Query         psy2693
Match_columns 122
No_of_seqs    104 out of 167
Neff          3.9 
Searched_HMMs 46136
Date          Fri Aug 16 22:47:40 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2693.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2693hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06957 COPI_C:  Coatomer (COP 100.0 2.1E-43 4.7E-48  302.7   5.2   98    2-101   325-422 (422)
  2 KOG0292|consensus              100.0 3.3E-33 7.2E-38  256.7   5.7   95    1-97   1108-1202(1202)
  3 COG4391 Uncharacterized protei  92.6   0.076 1.7E-06   36.0   1.7   20   48-68     40-59  (62)
  4 cd00350 rubredoxin_like Rubred  92.6     0.1 2.2E-06   30.3   2.0   26   58-83      2-27  (33)
  5 PRK12496 hypothetical protein;  92.2   0.091   2E-06   40.3   1.9   35   46-80    110-150 (164)
  6 PF05191 ADK_lid:  Adenylate ki  91.6    0.13 2.8E-06   30.9   1.7   23   59-81      3-29  (36)
  7 PF10276 zf-CHCC:  Zinc-finger   91.4    0.14   3E-06   31.6   1.7   21   48-68     20-40  (40)
  8 PF13240 zinc_ribbon_2:  zinc-r  90.3    0.13 2.9E-06   28.0   0.8   20   59-80      1-20  (23)
  9 PF14446 Prok-RING_1:  Prokaryo  90.0    0.17 3.7E-06   33.3   1.3   28   41-71      8-35  (54)
 10 PF08271 TF_Zn_Ribbon:  TFIIB z  88.8    0.21 4.6E-06   30.2   1.0   23   59-81      2-27  (43)
 11 PRK00398 rpoP DNA-directed RNA  87.3    0.55 1.2E-05   28.6   2.2   12   57-68     21-32  (46)
 12 cd00729 rubredoxin_SM Rubredox  87.2     0.5 1.1E-05   27.8   1.9   25   58-82      3-27  (34)
 13 PRK05452 anaerobic nitric oxid  86.5       2 4.3E-05   37.7   6.0   73    6-83    375-468 (479)
 14 PF13248 zf-ribbon_3:  zinc-rib  86.2    0.37 7.9E-06   26.6   0.9   22   58-81      3-24  (26)
 15 PF00301 Rubredoxin:  Rubredoxi  86.1    0.57 1.2E-05   29.7   1.8   26   58-83      2-44  (47)
 16 TIGR02300 FYDLN_acid conserved  85.1    0.52 1.1E-05   35.9   1.5   33   41-73      9-42  (129)
 17 PF09538 FYDLN_acid:  Protein o  84.8    0.51 1.1E-05   34.4   1.4   30   41-70      9-39  (108)
 18 PRK00420 hypothetical protein;  80.6    0.96 2.1E-05   33.5   1.4   27   58-84     24-51  (112)
 19 PF13901 DUF4206:  Domain of un  78.8     1.5 3.3E-05   34.4   2.1   38   42-80    156-196 (202)
 20 PF13913 zf-C2HC_2:  zinc-finge  78.7    0.83 1.8E-05   25.1   0.5   15   56-70      1-15  (25)
 21 smart00659 RPOLCX RNA polymera  78.3     1.6 3.4E-05   27.2   1.7   23   44-68      8-30  (44)
 22 COG1996 RPC10 DNA-directed RNA  78.2     1.4   3E-05   28.5   1.4   26   44-70     12-37  (49)
 23 COG1645 Uncharacterized Zn-fin  75.9     1.5 3.2E-05   33.5   1.3   55   58-113    29-88  (131)
 24 TIGR00622 ssl1 transcription f  75.7     1.9   4E-05   32.1   1.7   24   58-85      2-27  (112)
 25 PF14354 Lar_restr_allev:  Rest  74.1     1.7 3.6E-05   27.4   1.0   11   58-68      4-14  (61)
 26 smart00531 TFIIE Transcription  73.8     2.6 5.7E-05   31.3   2.1   27   54-80     96-130 (147)
 27 cd00730 rubredoxin Rubredoxin;  73.6     2.6 5.7E-05   26.9   1.8   12   59-70      3-14  (50)
 28 PF14369 zf-RING_3:  zinc-finge  71.2     3.1 6.7E-05   24.7   1.6   27   44-70      8-34  (35)
 29 PRK00566 DNA-directed RNA poly  70.5     4.5 9.6E-05   40.1   3.4   63   16-83     17-82  (1156)
 30 smart00834 CxxC_CXXC_SSSS Puta  69.5     2.7 5.8E-05   24.2   1.1   10   56-65     25-34  (41)
 31 PRK14892 putative transcriptio  69.2     4.1 8.8E-05   29.5   2.2   31   52-82     16-51  (99)
 32 TIGR03847 conserved hypothetic  69.2     2.7 5.8E-05   33.6   1.3   18   59-78    158-175 (177)
 33 PF13465 zf-H2C2_2:  Zinc-finge  69.0     3.4 7.3E-05   22.5   1.3   16   53-68     10-25  (26)
 34 PF12660 zf-TFIIIC:  Putative z  68.3     3.6 7.8E-05   29.2   1.7   31   39-70     38-68  (99)
 35 PF14255 Cys_rich_CPXG:  Cystei  68.2     2.5 5.3E-05   27.4   0.8   11   58-68      1-11  (52)
 36 PF10571 UPF0547:  Uncharacteri  68.1     2.9 6.4E-05   23.4   1.0   21   59-81      2-22  (26)
 37 TIGR00100 hypA hydrogenase nic  68.0       4 8.7E-05   29.5   1.9   29   55-83     68-96  (115)
 38 PF12773 DZR:  Double zinc ribb  67.1     4.4 9.5E-05   24.5   1.7   25   54-80     26-50  (50)
 39 PF01155 HypA:  Hydrogenase exp  66.8       2 4.3E-05   30.9   0.1   30   55-84     68-97  (113)
 40 PRK12380 hydrogenase nickel in  66.6     4.8  0.0001   29.1   2.1   28   55-82     68-95  (113)
 41 PF05605 zf-Di19:  Drought indu  65.7       3 6.5E-05   26.0   0.8   10   57-66      2-11  (54)
 42 TIGR00595 priA primosomal prot  64.3     5.9 0.00013   35.0   2.7   38   44-85    228-265 (505)
 43 TIGR02605 CxxC_CxxC_SSSS putat  64.3       4 8.7E-05   24.9   1.2    9   57-65     26-34  (52)
 44 PF08274 PhnA_Zn_Ribbon:  PhnA   64.3     3.1 6.6E-05   24.3   0.6   22   59-80      4-26  (30)
 45 PF06677 Auto_anti-p27:  Sjogre  64.0     4.5 9.8E-05   25.0   1.4   23   58-80     18-41  (41)
 46 PF02892 zf-BED:  BED zinc fing  63.7     4.3 9.4E-05   23.9   1.2   23   48-70      7-29  (45)
 47 PRK00432 30S ribosomal protein  62.8     5.1 0.00011   25.5   1.5   26   58-83     21-47  (50)
 48 PF11290 DUF3090:  Protein of u  62.6     4.2 9.1E-05   32.3   1.3   16   59-76    156-171 (171)
 49 PF03604 DNA_RNApol_7kD:  DNA d  62.2     5.2 0.00011   23.5   1.3   15   54-68     14-28  (32)
 50 PF07282 OrfB_Zn_ribbon:  Putat  61.5     7.3 0.00016   24.9   2.1   27   56-82     27-55  (69)
 51 PRK12495 hypothetical protein;  60.9     4.7  0.0001   33.3   1.3   23   57-80     42-65  (226)
 52 PF13894 zf-C2H2_4:  C2H2-type   60.0     5.1 0.00011   19.7   0.9   11   59-69      2-12  (24)
 53 PF14206 Cys_rich_CPCC:  Cystei  60.0     6.3 0.00014   27.5   1.7   28   58-85      2-32  (78)
 54 COG1579 Zn-ribbon protein, pos  57.9     3.1 6.8E-05   34.3  -0.2   25   43-67    199-231 (239)
 55 PRK13130 H/ACA RNA-protein com  57.7     8.5 0.00019   25.3   1.9   26   56-85      4-29  (56)
 56 COG1592 Rubrerythrin [Energy p  57.6     7.3 0.00016   30.6   1.9   13   54-66    146-158 (166)
 57 PRK14714 DNA polymerase II lar  57.5     6.9 0.00015   39.4   2.0   44   25-81    657-700 (1337)
 58 PRK10246 exonuclease subunit S  57.0     4.6  0.0001   38.7   0.8   15   57-71    503-517 (1047)
 59 PRK03824 hypA hydrogenase nick  56.9     8.5 0.00018   28.6   2.0   16   55-70     68-83  (135)
 60 TIGR02098 MJ0042_CXXC MJ0042 f  56.9     7.9 0.00017   22.3   1.5   12   56-67     24-35  (38)
 61 COG3931 Predicted N-formylglut  56.8     6.5 0.00014   33.2   1.5   67   37-110   142-234 (263)
 62 PF14446 Prok-RING_1:  Prokaryo  56.8     6.1 0.00013   26.0   1.1   26   56-81      4-29  (54)
 63 PF01783 Ribosomal_L32p:  Ribos  55.2      12 0.00027   23.9   2.3   23   56-81     25-47  (56)
 64 PRK06266 transcription initiat  55.1       8 0.00017   30.0   1.7   28   54-81    114-144 (178)
 65 PF06943 zf-LSD1:  LSD1 zinc fi  54.7     8.4 0.00018   21.7   1.3   13   53-65     12-24  (25)
 66 PF02150 RNA_POL_M_15KD:  RNA p  54.5     4.8  0.0001   23.8   0.3   24   59-82      3-29  (35)
 67 TIGR00373 conserved hypothetic  54.2     5.8 0.00013   30.1   0.8   26   55-80    107-135 (158)
 68 PRK00464 nrdR transcriptional   54.0     7.3 0.00016   30.0   1.3   34   59-94      2-47  (154)
 69 COG1545 Predicted nucleic-acid  53.2     9.6 0.00021   28.5   1.8   24   57-82     29-52  (140)
 70 PF14447 Prok-RING_4:  Prokaryo  51.7     8.2 0.00018   25.5   1.1   19   52-70     34-52  (55)
 71 smart00661 RPOL9 RNA polymeras  51.7      11 0.00024   22.7   1.6   24   59-82      2-29  (52)
 72 PF04981 NMD3:  NMD3 family ;    50.8     7.5 0.00016   30.9   0.9   25   60-85      1-25  (236)
 73 COG4530 Uncharacterized protei  50.2     8.1 0.00017   29.4   1.0   28   41-68      9-37  (129)
 74 PF13878 zf-C2H2_3:  zinc-finge  49.6      13 0.00027   22.6   1.6   14   57-70     13-26  (41)
 75 TIGR02159 PA_CoA_Oxy4 phenylac  49.6     7.7 0.00017   29.5   0.8   21   57-77    105-128 (146)
 76 TIGR03655 anti_R_Lar restricti  49.4     7.6 0.00016   24.3   0.6   10   59-68      3-12  (53)
 77 TIGR02387 rpoC1_cyan DNA-direc  49.3      18 0.00038   33.9   3.2   51   28-83     33-86  (619)
 78 PRK14873 primosome assembly pr  49.1      13 0.00028   34.5   2.3   64   12-84    358-433 (665)
 79 PRK00564 hypA hydrogenase nick  49.0      12 0.00026   27.2   1.7   29   55-83     69-98  (117)
 80 PRK02625 rpoC1 DNA-directed RN  48.5      19 0.00041   33.7   3.2   49   28-81     40-91  (627)
 81 PF08792 A2L_zn_ribbon:  A2L zi  48.3      11 0.00024   22.1   1.2   15   53-67     17-31  (33)
 82 PF00096 zf-C2H2:  Zinc finger,  46.5      10 0.00022   19.2   0.7   11   59-69      2-12  (23)
 83 PF03811 Zn_Tnp_IS1:  InsA N-te  46.4      10 0.00022   22.7   0.8   11   57-67      5-15  (36)
 84 PRK05580 primosome assembly pr  46.4      16 0.00034   33.6   2.4   50   32-84    372-432 (679)
 85 PRK00133 metG methionyl-tRNA s  46.2      30 0.00066   31.6   4.2   63   10-81     97-160 (673)
 86 PF14353 CpXC:  CpXC protein     45.8      12 0.00027   26.6   1.3   15   57-71     38-52  (128)
 87 PRK12286 rpmF 50S ribosomal pr  45.7      14  0.0003   24.1   1.5   22   56-80     26-47  (57)
 88 COG1675 TFA1 Transcription ini  45.6      18 0.00038   28.7   2.3   52   10-67     88-142 (176)
 89 TIGR01053 LSD1 zinc finger dom  44.1      21 0.00046   20.7   1.9   14   53-66     15-28  (31)
 90 PF11672 DUF3268:  Protein of u  44.0      11 0.00025   27.4   0.9   32   57-89      2-46  (102)
 91 TIGR01031 rpmF_bact ribosomal   43.8      15 0.00033   23.7   1.4   24   55-81     24-47  (55)
 92 COG3809 Uncharacterized protei  42.8      14 0.00029   26.6   1.1   18   74-93      2-19  (88)
 93 PF01430 HSP33:  Hsp33 protein;  42.4      11 0.00023   30.8   0.6   16   53-68    262-277 (280)
 94 PRK03681 hypA hydrogenase nick  42.1      20 0.00044   25.8   2.0   28   55-82     68-96  (114)
 95 TIGR01384 TFS_arch transcripti  41.6      15 0.00031   25.4   1.1   22   60-81      3-24  (104)
 96 COG0675 Transposase and inacti  41.6      13 0.00028   28.7   1.0   24   55-81    307-330 (364)
 97 PHA00159 endonuclease I         41.6      26 0.00057   27.4   2.6   34   16-58     75-108 (148)
 98 PF03833 PolC_DP2:  DNA polymer  41.6     8.7 0.00019   37.3   0.0   63   10-82    629-701 (900)
 99 COG1592 Rubrerythrin [Energy p  41.3      14 0.00031   29.0   1.1   24   57-81    134-157 (166)
100 COG1281 Disulfide bond chapero  41.0      13 0.00029   31.5   1.0   17   53-69    262-278 (286)
101 PF13719 zinc_ribbon_5:  zinc-r  40.8      16 0.00036   21.4   1.1   12   58-69      3-14  (37)
102 PRK00423 tfb transcription ini  40.5      17 0.00038   30.0   1.6   27   55-81      9-38  (310)
103 smart00614 ZnF_BED BED zinc fi  40.3      18 0.00038   22.2   1.3   17   53-69     14-30  (50)
104 PF02591 DUF164:  Putative zinc  40.3      10 0.00022   23.8   0.2   17   50-66     39-55  (56)
105 PF04606 Ogr_Delta:  Ogr/Delta-  39.9      13 0.00029   22.8   0.6   10   59-68      1-10  (47)
106 PF04423 Rad50_zn_hook:  Rad50   39.7     8.5 0.00018   24.0  -0.3   13   59-71     22-34  (54)
107 PF12172 DUF35_N:  Rubredoxin-l  39.1      18 0.00039   20.8   1.1   22   58-81     12-33  (37)
