Diaphorina citri psyllid: psy2668


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-----
MEVAFSSNADFSLMTKNKEPLLISEVIQKAFIEVNEEGTEAAAATVDRPSIDEVILCCRSSVDTP
ccccccccccccccccccccCEEEEEEEEEEEEEcccHHHHHHcccccCEECcccccccEEcccc
MEVAFSSNADFSLMTKNKEPLLISEVIQKAFIEVNEEGTEAAAATVDRPSIDEVILCCRSSVDTP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVAFSSNADFSLMTKNKEPLLISEVIQKAFIEVNEEGTEAAAATVDRPSIDEVILCCRSSVDTP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heterochromatin-associated protein MENT DNA-binding protein that promotes DNA condensation into transcriptionally inactive heterochromatin in terminally differentiated avian blood cells. Promotes tight packing of nucleosomes into spherical clusters by binding to linker DNA and subsequent oligomerization. Act as a cysteine protease inhibitor towards CTSL1 (cathepsin L1) and CTSL2 (cathepsin L2), but does not inhibit serine proteases.confidentO73790

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0043434 [BP]response to peptide hormone stimulusprobableGO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0010033
GO:0034097 [BP]response to cytokine stimulusprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0045861 [BP]negative regulation of proteolysisprobableGO:0032269, GO:0032268, GO:0010605, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0031324, GO:0051246, GO:0051248, GO:0050794, GO:0008150, GO:0065007, GO:0030162, GO:0048519, GO:0009892, GO:0050789, GO:0048523
GO:0001618 [MF]viral receptor activityprobableGO:0003674, GO:0004872
GO:0042176 [BP]regulation of protein catabolic processprobableGO:0009894, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0065007, GO:0008150, GO:0050789
GO:0010951 [BP]negative regulation of endopeptidase activityprobableGO:0051336, GO:0051346, GO:0019222, GO:0052547, GO:0052548, GO:0050790, GO:0050789, GO:0010466, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0043086
GO:0070062 [CC]extracellular vesicular exosomeprobableGO:0043230, GO:0031982, GO:0044421, GO:0065010, GO:0031988, GO:0005575, GO:0005576, GO:0043227, GO:0043226
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031232 [CC]extrinsic to external side of plasma membraneprobableGO:0019897, GO:0009897, GO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0019898, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0030155 [BP]regulation of cell adhesionprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0004867 [MF]serine-type endopeptidase inhibitor activityprobableGO:0004866, GO:0030234, GO:0061134, GO:0003674, GO:0030414, GO:0004857, GO:0061135
GO:0004869 [MF]cysteine-type endopeptidase inhibitor activityprobableGO:0004866, GO:0030234, GO:0061134, GO:0003674, GO:0030414, GO:0004857, GO:0061135
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0009615 [BP]response to virusprobableGO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0048711 [BP]positive regulation of astrocyte differentiationprobableGO:0048710, GO:0030154, GO:0045687, GO:0050789, GO:0045685, GO:0014015, GO:0014013, GO:0048869, GO:0060284, GO:0050769, GO:0008150, GO:0065007, GO:0044699, GO:0010720, GO:0048518, GO:0032502, GO:0032501, GO:0050767, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0051960, GO:2000026, GO:0007275, GO:0048731, GO:0048522
GO:0042060 [BP]wound healingprobableGO:0050896, GO:0006950, GO:0008150, GO:0009611
GO:0008201 [MF]heparin bindingprobableGO:0043168, GO:1901681, GO:0097367, GO:0043167, GO:0005539, GO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QMN, chain A
Confidence level:very confident
Coverage over the Query: 1-47
View the alignment between query and template
View the model in PyMOL