Diaphorina citri psyllid: psy2657


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MNLFIPKRKPVMLIGNAGSGKSILINKMLSSLPPETYALTSVPFNFYTSSEMLQKVLEKPLEKKAGRNFGPPGNKTMIYFVDDMNMPEVDAYGTVQPHTVIRQYMDYQHWYDRQKLSLKDIHNIMFVSAMNPTSGSFTIEPRLQRHFYVFALRLGLLRIGSIY
ccccccccccEEEEccccccHHHHHHHHHHcccccccEEEEECccccccHHHHHHHHHHHHHHccccccccccccEEEEEEcccccccccccccccHHHHHHHHHcccccEEccccccEEEEccEEEEECccccccccccHHHHHHHcEEEEcccHHHHcccc
*NLF**KRKPVMLIGNAGSGKSILINKMLSSLPPETYALTSVPFNFYTSSEMLQKVLEKPLEKKAGRNFGPPGNKTMIYFVDDMNMPEVDAYGTVQPHTVIRQYMDYQHWYDRQKLSLKDIHNIMFVSAMNPTSGSFTIEPRLQRHFYVFALRLGLLRIGSIY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLFIPKRKPVMLIGNAGSGKSILINKMLSSLPPETYALTSVPFNFYTSSEMLQKVLEKPLEKKAGRNFGPPGNKTMIYFVDDMNMPEVDAYGTVQPHTVIRQYMDYQHWYDRQKLSLKDIHNIMFVSAMNPTSGSFTIEPRLQRHFYVFALRLGLLRIGSIY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dynein heavy chain 9, axonemal Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP.confidentQ9NYC9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0007605 [BP]sensory perception of soundprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0003674 [MF]molecular_functionprobable
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0035085 [CC]cilium axonemeprobableGO:0005737, GO:0005575, GO:0044463, GO:0043231, GO:0032838, GO:0031514, GO:0044441, GO:0044464, GO:0043229, GO:0005623, GO:0043226, GO:0044446, GO:0044444, GO:0097014, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0005930, GO:0044422, GO:0005622
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZU0, chain C
Confidence level:confident
Coverage over the Query: 1-154
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3vkg, chain A very confident Alignment | Template Structure