108 COG1110 Reverse gyrase [DNA re  39.1      11 0.00025   37.4   0.3   38   43-84    682-719 (1187)
109 COG1439 Predicted nucleic acid  38.8      18 0.00039   28.9   1.4   24   55-80    137-160 (177)
110 CHL00018 rpoC1 RNA polymerase   38.7      42  0.0009   31.7   3.9   51   28-84     38-95  (663)
111 PF09889 DUF2116:  Uncharacteri  38.3      13 0.00028   24.7   0.4   23   56-80      2-25  (59)
112 cd00498 Hsp33 Heat shock prote  38.1      16 0.00036   29.8   1.1   15   54-68    259-273 (275)
113 COG1405 SUA7 Transcription ini  37.9      18 0.00038   30.4   1.3   25   58-82      2-29  (285)
114 COG4049 Uncharacterized protei  37.7      12 0.00025   25.5   0.1   16   53-68     13-28  (65)
115 PRK14906 DNA-directed RNA poly  37.7      42 0.00091   34.4   4.0   61   17-82     20-83  (1460)
116 TIGR02487 NrdD anaerobic ribon  37.6      45 0.00098   30.3   3.9   46   13-66    500-547 (579)
117 PF03119 DNA_ligase_ZBD:  NAD-d  37.5      19 0.00041   20.3   1.0   18   59-76      1-20  (28)
118 PRK08665 ribonucleotide-diphos  37.2      19  0.0004   33.9   1.4   26   58-83    725-750 (752)
119 PF09723 Zn-ribbon_8:  Zinc rib  37.0      20 0.00043   21.6   1.1   11   55-65     24-34  (42)
120 PRK00114 hslO Hsp33-like chape  36.9      17 0.00038   30.0   1.1   15   54-68    265-279 (293)
121 KOG4080|consensus               36.6      11 0.00024   30.1  -0.1   22   55-79     91-112 (176)
122 COG4888 Uncharacterized Zn rib  36.5      16 0.00035   27.0   0.8   28   55-82     20-55  (104)
123 KOG2807|consensus               36.1      46   0.001   29.5   3.5   53   28-85    247-302 (378)
124 PRK06393 rpoE DNA-directed RNA  36.1      25 0.00054   23.8   1.5   43   57-105     5-47  (64)
125 COG1198 PriA Primosomal protei  35.9      89  0.0019   29.7   5.6   67    9-82    406-484 (730)
126 PF13824 zf-Mss51:  Zinc-finger  35.5      27 0.00058   23.0   1.6   12   55-66     12-23  (55)
127 PF09297 zf-NADH-PPase:  NADH p  35.5      18 0.00039   20.4   0.7   23   59-81      5-29  (32)
128 TIGR00269 conserved hypothetic  35.5      20 0.00043   25.2   1.1   23   55-81     78-100 (104)
129 TIGR03829 YokU_near_AblA uncha  35.3      17 0.00037   26.0   0.7   20   51-70     29-48  (89)
130 PF13717 zinc_ribbon_4:  zinc-r  34.9      24 0.00051   20.8   1.2   11   58-68      3-13  (36)
131 PRK08351 DNA-directed RNA poly  34.7      35 0.00075   22.9   2.0   42   59-106     5-46  (61)
132 PRK12268 methionyl-tRNA synthe  34.6      71  0.0015   28.0   4.5   60   10-80     99-161 (556)
133 PRK06260 threonine synthase; V  34.3      27 0.00058   29.6   1.8   23   58-80      4-26  (397)
134 COG3919 Predicted ATP-grasp en  34.1      41 0.00089   29.8   2.9   34    5-38    242-275 (415)
135 smart00238 BIR Baculoviral inh  33.7      34 0.00074   21.7   1.9   18   52-69     30-48  (71)
136 PF09986 DUF2225:  Uncharacteri  32.9      23 0.00049   28.1   1.1   31   55-85      3-60  (214)
137 PF06676 DUF1178:  Protein of u  32.9      21 0.00046   27.5   0.9   16   54-69     29-44  (148)
138 COG4357 Zinc finger domain con  32.7      20 0.00044   26.5   0.8   30   41-72     62-95  (105)
139 PLN02294 cytochrome c oxidase   32.7      22 0.00047   28.5   0.9   28   46-74    127-158 (174)
140 PF07754 DUF1610:  Domain of un  32.6      29 0.00063   19.3   1.2   19   44-64      4-23  (24)
141 PRK06450 threonine synthase; V  32.4      28 0.00061   29.2   1.6   22   58-80      4-25  (338)
142 KOG3352|consensus               32.2      80  0.0017   24.8   4.0   56   17-73     71-149 (153)
143 PRK07591 threonine synthase; V  31.7      29 0.00063   29.9   1.7   23   57-80     18-40  (421)
144 PF03884 DUF329:  Domain of unk  31.7      37  0.0008   22.4   1.8   29   57-85      2-34  (57)
145 COG3677 Transposase and inacti  31.1      30 0.00066   25.6   1.5   35   43-77     35-73  (129)
146 COG2093 DNA-directed RNA polym  30.5      37 0.00081   23.2   1.7   30   73-104    18-47  (64)
147 PF14311 DUF4379:  Domain of un  30.5      25 0.00054   21.9   0.8   37   43-79     14-55  (55)
148 PRK09783 copper/silver efflux   30.4      28 0.00061   29.7   1.3   33   41-75     44-76  (409)
149 TIGR03826 YvyF flagellar opero  30.3      17 0.00037   27.6  -0.0   22   58-80      4-25  (137)
150 PF14169 YdjO:  Cold-inducible   30.0      31 0.00067   23.0   1.2   19   53-71     35-53  (59)
151 COG1656 Uncharacterized conser  29.7      49  0.0011   26.2   2.5   10   60-69    133-142 (165)
152 PF05325 DUF730:  Protein of un  28.8      38 0.00083   25.3   1.6   32   31-63     19-50  (122)
153 COG1571 Predicted DNA-binding   28.7      31 0.00066   30.9   1.3   24   58-81    351-375 (421)
154 PF13806 Rieske_2:  Rieske-like  28.5      34 0.00074   24.0   1.3   21   53-74     60-80  (104)
155 PRK01343 zinc-binding protein;  28.5      47   0.001   22.0   1.8   31   54-85      6-37  (57)
156 TIGR01206 lysW lysine biosynth  28.4      33 0.00072   22.3   1.1   13   56-68     21-33  (54)
157 cd00924 Cyt_c_Oxidase_Vb Cytoc  28.3      30 0.00064   24.9   1.0   26   47-73     66-95  (97)
158 TIGR00244 transcriptional regu  28.2      25 0.00054   27.3   0.6    7   59-65      2-8   (147)
159 cd03532 Rieske_RO_Alpha_VanA_D  28.1      56  0.0012   22.8   2.4   35   42-78     44-81  (116)
160 PF04641 Rtf2:  Rtf2 RING-finge  27.9      56  0.0012   26.4   2.6   60   26-85     84-162 (260)
161 PF15616 TerY-C:  TerY-C metal   27.9      58  0.0013   24.7   2.5   26   41-66     89-114 (131)
162 PF13408 Zn_ribbon_recom:  Reco  27.9      35 0.00076   20.5   1.1   17   55-71      3-19  (58)
163 PF13395 HNH_4:  HNH endonuclea  27.8      26 0.00057   21.9   0.5   11   60-70      1-11  (54)
164 COG4311 SoxD Sarcosine oxidase  27.5      25 0.00055   25.7   0.5   15   57-71      3-17  (97)
165 COG1143 NuoI Formate hydrogenl  27.4      44 0.00095   26.1   1.8   36   26-65     67-102 (172)
166 PRK14559 putative protein seri  26.8      37  0.0008   31.6   1.5   22   59-82     29-50  (645)
167 TIGR00201 comF comF family pro  26.7      31 0.00068   26.1   0.9   19   60-80      1-19  (190)
168 smart00109 C1 Protein kinase C  26.3      64  0.0014   18.3   2.0   23   59-81     13-35  (49)
169 PF08782 c-SKI_SMAD_bind:  c-SK  26.1      26 0.00057   25.4   0.4   30   41-70      9-41  (96)
170 PF12760 Zn_Tnp_IS1595:  Transp  25.8      32  0.0007   20.8   0.7    9   58-66     19-27  (46)
171 TIGR02487 NrdD anaerobic ribon  25.8      44 0.00095   30.4   1.8   25   55-81    522-546 (579)
172 PRK01402 hslO Hsp33-like chape  25.7      36 0.00079   29.0   1.2   15   54-68    305-319 (328)
173 cd00022 BIR Baculoviral inhibi  25.6      58  0.0013   20.5   1.9   15   55-69     32-46  (69)
174 PRK09263 anaerobic ribonucleos  25.5      42 0.00092   31.4   1.7    8   58-65    660-667 (711)
175 PRK10445 endonuclease VIII; Pr  25.5 1.5E+02  0.0032   24.1   4.7   63   10-80    196-262 (263)
176 PF14122 YokU:  YokU-like prote  25.5      41 0.00089   24.2   1.2   18   53-70     31-48  (87)
177 PF13597 NRDD:  Anaerobic ribon  25.4      77  0.0017   28.6   3.2   49   12-67    465-514 (546)
178 PRK09710 lar restriction allev  25.2      30 0.00066   23.5   0.5    9   58-66      7-15  (64)
179 PF11238 DUF3039:  Protein of u  24.8      23  0.0005   23.7  -0.1   27   42-68     29-55  (58)
180 PF14569 zf-UDP:  Zinc-binding   24.5      37  0.0008   24.1   0.9   22   68-92      4-25  (80)
181 PRK09678 DNA-binding transcrip  24.4      33 0.00072   23.5   0.6    9   59-67      3-11  (72)
182 PF14690 zf-ISL3:  zinc-finger   24.0      37 0.00081   19.9   0.7   10   58-67      3-12  (47)
183 PRK14894 glycyl-tRNA synthetas  23.8      50  0.0011   30.5   1.8   40   41-80     62-111 (539)
184 PRK14526 adenylate kinase; Pro  23.4      51  0.0011   25.8   1.6   30   56-85    121-154 (211)
185 PHA02942 putative transposase;  23.2      76  0.0017   27.3   2.7   33   56-92    324-358 (383)
186 PF11475 VP_N-CPKC:  Virion pro  23.2      10 0.00022   22.5  -1.8   18   41-65      7-24  (32)
187 PF06044 DRP:  Dam-replacing fa  23.2      26 0.00057   29.5  -0.1   23   58-80     32-60  (254)
188 PRK00241 nudC NADH pyrophospha  23.2      45 0.00098   27.1   1.3   21   53-73    113-133 (256)
189 TIGR01374 soxD sarcosine oxida  23.0      31 0.00068   24.4   0.3   14   58-71      2-15  (84)
190 cd03531 Rieske_RO_Alpha_KSH Th  22.9      84  0.0018   22.1   2.5   56   43-103    42-100 (115)
191 PRK01103 formamidopyrimidine/5  22.8 1.4E+02  0.0029   24.3   3.9   65   10-80    200-272 (274)
192 PF09862 DUF2089:  Protein of u  22.6      39 0.00084   25.1   0.7   24   60-85      1-24  (113)
193 PRK08579 anaerobic ribonucleos  22.6      52  0.0011   30.5   1.7   22   57-80    568-589 (625)
194 smart00647 IBR In Between Ring  22.5      78  0.0017   19.1   2.0   15   53-67     36-50  (64)
195 PRK09603 bifunctional DNA-dire  22.5      96  0.0021   34.1   3.6   62   17-83   1407-1472(2890)
196 cd03469 Rieske_RO_Alpha_N Ries  22.4      93   0.002   21.1   2.6   32   42-75     41-76  (118)
197 COG2260 Predicted Zn-ribbon RN  22.4      55  0.0012   22.0   1.3   18   59-80      7-24  (59)
198 TIGR02378 nirD_assim_sml nitri  22.3      55  0.0012   22.2   1.4   17   57-74     64-80  (105)
199 PRK08329 threonine synthase; V  22.3      49  0.0011   27.6   1.3   21   58-80      2-22  (347)
200 COG0333 RpmF Ribosomal protein  22.3      57  0.0012   21.6   1.4   22   57-81     27-48  (57)
201 PRK00420 hypothetical protein;  22.2      60  0.0013   24.0   1.6   28   44-71     26-54  (112)
202 PRK08271 anaerobic ribonucleos  22.1      56  0.0012   30.3   1.8   11   13-23    542-552 (623)
203 PF11023 DUF2614:  Protein of u  22.0      41 0.00089   25.3   0.7   25   56-80     68-92  (114)
204 TIGR02386 rpoC_TIGR DNA-direct  21.8      91   0.002   31.3   3.2   61   18-83     11-74  (1140)
205 PF01215 COX5B:  Cytochrome c o  21.7      25 0.00055   26.8  -0.4   27   46-73     98-128 (136)
206 PF11789 zf-Nse:  Zinc-finger o  21.6      46   0.001   21.4   0.8   34   42-78     12-53  (57)
207 PF04267 SoxD:  Sarcosine oxida  21.6      36 0.00077   24.1   0.3   14   58-71      2-15  (84)
208 PRK14810 formamidopyrimidine-D  21.5 1.7E+02  0.0037   23.8   4.3   66   10-80    199-271 (272)
209 PRK14844 bifunctional DNA-dire  21.5      92   0.002   34.2   3.3   62   17-83   1459-1523(2836)
210 cd03474 Rieske_T4moC Toluene-4  20.9   1E+02  0.0022   20.9   2.5   51   42-103    40-93  (108)
211 PF11793 FANCL_C:  FANCL C-term  20.8      42 0.00091   22.2   0.5   13   58-70     56-68  (70)
212 PHA02551 19 tail tube protein;  20.8      59  0.0013   25.5   1.4   22   29-50    138-159 (163)
213 PRK05638 threonine synthase; V  20.7      58  0.0013   28.1   1.5   21   58-80      2-22  (442)
214 COG1327 Predicted transcriptio  20.5      43 0.00094   26.4   0.6   22   59-80      2-35  (156)
215 TIGR02827 RNR_anaer_Bdell anae  20.2 1.6E+02  0.0036   27.2   4.3   44   14-65    509-554 (586)
216 smart00249 PHD PHD zinc finger  20.2      77  0.0017   17.4   1.5   20   53-72     10-29  (47)
217 PF02489 Herpes_glycop_H:  Herp  20.0      52  0.0011   29.9   1.1   27   42-68    546-572 (657)

