHIGKYKLLKTIGKGNFAKVKLAKHVPTGKEVAIKIIDKTQLNPGSLQKLFREVRIMKMLDHPNIVKLFQVIETEKTLYLVMEYASGGEVFDYLVLHGRMKEKEARAKFRQIVSAVQYCHQKKIIHRDLKAENLLLDSEMNIKIADFGFSNEFTPGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLKKFLVLNPAKRASLEVSGEVTLGGAPVTSSGGAGTNHTHNSSISPAPTNFKRQNTIDSASIKENTARLNAGRPAKNTASIAPLDTKALVGLGYSRSEIEESLSQAKYDDPESDGSRSGSSLSLRNLQPGSGGGATGGSGSSRSWRNMQPGSGGVATGGSGGGGGGGAAQSPSHRGVHRSISASNAKPSRRASSGGETLLKLFQVIETEKTLYLVMEYASGGEVFDYLVLHGRMKEKEARAKFRQIVSAVQYCHQKKIIHRDLKAENLLLDSEMNIKIADFGFSNEFTPGNKLDTFCGSPPYAAPELFQGGAPVTSSGGAGTNHTHNSSISPAPTNFKRQNTIDSASIKENTARLNAGRPAKNTASIAPLDTNTSNIGKPRGVTKSNTMTGNRTTLTPGGSVGRRSTISYDAKAASNEKTNTAGDTPTWWVTT

cccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccCEEEEEEEcccccEEEEEEECccccccccHHHHHHHHHHHHHccccccccEEEEEEEccEEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEECccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHccCCcccccccHHHHHHHHHHHccccccccCEECccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccHHHHHHHcccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEccEEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEECcccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEc

********************************************IGKYKLLKTIGKGNFAKVKLAKHVPTGKEVAIKIIDKTQLNPGSLQKLFREVRIMKMLDHPNIVKLFQVIETEKTLYLVMEYASGGEVFDYLVLHGRMKEKEARAKFRQIVSAVQYCHQKKIIHRDLKAENLLLDSEMNIKIADFGFSNEFTPGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLKKFLVLNPAKRASLEVSGEVTLGGAPVTSSGGAGTNHTH***ISP*PTNFKRQNTIDSASIKENTARLNAGRPAKNTASIAPLDTKALVGLGYSRSEIEES*SQAKYDDPESDGSRSGSSLSLRNLQPGSGGGATGGSGSSRSWRNMQPGSGGV******************************************TLLKLFQVIETEKTLYLVMEYASGGEVFDYLVLHGRMKEKEARAKFRQIVSAVQYCHQKKIIHRDLKAENLLLDSEMNIKIADFGFSNEFTPGNKLDTFCGSPPYAAPELFQGGAPVTSSGGAGTNHTHNSSISPAPTNFKRQNTIDSASIK******************************************************************************TWWVTT

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
MAP/microtubule affinity-regulating kinase 3	Involved in the specific phosphorylation of microtubule-associated proteins for tau, MAP2 and MAP4. Phosphorylates CDC25C. Regulates localization and activity of some histone deacetylases by mediating phosphorylation of HDAC7, promoting subsequent interaction between HDAC7 and 14-3-3 and export from the nucleus.	confident	Q03141
MAP/microtubule affinity-regulating kinase 3	Involved in the specific phosphorylation of microtubule-associated proteins for tau, MAP2 and MAP4. Phosphorylates CDC25C. Regulates localization and activity of some histone deacetylases by mediating phosphorylation of HDAC7, promoting subsequent interaction between HDAC7 and 14-3-3 and export from the nucleus.	confident	Q8VHF0
MAP/microtubule affinity-regulating kinase 3	Involved in the specific phosphorylation of microtubule-associated proteins for tau, MAP2 and MAP4. Phosphorylates CDC25C on 'Ser-216'. Regulates localization and activity of some histone deacetylases by mediating phosphorylation of HDAC7, promoting subsequent interaction between HDAC7 and 14-3-3 and export from the nucleus.	confident	P27448

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0005938 [CC]	cell cortex	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0051716 [BP]	cellular response to stimulus	probable	GO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0009949 [BP]	polarity specification of anterior/posterior axis	probable	GO:0032502, GO:0007389, GO:0032501, GO:0009952, GO:0044707, GO:0009948, GO:0065001, GO:0008150, GO:0003002, GO:0009798, GO:0007275, GO:0044699
GO:0048522 [BP]	positive regulation of cellular process	probable	GO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031667 [BP]	response to nutrient levels	probable	GO:0009991, GO:0008150, GO:0050896, GO:0009605
GO:0055059 [BP]	asymmetric neuroblast division	probable	GO:0030154, GO:0055057, GO:0048103, GO:0007405, GO:0007275, GO:0051301, GO:0048869, GO:0008150, GO:0044699, GO:0061351, GO:0032502, GO:0032501, GO:0008283, GO:0009987, GO:0044763, GO:0022008, GO:0017145, GO:0048699, GO:0045165, GO:0044707, GO:0007399, GO:0048856, GO:0048731, GO:0072089
GO:0009894 [BP]	regulation of catabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0004674 [MF]	protein serine/threonine kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0045167 [BP]	asymmetric protein localization involved in cell fate determination	probable	GO:0032502, GO:0008105, GO:0008104, GO:0048869, GO:0001709, GO:0045165, GO:0044763, GO:0030154, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699
GO:0040025 [BP]	vulval development	probable	GO:0032502, GO:0009791, GO:0048856, GO:0044707, GO:0048569, GO:0032501, GO:0002119, GO:0044767, GO:0048513, GO:0002164, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0040027 [BP]	negative regulation of vulval development	probable	GO:0051093, GO:0050793, GO:0051241, GO:0040028, GO:0048581, GO:0048580, GO:0050789, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048519, GO:0061062, GO:0061064
GO:0042221 [BP]	response to chemical stimulus	probable	GO:0050896, GO:0008150
GO:0006950 [BP]	response to stress	probable	GO:0050896, GO:0008150
GO:0030010 [BP]	establishment of cell polarity	probable	GO:0008150, GO:0009987, GO:0007163, GO:0044763, GO:0044699
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0080090 [BP]	regulation of primary metabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0010604 [BP]	positive regulation of macromolecule metabolic process	probable	GO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0040035 [BP]	hermaphrodite genitalia development	probable	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0046777 [BP]	protein autophosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0007154 [BP]	cell communication	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.7.-.-	Transferring phosphorous-containing groups.	probable
2.7.11.-	Protein-serine/threonine kinases.	probable
2.7.11.1	Transferred entry: 2.7.11.19.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FE3, chain A
Confidence level:very confident
Coverage over the Query: 42-301,312-323,354-395
View the alignment between query and template
View the model in PyMOL

Template: 3FE3, chain A
Confidence level:very confident
Coverage over the Query: 468-589
View the alignment between query and template
View the model in PyMOL

Template: 3H4J, chain B
Confidence level:very confident
Coverage over the Query: 467-592,618-636
View the alignment between query and template
View the model in PyMOL

Template: 3QA8, chain A
Confidence level:very confident
Coverage over the Query: 433-592,618-637
View the alignment between query and template
View the model in PyMOL

Template: 3DLS, chain A
Confidence level:very confident
Coverage over the Query: 467-641
View the alignment between query and template
View the model in PyMOL

Template: 2QNJ, chain A
Confidence level:very confident
Coverage over the Query: 41-291,302-333,363-385
View the alignment between query and template
View the model in PyMOL

Template: 3OCB, chain A
Confidence level:confident
Coverage over the Query: 45-287,298-344
View the alignment between query and template
View the model in PyMOL