No 1  
>PF06957 COPI_C:  Coatomer (COPI) alpha subunit C-terminus;  InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer []. While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins []. For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi []. Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes []. Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerise, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.  This entry represents the C terminus (approximately 500 residues) of the eukaryotic coatomer alpha subunit [, ]. This domain is found along with the IPR006692 from INTERPRO domain. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0005515 protein binding, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030126 COPI vesicle coat; PDB: 3MKR_B 3MV2_E 3MKQ_B 3MV3_A.
Probab=100.00  E-value=2.1e-43  Score=302.70  Aligned_cols=98  Identities=54%  Similarity=0.981  Sum_probs=72.3

Q ss_pred             cccccCCChHHHHHHHHHHHHHhcCCCCceeecCCCCCCeeeecccceeccCCCcceecCCCCceecCCCCCcccCcccc
Q psy2693           2 EILAKFQIIPVATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus         2 ~lLel~p~~~va~qArKIl~~ce~~~tDa~eIdYD~~npF~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      +|||++|++++++||||||++|||+|||+|+||||+||||+||++||||||+|+++|+||||||+|+|+|||+||+||+|
T Consensus       325 RLLel~p~~~~a~qArKil~~~e~~~tDa~~i~yD~~npF~ICa~s~tPIY~G~~~v~CP~cgA~y~~~~kG~lC~vC~l  404 (422)
T PF06957_consen  325 RLLELNPSPEVAEQARKILQACERNPTDAHEIDYDERNPFDICAASYTPIYRGSPSVKCPYCGAKYHPEYKGQLCPVCEL  404 (422)
T ss_dssp             HHHCT--SCHHHHHHHHHHHHHCCS--BSS--S--TTS-EEEBTTT--EEETTS-EEE-TTT--EEEGGGTTSB-TTTTT
T ss_pred             HHHHcCCCHHHHHHHHHHHHHHhcCCCCceecCCCCCCCceeeecccccccCCCCCeeCCCCCCccChhhCCCCCCCCcc
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeecCCCcccCcceecccch
Q psy2693          82 SVIDTHRNAYGLQICAGLMK  101 (122)
Q Consensus        82 s~IG~~~~a~GLr~~~~~~~  101 (122)
                      ++||  ++++|||++++|+|
T Consensus       405 ~~IG--~~a~GLris~~q~r  422 (422)
T PF06957_consen  405 SEIG--ADASGLRISPSQFR  422 (422)
T ss_dssp             BBTT-----S----SGGG--
T ss_pred             eeeC--CcceeeEecccccC
Confidence            9999  99999999999998


No 2  
>KOG0292|consensus
Probab=99.97  E-value=3.3e-33  Score=256.73  Aligned_cols=95  Identities=47%  Similarity=0.905  Sum_probs=93.0

Q ss_pred             CcccccCCChHHHHHHHHHHHHHhcCCCCceeecCCCCCCeeeecccceeccCCCcceecCCCCceecCCCCCcccCccc
Q psy2693           1 MEILAKFQIIPVATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus         1 ~~lLel~p~~~va~qArKIl~~ce~~~tDa~eIdYD~~npF~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      |+||++.|++++|+|||||+++||+||+|+++|+||+||||+||++||+|||+|+|.++||||||+|+|.++|++|.||+
T Consensus      1108 ~rLlel~~~~~~A~q~rki~~a~eknp~Da~~l~yd~~n~f~iC~~t~~Piy~g~p~~~cp~cga~y~~~~~g~iCtvc~ 1187 (1202)
T KOG0292|consen 1108 RRLLELAPSPPVAEQARKIKQAAEKNPTDAYELNYDPHNPFVICGATYVPIYRGRPDVSCPYCGACFVPSSKGNICTVCD 1187 (1202)
T ss_pred             HHHHhhCCCChHHHHHHHHHHHhhcCcccccccCcccCCCeeEecccceeeecCCCCcCCCcccceeccccCCceeeeee
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeecCCCcccCcceec
Q psy2693          81 VSVIDTHRNAYGLQICA   97 (122)
Q Consensus        81 ls~IG~~~~a~GLr~~~   97 (122)
                      |++||  ++++||||++
T Consensus      1188 V~~ig--~~~~Glris~ 1202 (1202)
T KOG0292|consen 1188 VGVIG--ADASGLRISA 1202 (1202)
T ss_pred             eeeec--CcccceeecC
Confidence            99999  9999999964


No 3  
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=92.65  E-value=0.076  Score=35.98  Aligned_cols=20  Identities=20%  Similarity=0.629  Sum_probs=15.8

Q ss_pred             ceeccCCCcceecCCCCceec
Q psy2693          48 YTPIYHGRESEACVYCGASYL   68 (122)
Q Consensus        48 ~tPIY~G~~~v~CP~CgA~Y~   68 (122)
                      |-+| .-+.+|.|||||.+|.
T Consensus        40 ~L~m-g~~gev~CPYC~t~y~   59 (62)
T COG4391          40 FLDM-GDEGEVVCPYCSTRYR   59 (62)
T ss_pred             EEEc-CCCCcEecCccccEEE
Confidence            4444 4588999999999985


No 4  
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.60  E-value=0.1  Score=30.27  Aligned_cols=26  Identities=27%  Similarity=0.523  Sum_probs=21.9

Q ss_pred             eecCCCCceecCCCCCcccCccccee
Q psy2693          58 EACVYCGASYLPKYKGELCAVCTVSV   83 (122)
Q Consensus        58 v~CP~CgA~Y~p~~kG~lC~VC~ls~   83 (122)
                      -.|+.||-.|.++.....|++|+..+
T Consensus         2 ~~C~~CGy~y~~~~~~~~CP~Cg~~~   27 (33)
T cd00350           2 YVCPVCGYIYDGEEAPWVCPVCGAPK   27 (33)
T ss_pred             EECCCCCCEECCCcCCCcCcCCCCcH
Confidence            36999999999988899999998653


No 5  
>PRK12496 hypothetical protein; Provisional
Probab=92.20  E-value=0.091  Score=40.31  Aligned_cols=35  Identities=23%  Similarity=0.660  Sum_probs=26.1

Q ss_pred             ccceecc-CCCcc-----eecCCCCceecCCCCCcccCccc
Q psy2693          46 RSYTPIY-HGRES-----EACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        46 ~S~tPIY-~G~~~-----v~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      ..+.+|. +|-..     ..|+-||..|.-.+.+..|++|+
T Consensus       110 i~v~~~~~~~i~~~~~w~~~C~gC~~~~~~~~~~~~C~~CG  150 (164)
T PRK12496        110 IKFENIKTKGIKKVIKWRKVCKGCKKKYPEDYPDDVCEICG  150 (164)
T ss_pred             CeEeccccccchhheeeeEECCCCCccccCCCCCCcCCCCC
Confidence            3445543 45444     35999999998888899999998


No 6  
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=91.61  E-value=0.13  Score=30.91  Aligned_cols=23  Identities=26%  Similarity=0.713  Sum_probs=19.4

Q ss_pred             ecCCCCceecCCCC----CcccCcccc
Q psy2693          59 ACVYCGASYLPKYK----GELCAVCTV   81 (122)
Q Consensus        59 ~CP~CgA~Y~p~~k----G~lC~VC~l   81 (122)
                      .||-||+.|+-.|+    ..+|.+|+-
T Consensus         3 ~C~~Cg~~Yh~~~~pP~~~~~Cd~cg~   29 (36)
T PF05191_consen    3 ICPKCGRIYHIEFNPPKVEGVCDNCGG   29 (36)
T ss_dssp             EETTTTEEEETTTB--SSTTBCTTTTE
T ss_pred             CcCCCCCccccccCCCCCCCccCCCCC
Confidence            69999999998776    488988874


No 7  
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=91.35  E-value=0.14  Score=31.64  Aligned_cols=21  Identities=29%  Similarity=0.757  Sum_probs=14.0

Q ss_pred             ceeccCCCcceecCCCCceec
Q psy2693          48 YTPIYHGRESEACVYCGASYL   68 (122)
Q Consensus        48 ~tPIY~G~~~v~CP~CgA~Y~   68 (122)
                      |=+|-+....+.|||||..|.
T Consensus        20 yl~l~~~~~~~~CpYCg~~yv   40 (40)
T PF10276_consen   20 YLNLDDEPGPVVCPYCGTRYV   40 (40)
T ss_dssp             EEE-TTTTCEEEETTTTEEEE
T ss_pred             EEecCCCCCeEECCCCCCEEC
Confidence            334433345799999999984


No 8  
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=90.26  E-value=0.13  Score=28.05  Aligned_cols=20  Identities=30%  Similarity=0.780  Sum_probs=16.6

Q ss_pred             ecCCCCceecCCCCCcccCccc
Q psy2693          59 ACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        59 ~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      .||.||+...+.  .+.|+.|+
T Consensus         1 ~Cp~CG~~~~~~--~~fC~~CG   20 (23)
T PF13240_consen    1 YCPNCGAEIEDD--AKFCPNCG   20 (23)
T ss_pred             CCcccCCCCCCc--CcchhhhC
Confidence            489999999876  78898886


No 9  
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=90.00  E-value=0.17  Score=33.28  Aligned_cols=28  Identities=25%  Similarity=0.711  Sum_probs=21.5

Q ss_pred             eeeecccceeccCCCcceecCCCCceecCCC
Q psy2693          41 FQICARSYTPIYHGRESEACVYCGASYLPKY   71 (122)
Q Consensus        41 F~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~   71 (122)
                      =.+|...|+|   |.+.|.||-|||.||-+-
T Consensus         8 C~~Cg~~~~~---~dDiVvCp~CgapyHR~C   35 (54)
T PF14446_consen    8 CPVCGKKFKD---GDDIVVCPECGAPYHRDC   35 (54)
T ss_pred             ChhhCCcccC---CCCEEECCCCCCcccHHH
Confidence            3456665554   789999999999999763


No 10 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=88.81  E-value=0.21  Score=30.17  Aligned_cols=23  Identities=30%  Similarity=0.866  Sum_probs=15.3

Q ss_pred             ecCCCCceec--CCCCCc-ccCcccc
Q psy2693          59 ACVYCGASYL--PKYKGE-LCAVCTV   81 (122)
Q Consensus        59 ~CP~CgA~Y~--p~~kG~-lC~VC~l   81 (122)
                      +||.||+++.  ....|+ +|+.|+.
T Consensus         2 ~Cp~Cg~~~~~~D~~~g~~vC~~CG~   27 (43)
T PF08271_consen    2 KCPNCGSKEIVFDPERGELVCPNCGL   27 (43)
T ss_dssp             SBTTTSSSEEEEETTTTEEEETTT-B
T ss_pred             CCcCCcCCceEEcCCCCeEECCCCCC
Confidence            6999999762  233454 8999863


No 11 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=87.31  E-value=0.55  Score=28.63  Aligned_cols=12  Identities=42%  Similarity=0.955  Sum_probs=7.3

Q ss_pred             ceecCCCCceec
Q psy2693          57 SEACVYCGASYL   68 (122)
Q Consensus        57 ~v~CP~CgA~Y~   68 (122)
                      ..+||+||+...
T Consensus        21 ~~~Cp~CG~~~~   32 (46)
T PRK00398         21 GVRCPYCGYRIL   32 (46)
T ss_pred             ceECCCCCCeEE
Confidence            566666666554


No 12 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=87.25  E-value=0.5  Score=27.77  Aligned_cols=25  Identities=24%  Similarity=0.477  Sum_probs=16.6

Q ss_pred             eecCCCCceecCCCCCcccCcccce
Q psy2693          58 EACVYCGASYLPKYKGELCAVCTVS   82 (122)
Q Consensus        58 v~CP~CgA~Y~p~~kG~lC~VC~ls   82 (122)
                      -.|+.||-.|.-+..-..|++|+..
T Consensus         3 ~~C~~CG~i~~g~~~p~~CP~Cg~~   27 (34)
T cd00729           3 WVCPVCGYIHEGEEAPEKCPICGAP   27 (34)
T ss_pred             EECCCCCCEeECCcCCCcCcCCCCc
Confidence            4677777777655555677777653


No 13 
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=86.50  E-value=2  Score=37.72  Aligned_cols=73  Identities=15%  Similarity=0.138  Sum_probs=42.7

Q ss_pred             cCCChHHHHH----HHHHHHHHhcCCCCceeecCCCCCCeeeecccceeccCCCcceecCCCCceecCCCC---------
Q psy2693           6 KFQIIPVATQ----ARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKYK---------   72 (122)
Q Consensus         6 l~p~~~va~q----ArKIl~~ce~~~tDa~eIdYD~~npF~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~k---------   72 (122)
                      ..|..+..++    +|++.++-.+.|-++...+=+-..+-..    .+| -......+|+.||-.|.|+.-         
T Consensus       375 ~~P~ee~~~~~~~~g~~la~~~~~~~~~~~~~~~~~~~~~~~----~~~-~~~~~~~~c~~c~~~yd~~~g~~~~~~~~g  449 (479)
T PRK05452        375 WRPDQDALELCREHGREIARQWALAPLPQSTVNTVVKEETSA----TTT-ADLGPRMQCSVCQWIYDPAKGEPMQDVAPG  449 (479)
T ss_pred             ecCCHHHHHHHHHHHHHHHHHHhhCCcccccccccccccccc----ccc-cCCCCeEEECCCCeEECCCCCCcccCCCCC
Confidence            4455444433    5666655545555544333331111111    444 256788899999999999841         


Q ss_pred             --------CcccCccccee
Q psy2693          73 --------GELCAVCTVSV   83 (122)
Q Consensus        73 --------G~lC~VC~ls~   83 (122)
                              .-.||+|+.++
T Consensus       450 t~~~~lp~~~~cp~c~~~k  468 (479)
T PRK05452        450 TPWSEVPDNFLCPECSLGK  468 (479)
T ss_pred             CChhhCCCCCcCcCCCCcH
Confidence                    13899998765


No 14 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=86.18  E-value=0.37  Score=26.63  Aligned_cols=22  Identities=32%  Similarity=0.786  Sum_probs=17.3

Q ss_pred             eecCCCCceecCCCCCcccCcccc
Q psy2693          58 EACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus        58 v~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      +.||.||+...++  -+.|+.|+-
T Consensus         3 ~~Cp~Cg~~~~~~--~~fC~~CG~   24 (26)
T PF13248_consen    3 MFCPNCGAEIDPD--AKFCPNCGA   24 (26)
T ss_pred             CCCcccCCcCCcc--cccChhhCC
Confidence            5799999976666  678888874


No 15 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=86.12  E-value=0.57  Score=29.69  Aligned_cols=26  Identities=31%  Similarity=0.667  Sum_probs=18.3

Q ss_pred             eecCCCCceecCCCCC-----------------cccCccccee
Q psy2693          58 EACVYCGASYLPKYKG-----------------ELCAVCTVSV   83 (122)
Q Consensus        58 v~CP~CgA~Y~p~~kG-----------------~lC~VC~ls~   83 (122)
                      .+|+.||-.|.|+.-.                 =.|++|+.++
T Consensus         2 y~C~~CgyvYd~~~Gd~~~~i~pGt~F~~Lp~~w~CP~C~a~K   44 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKGDPENGIPPGTPFEDLPDDWVCPVCGAPK   44 (47)
T ss_dssp             EEETTTSBEEETTTBBGGGTB-TT--GGGS-TT-B-TTTSSBG
T ss_pred             cCCCCCCEEEcCCcCCcccCcCCCCCHHHCCCCCcCcCCCCcc
Confidence            4789999999988632                 1788888765


No 16 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=85.08  E-value=0.52  Score=35.93  Aligned_cols=33  Identities=21%  Similarity=0.449  Sum_probs=26.4

Q ss_pred             eeeecccceeccC-CCcceecCCCCceecCCCCC
Q psy2693          41 FQICARSYTPIYH-GRESEACVYCGASYLPKYKG   73 (122)
Q Consensus        41 F~ICa~S~tPIY~-G~~~v~CP~CgA~Y~p~~kG   73 (122)
                      ..+|..+=+.-|- ++..+.|||||+.|.+++..
T Consensus         9 Kr~Cp~cg~kFYDLnk~p~vcP~cg~~~~~~~~~   42 (129)
T TIGR02300         9 KRICPNTGSKFYDLNRRPAVSPYTGEQFPPEEAL   42 (129)
T ss_pred             cccCCCcCccccccCCCCccCCCcCCccCcchhh
Confidence            4577777777775 78899999999999998543


No 17 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=84.84  E-value=0.51  Score=34.42  Aligned_cols=30  Identities=20%  Similarity=0.625  Sum_probs=22.1

Q ss_pred             eeeecccceeccC-CCcceecCCCCceecCC
Q psy2693          41 FQICARSYTPIYH-GRESEACVYCGASYLPK   70 (122)
Q Consensus        41 F~ICa~S~tPIY~-G~~~v~CP~CgA~Y~p~   70 (122)
                      -.+|..+=+.-|- ++..+.|||||+.|.++
T Consensus         9 KR~Cp~CG~kFYDLnk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen    9 KRTCPSCGAKFYDLNKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             cccCCCCcchhccCCCCCccCCCCCCccCcc
Confidence            3456666666664 55668899999999998


No 18 
>PRK00420 hypothetical protein; Validated
Probab=80.61  E-value=0.96  Score=33.46  Aligned_cols=27  Identities=26%  Similarity=0.485  Sum_probs=16.5

Q ss_pred             eecCCCCceecC-CCCCcccCcccceee
Q psy2693          58 EACVYCGASYLP-KYKGELCAVCTVSVI   84 (122)
Q Consensus        58 v~CP~CgA~Y~p-~~kG~lC~VC~ls~I   84 (122)
                      ..||.||+...- +---..|++|+-..+
T Consensus        24 ~~CP~Cg~pLf~lk~g~~~Cp~Cg~~~~   51 (112)
T PRK00420         24 KHCPVCGLPLFELKDGEVVCPVHGKVYI   51 (112)
T ss_pred             CCCCCCCCcceecCCCceECCCCCCeee
Confidence            467777776665 333346777776544


No 19 
>PF13901 DUF4206:  Domain of unknown function (DUF4206)
Probab=78.85  E-value=1.5  Score=34.43  Aligned_cols=38  Identities=18%  Similarity=0.557  Sum_probs=29.5

Q ss_pred             eeecccceeccC-C-CcceecCCCCceecCCC-CCcccCccc
Q psy2693          42 QICARSYTPIYH-G-RESEACVYCGASYLPKY-KGELCAVCT   80 (122)
Q Consensus        42 ~ICa~S~tPIY~-G-~~~v~CP~CgA~Y~p~~-kG~lC~VC~   80 (122)
                      ++|..+ .+||+ . +..++|+-|+|.||.+- ...-|+-|.
T Consensus       156 e~C~~~-~~IfPF~~~~~~~C~~C~~v~H~~C~~~~~CpkC~  196 (202)
T PF13901_consen  156 EICNSD-DIIFPFQIDTTVRCPKCKSVFHKSCFRKKSCPKCA  196 (202)
T ss_pred             ccCCCC-CCCCCCCCCCeeeCCcCccccchhhcCCCCCCCcH
Confidence            578777 99997 3 48999999999999764 334677764


No 20 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=78.70  E-value=0.83  Score=25.10  Aligned_cols=15  Identities=33%  Similarity=0.815  Sum_probs=12.5

Q ss_pred             cceecCCCCceecCC
Q psy2693          56 ESEACVYCGASYLPK   70 (122)
Q Consensus        56 ~~v~CP~CgA~Y~p~   70 (122)
                      +.+.||+||-+|.|+
T Consensus         1 ~l~~C~~CgR~F~~~   15 (25)
T PF13913_consen    1 ELVPCPICGRKFNPD   15 (25)
T ss_pred             CCCcCCCCCCEECHH
Confidence            357899999999875


No 21 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=78.34  E-value=1.6  Score=27.17  Aligned_cols=23  Identities=26%  Similarity=0.602  Sum_probs=15.8

Q ss_pred             ecccceeccCCCcceecCCCCceec
Q psy2693          44 CARSYTPIYHGRESEACVYCGASYL   68 (122)
Q Consensus        44 Ca~S~tPIY~G~~~v~CP~CgA~Y~   68 (122)
                      |...++.  .....++||+||.+.+
T Consensus         8 Cg~~~~~--~~~~~irC~~CG~rIl   30 (44)
T smart00659        8 CGRENEI--KSKDVVRCRECGYRIL   30 (44)
T ss_pred             CCCEeec--CCCCceECCCCCceEE
Confidence            4444443  2467899999999876


No 22 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=78.24  E-value=1.4  Score=28.50  Aligned_cols=26  Identities=31%  Similarity=0.622  Sum_probs=16.6

Q ss_pred             ecccceeccCCCcceecCCCCceecCC
Q psy2693          44 CARSYTPIYHGRESEACVYCGASYLPK   70 (122)
Q Consensus        44 Ca~S~tPIY~G~~~v~CP~CgA~Y~p~   70 (122)
                      |...+.-+ ...+.++|||||.+.+-+
T Consensus        12 Cg~~~~~~-~~~~~irCp~Cg~rIl~K   37 (49)
T COG1996          12 CGREVELD-QETRGIRCPYCGSRILVK   37 (49)
T ss_pred             cCCeeehh-hccCceeCCCCCcEEEEe
Confidence            44444322 356778999999887644


No 23 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=75.94  E-value=1.5  Score=33.46  Aligned_cols=55  Identities=18%  Similarity=0.372  Sum_probs=34.8

Q ss_pred             eecCCCCceecCCCCCc-ccCcccceeecCCCcccC----cceecccchhhhhhccchhhh
Q psy2693          58 EACVYCGASYLPKYKGE-LCAVCTVSVIDTHRNAYG----LQICAGLMKSDVINNIDSSLA  113 (122)
Q Consensus        58 v~CP~CgA~Y~p~~kG~-lC~VC~ls~IG~~~~a~G----Lr~~~~~~~~~~~~~~~~~~~  113 (122)
                      ..||-||...+- +.|+ .|+||+..+.+.-.+.-+    ........++.+..+++....
T Consensus        29 ~hCp~Cg~PLF~-KdG~v~CPvC~~~~~~v~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (131)
T COG1645          29 KHCPKCGTPLFR-KDGEVFCPVCGYREVVVEEEEEEVEAEVQEQLRRSRPELPDDSDELKK   88 (131)
T ss_pred             hhCcccCCccee-eCCeEECCCCCceEEEeecccccchhhhhcchhhcccccccchhhhhc
Confidence            479999999998 5565 699999666651112222    244445666666666665543


No 24 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=75.67  E-value=1.9  Score=32.08  Aligned_cols=24  Identities=33%  Similarity=0.725  Sum_probs=21.0

Q ss_pred             eecCCCCcee--cCCCCCcccCcccceeec
Q psy2693          58 EACVYCGASY--LPKYKGELCAVCTVSVID   85 (122)
Q Consensus        58 v~CP~CgA~Y--~p~~kG~lC~VC~ls~IG   85 (122)
                      ..||-|+|+|  +|    ..|+||+|.-|-
T Consensus         2 Y~CPrC~skvC~LP----~~CpiCgLtLVs   27 (112)
T TIGR00622         2 YFCPQCRAKVCELP----VECPICGLTLIL   27 (112)
T ss_pred             ccCCCCCCCccCCC----CcCCcCCCEEec
Confidence            3699999999  77    589999999886


No 25 
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=74.12  E-value=1.7  Score=27.38  Aligned_cols=11  Identities=27%  Similarity=1.078  Sum_probs=7.5

Q ss_pred             eecCCCCceec
Q psy2693          58 EACVYCGASYL   68 (122)
Q Consensus        58 v~CP~CgA~Y~   68 (122)
                      .-|||||+.-.
T Consensus         4 kPCPFCG~~~~   14 (61)
T PF14354_consen    4 KPCPFCGSADV   14 (61)
T ss_pred             cCCCCCCCcce
Confidence            34999996543


No 26 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=73.78  E-value=2.6  Score=31.31  Aligned_cols=27  Identities=22%  Similarity=0.472  Sum_probs=16.2

Q ss_pred             CCcceecCCCCceecCC-------CCC-cccCccc
Q psy2693          54 GRESEACVYCGASYLPK-------YKG-ELCAVCT   80 (122)
Q Consensus        54 G~~~v~CP~CgA~Y~p~-------~kG-~lC~VC~   80 (122)
                      +.....||-||.+|...       ..| =.|+.|+
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~~d~~~~f~Cp~Cg  130 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQLLDMDGTFTCPRCG  130 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHhcCCCCcEECCCCC
Confidence            45667777777777541       112 4577775


No 27 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=73.57  E-value=2.6  Score=26.91  Aligned_cols=12  Identities=42%  Similarity=0.941  Sum_probs=9.3

Q ss_pred             ecCCCCceecCC
Q psy2693          59 ACVYCGASYLPK   70 (122)
Q Consensus        59 ~CP~CgA~Y~p~   70 (122)
                      +|..||-.|.|+
T Consensus         3 ~C~~CgyiYd~~   14 (50)
T cd00730           3 ECRICGYIYDPA   14 (50)
T ss_pred             CCCCCCeEECCC
Confidence            678888888876


No 28 
>PF14369 zf-RING_3:  zinc-finger
Probab=71.17  E-value=3.1  Score=24.68  Aligned_cols=27  Identities=19%  Similarity=0.383  Sum_probs=17.5

Q ss_pred             ecccceeccCCCcceecCCCCceecCC
Q psy2693          44 CARSYTPIYHGRESEACVYCGASYLPK   70 (122)
Q Consensus        44 Ca~S~tPIY~G~~~v~CP~CgA~Y~p~   70 (122)
                      |.++..+--.+.+.+.||.|+.-++-+
T Consensus         8 C~~~V~~~~~~~~~~~CP~C~~gFvEe   34 (35)
T PF14369_consen    8 CNRFVRIAPSPDSDVACPRCHGGFVEE   34 (35)
T ss_pred             CCCEeEeCcCCCCCcCCcCCCCcEeEe
Confidence            444555433456667899999877643


No 29 
>PRK00566 DNA-directed RNA polymerase subunit beta'; Provisional
Probab=70.54  E-value=4.5  Score=40.06  Aligned_cols=63  Identities=29%  Similarity=0.595  Sum_probs=46.1

Q ss_pred             HHHHHHHHhcCCCCceeecCCCCCC---eeeecccceeccCCCcceecCCCCceecCCCCCcccCccccee
Q psy2693          16 ARKLLAICNANPTDEHTIDYDEHNP---FQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTVSV   83 (122)
Q Consensus        16 ArKIl~~ce~~~tDa~eIdYD~~np---F~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC~ls~   83 (122)
                      ..+|.+.+--.=+..-.|||.-+.|   =-.|..=|.|+    ....| .||.....+|+|.+|.-|++-.
T Consensus        17 pe~I~~ws~GeV~~petinyrt~kPe~~GLfcerIFgp~----kd~eC-~Cgkyk~~~~~~~~C~~cgve~   82 (1156)
T PRK00566         17 PEKIRSWSYGEVKKPETINYRTLKPERDGLFCERIFGPT----KDYEC-LCGKYKRVRYKGIICERCGVEV   82 (1156)
T ss_pred             HHHHHHhhcceEccccccccCCCccCCCCcccchhcCcc----cCcEE-eCccccccCcCCcCCCCCCcee
Confidence            3456666655556777899976654   33788888885    45788 9997666889999999997643


No 30 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=69.47  E-value=2.7  Score=24.23  Aligned_cols=10  Identities=30%  Similarity=0.787  Sum_probs=5.2

Q ss_pred             cceecCCCCc
Q psy2693          56 ESEACVYCGA   65 (122)
Q Consensus        56 ~~v~CP~CgA   65 (122)
                      +.+.||.||+
T Consensus        25 ~~~~CP~Cg~   34 (41)
T smart00834       25 PLATCPECGG   34 (41)
T ss_pred             CCCCCCCCCC
Confidence            3445555555


No 31 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=69.24  E-value=4.1  Score=29.48  Aligned_cols=31  Identities=19%  Similarity=0.295  Sum_probs=19.7

Q ss_pred             cCCCcceecCCCCceecC----C-CCCcccCcccce
Q psy2693          52 YHGRESEACVYCGASYLP----K-YKGELCAVCTVS   82 (122)
Q Consensus        52 Y~G~~~v~CP~CgA~Y~p----~-~kG~lC~VC~ls   82 (122)
                      ++-...+.||+||+.-++    + -.-..|++|+..
T Consensus        16 ~klpt~f~CP~Cge~~v~v~~~k~~~h~~C~~CG~y   51 (99)
T PRK14892         16 PKLPKIFECPRCGKVSISVKIKKNIAIITCGNCGLY   51 (99)
T ss_pred             cCCCcEeECCCCCCeEeeeecCCCcceEECCCCCCc
Confidence            344567899999975553    0 113568888765


No 32 
>TIGR03847 conserved hypothetical protein. The conserved hypothetical protein described here occurs as part of the trio of uncharacterized proteins common in the Actinobacteria.
Probab=69.16  E-value=2.7  Score=33.59  Aligned_cols=18  Identities=33%  Similarity=0.942  Sum_probs=16.5

Q ss_pred             ecCCCCceecCCCCCcccCc
Q psy2693          59 ACVYCGASYLPKYKGELCAV   78 (122)
Q Consensus        59 ~CP~CgA~Y~p~~kG~lC~V   78 (122)
                      .||+||....|+  |.+|+-
T Consensus       158 ~CPlCg~PldP~--GH~Cpr  175 (177)
T TIGR03847       158 PCPLCGRPIDPD--GHICPR  175 (177)
T ss_pred             CCCCCCCCCCCC--CccCCC
Confidence            599999999999  999974


No 33 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=69.04  E-value=3.4  Score=22.48  Aligned_cols=16  Identities=38%  Similarity=0.949  Sum_probs=13.4

Q ss_pred             CCCcceecCCCCceec
Q psy2693          53 HGRESEACVYCGASYL   68 (122)
Q Consensus        53 ~G~~~v~CP~CgA~Y~   68 (122)
                      .|+....||+|+.+|.
T Consensus        10 ~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen   10 TGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             SSSSSEEESSSSEEES
T ss_pred             CCCCCCCCCCCcCeeC
Confidence            4778899999998874


No 34 
>PF12660 zf-TFIIIC:  Putative zinc-finger of transcription factor IIIC complex;  InterPro: IPR024764 This zinc-finger domain is at the very C terminus of a number of different TFIIIC subunit proteins. This domain might be involved in protein-DNA and/or protein-protein interactions [].; PDB: 2J04_C.
Probab=68.32  E-value=3.6  Score=29.19  Aligned_cols=31  Identities=26%  Similarity=0.543  Sum_probs=17.7

Q ss_pred             CCeeeecccceeccCCCcceecCCCCceecCC
Q psy2693          39 NPFQICARSYTPIYHGRESEACVYCGASYLPK   70 (122)
Q Consensus        39 npF~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~   70 (122)
                      .-|.-|+.||-||- .-..-.|+.||.+|+..
T Consensus        38 H~w~RC~lT~l~i~-~~~~r~C~~C~~~~l~~   68 (99)
T PF12660_consen   38 HVWPRCALTFLPIQ-TPGVRVCPVCGRRALDP   68 (99)
T ss_dssp             -EEEB-SSS-SBS--SS-EEE-TTT--EEE-G
T ss_pred             CEEeeeeeeeeeec-cCCeeEcCCCCCEEecC
Confidence            45999999999995 33337899999988754


No 35 
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=68.20  E-value=2.5  Score=27.38  Aligned_cols=11  Identities=36%  Similarity=0.896  Sum_probs=8.9

Q ss_pred             eecCCCCceec
Q psy2693          58 EACVYCGASYL   68 (122)
Q Consensus        58 v~CP~CgA~Y~   68 (122)
                      +.|||||....
T Consensus         1 i~CPyCge~~~   11 (52)
T PF14255_consen    1 IQCPYCGEPIE   11 (52)
T ss_pred             CCCCCCCCeeE
Confidence            57999998764


No 36 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=68.11  E-value=2.9  Score=23.44  Aligned_cols=21  Identities=29%  Similarity=0.751  Sum_probs=14.7

Q ss_pred             ecCCCCceecCCCCCcccCcccc
Q psy2693          59 ACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus        59 ~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      +||-|++...-.  -+.|+.|+.
T Consensus         2 ~CP~C~~~V~~~--~~~Cp~CG~   22 (26)
T PF10571_consen    2 TCPECGAEVPES--AKFCPHCGY   22 (26)
T ss_pred             cCCCCcCCchhh--cCcCCCCCC
Confidence            578888877544  567777764


No 37 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=67.97  E-value=4  Score=29.51  Aligned_cols=29  Identities=17%  Similarity=0.314  Sum_probs=23.8

Q ss_pred             CcceecCCCCceecCCCCCcccCccccee
Q psy2693          55 RESEACVYCGASYLPKYKGELCAVCTVSV   83 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~p~~kG~lC~VC~ls~   83 (122)
                      ....+|+-||..|.+......||.|+-..
T Consensus        68 p~~~~C~~Cg~~~~~~~~~~~CP~Cgs~~   96 (115)
T TIGR00100        68 PVECECEDCSEEVSPEIDLYRCPKCHGIM   96 (115)
T ss_pred             CcEEEcccCCCEEecCCcCccCcCCcCCC
Confidence            45689999999999976678899999544


No 38 
>PF12773 DZR:  Double zinc ribbon
Probab=67.08  E-value=4.4  Score=24.50  Aligned_cols=25  Identities=28%  Similarity=0.796  Sum_probs=16.1

Q ss_pred             CCcceecCCCCceecCCCCCcccCccc
Q psy2693          54 GRESEACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        54 G~~~v~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      ....+.||.||+...+.  -+.|+.|+
T Consensus        26 ~~~~~~C~~Cg~~~~~~--~~fC~~CG   50 (50)
T PF12773_consen   26 DQSKKICPNCGAENPPN--AKFCPNCG   50 (50)
T ss_pred             cCCCCCCcCCcCCCcCC--cCccCccc
Confidence            34556777777776555  56666664


No 39 
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=66.84  E-value=2  Score=30.90  Aligned_cols=30  Identities=20%  Similarity=0.454  Sum_probs=21.7

Q ss_pred             CcceecCCCCceecCCCCCcccCcccceee
Q psy2693          55 RESEACVYCGASYLPKYKGELCAVCTVSVI   84 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~p~~kG~lC~VC~ls~I   84 (122)
                      ...++|.-||..|.++.....||.|+=..+
T Consensus        68 p~~~~C~~Cg~~~~~~~~~~~CP~Cgs~~~   97 (113)
T PF01155_consen   68 PARARCRDCGHEFEPDEFDFSCPRCGSPDV   97 (113)
T ss_dssp             --EEEETTTS-EEECHHCCHH-SSSSSS-E
T ss_pred             CCcEECCCCCCEEecCCCCCCCcCCcCCCc
Confidence            356899999999999888888999986654


No 40 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=66.56  E-value=4.8  Score=29.07  Aligned_cols=28  Identities=14%  Similarity=0.262  Sum_probs=22.5

Q ss_pred             CcceecCCCCceecCCCCCcccCcccce
Q psy2693          55 RESEACVYCGASYLPKYKGELCAVCTVS   82 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~p~~kG~lC~VC~ls   82 (122)
                      ....+|+-||..+.++...-.||.|+-.
T Consensus        68 p~~~~C~~Cg~~~~~~~~~~~CP~Cgs~   95 (113)
T PRK12380         68 PAQAWCWDCSQVVEIHQHDAQCPHCHGE   95 (113)
T ss_pred             CcEEEcccCCCEEecCCcCccCcCCCCC
Confidence            4578999999999987556669999943


No 41 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=65.70  E-value=3  Score=26.04  Aligned_cols=10  Identities=50%  Similarity=1.148  Sum_probs=8.3

Q ss_pred             ceecCCCCce
Q psy2693          57 SEACVYCGAS   66 (122)
Q Consensus        57 ~v~CP~CgA~   66 (122)
                      +..|||||..
T Consensus         2 ~f~CP~C~~~   11 (54)
T PF05605_consen    2 SFTCPYCGKG   11 (54)
T ss_pred             CcCCCCCCCc
Confidence            5689999993


No 42 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=64.33  E-value=5.9  Score=35.03  Aligned_cols=38  Identities=24%  Similarity=0.408  Sum_probs=26.7

Q ss_pred             ecccceeccCCCcceecCCCCceecCCCCCcccCcccceeec
Q psy2693          44 CARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTVSVID   85 (122)
Q Consensus        44 Ca~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC~ls~IG   85 (122)
                      |..++|- ++.+...+|.|||..+...   ..|+.|+-..+-
T Consensus       228 C~~~l~~-h~~~~~l~Ch~Cg~~~~~~---~~Cp~C~s~~l~  265 (505)
T TIGR00595       228 CDVSLTY-HKKEGKLRCHYCGYQEPIP---KTCPQCGSEDLV  265 (505)
T ss_pred             CCCceEE-ecCCCeEEcCCCcCcCCCC---CCCCCCCCCeeE
Confidence            3445554 3567789999999777643   589999866554


No 43 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=64.32  E-value=4  Score=24.92  Aligned_cols=9  Identities=33%  Similarity=0.892  Sum_probs=4.2

Q ss_pred             ceecCCCCc
Q psy2693          57 SEACVYCGA   65 (122)
Q Consensus        57 ~v~CP~CgA   65 (122)
                      .+.||.||+
T Consensus        26 ~~~CP~Cg~   34 (52)
T TIGR02605        26 LATCPECGG   34 (52)
T ss_pred             CCCCCCCCC
Confidence            344555554


No 44 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=64.29  E-value=3.1  Score=24.26  Aligned_cols=22  Identities=27%  Similarity=0.717  Sum_probs=8.5

Q ss_pred             ecCCCCceec-CCCCCcccCccc
Q psy2693          59 ACVYCGASYL-PKYKGELCAVCT   80 (122)
Q Consensus        59 ~CP~CgA~Y~-p~~kG~lC~VC~   80 (122)
                      +||.||+.|. .+-.--+|+-|.
T Consensus         4 ~Cp~C~se~~y~D~~~~vCp~C~   26 (30)
T PF08274_consen    4 KCPLCGSEYTYEDGELLVCPECG   26 (30)
T ss_dssp             --TTT-----EE-SSSEEETTTT
T ss_pred             CCCCCCCcceeccCCEEeCCccc
Confidence            6889988775 443445666664


No 45 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=64.02  E-value=4.5  Score=24.96  Aligned_cols=23  Identities=30%  Similarity=0.790  Sum_probs=14.5

Q ss_pred             eecCCCCceecCCCCC-cccCccc
Q psy2693          58 EACVYCGASYLPKYKG-ELCAVCT   80 (122)
Q Consensus        58 v~CP~CgA~Y~p~~kG-~lC~VC~   80 (122)
                      ..||-||........| .+|++|+
T Consensus        18 ~~Cp~C~~PL~~~k~g~~~Cv~C~   41 (41)
T PF06677_consen   18 EHCPDCGTPLMRDKDGKIYCVSCG   41 (41)
T ss_pred             CccCCCCCeeEEecCCCEECCCCC
Confidence            4677888777763333 4576664


No 46 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=63.65  E-value=4.3  Score=23.91  Aligned_cols=23  Identities=26%  Similarity=0.561  Sum_probs=13.6

Q ss_pred             ceeccCCCcceecCCCCceecCC
Q psy2693          48 YTPIYHGRESEACVYCGASYLPK   70 (122)
Q Consensus        48 ~tPIY~G~~~v~CP~CgA~Y~p~   70 (122)
                      |+++..+...++|-||+..+.-.
T Consensus         7 F~~~~~~~~~a~C~~C~~~~~~~   29 (45)
T PF02892_consen    7 FTKIPGDKKKAKCKYCGKVIKYS   29 (45)
T ss_dssp             CEE--GCSS-EEETTTTEE----
T ss_pred             EEEccCCcCeEEeCCCCeEEeeC
Confidence            45555789999999999988754


No 47 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=62.83  E-value=5.1  Score=25.47  Aligned_cols=26  Identities=19%  Similarity=0.442  Sum_probs=20.1

Q ss_pred             eecCCCCc-eecCCCCCcccCccccee
Q psy2693          58 EACVYCGA-SYLPKYKGELCAVCTVSV   83 (122)
Q Consensus        58 v~CP~CgA-~Y~p~~kG~lC~VC~ls~   83 (122)
                      ..||-||+ -..+....-.|.-|+..+
T Consensus        21 ~fCP~Cg~~~m~~~~~r~~C~~Cgyt~   47 (50)
T PRK00432         21 KFCPRCGSGFMAEHLDRWHCGKCGYTE   47 (50)
T ss_pred             CcCcCCCcchheccCCcEECCCcCCEE
Confidence            48999999 566666677899988764


No 48 
>PF11290 DUF3090:  Protein of unknown function (DUF3090);  InterPro: IPR021441  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=62.64  E-value=4.2  Score=32.28  Aligned_cols=16  Identities=38%  Similarity=1.136  Sum_probs=14.8

Q ss_pred             ecCCCCceecCCCCCccc
Q psy2693          59 ACVYCGASYLPKYKGELC   76 (122)
Q Consensus        59 ~CP~CgA~Y~p~~kG~lC   76 (122)
                      .||+||....|+  |.+|
T Consensus       156 ~CPlCg~PlDP~--GH~C  171 (171)
T PF11290_consen  156 PCPLCGEPLDPE--GHIC  171 (171)
T ss_pred             CCCCCCCCCCCC--CCcC
Confidence            599999999999  9988


No 49 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=62.23  E-value=5.2  Score=23.50  Aligned_cols=15  Identities=27%  Similarity=0.547  Sum_probs=10.7

Q ss_pred             CCcceecCCCCceec
Q psy2693          54 GRESEACVYCGASYL   68 (122)
Q Consensus        54 G~~~v~CP~CgA~Y~   68 (122)
                      ..+.++||+||.+.+
T Consensus        14 ~~~~irC~~CG~RIl   28 (32)
T PF03604_consen   14 PGDPIRCPECGHRIL   28 (32)
T ss_dssp             TSSTSSBSSSS-SEE
T ss_pred             CCCcEECCcCCCeEE
Confidence            356789999998754


No 50 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=61.52  E-value=7.3  Score=24.91  Aligned_cols=27  Identities=22%  Similarity=0.444  Sum_probs=19.2

Q ss_pred             cceecCCCCceecC--CCCCcccCcccce
Q psy2693          56 ESEACVYCGASYLP--KYKGELCAVCTVS   82 (122)
Q Consensus        56 ~~v~CP~CgA~Y~p--~~kG~lC~VC~ls   82 (122)
                      .+-.||.||.....  ....-.|+.|+..
T Consensus        27 TSq~C~~CG~~~~~~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   27 TSQTCPRCGHRNKKRRSGRVFTCPNCGFE   55 (69)
T ss_pred             CccCccCcccccccccccceEEcCCCCCE
Confidence            45668888887776  6666678887765


No 51 
>PRK12495 hypothetical protein; Provisional
Probab=60.86  E-value=4.7  Score=33.34  Aligned_cols=23  Identities=26%  Similarity=0.801  Sum_probs=16.9

Q ss_pred             ceecCCCCceecCCCCCcc-cCccc
Q psy2693          57 SEACVYCGASYLPKYKGEL-CAVCT   80 (122)
Q Consensus        57 ~v~CP~CgA~Y~p~~kG~l-C~VC~   80 (122)
                      ...|+.||.... .+.|.+ |++|+
T Consensus        42 a~hC~~CG~PIp-a~pG~~~Cp~CQ   65 (226)
T PRK12495         42 NAHCDECGDPIF-RHDGQEFCPTCQ   65 (226)
T ss_pred             hhhcccccCccc-CCCCeeECCCCC
Confidence            456888888766 667765 88887


No 52 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=60.03  E-value=5.1  Score=19.69  Aligned_cols=11  Identities=36%  Similarity=0.969  Sum_probs=6.8

Q ss_pred             ecCCCCceecC
Q psy2693          59 ACVYCGASYLP   69 (122)
Q Consensus        59 ~CP~CgA~Y~p   69 (122)
                      .|++||..|..
T Consensus         2 ~C~~C~~~~~~   12 (24)
T PF13894_consen    2 QCPICGKSFRS   12 (24)
T ss_dssp             E-SSTS-EESS
T ss_pred             CCcCCCCcCCc
Confidence            68999888753


No 53 
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=60.01  E-value=6.3  Score=27.46  Aligned_cols=28  Identities=25%  Similarity=0.450  Sum_probs=21.0

Q ss_pred             eecCCCCceecCCCC---CcccCcccceeec
Q psy2693          58 EACVYCGASYLPKYK---GELCAVCTVSVID   85 (122)
Q Consensus        58 v~CP~CgA~Y~p~~k---G~lC~VC~ls~IG   85 (122)
                      +.||-||-.-+++-.   -.+|+||.---=|
T Consensus         2 ~~CPCCg~~Tl~~~~~~~ydIC~VC~WEdD~   32 (78)
T PF14206_consen    2 YPCPCCGYYTLEERGEGTYDICPVCFWEDDG   32 (78)
T ss_pred             ccCCCCCcEEeccCCCcCceECCCCCcccCC
Confidence            579999999887653   3599999765444


No 54 
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=57.93  E-value=3.1  Score=34.29  Aligned_cols=25  Identities=24%  Similarity=0.541  Sum_probs=18.6

Q ss_pred             eecccceecc--------CCCcceecCCCCcee
Q psy2693          43 ICARSYTPIY--------HGRESEACVYCGASY   67 (122)
Q Consensus        43 ICa~S~tPIY--------~G~~~v~CP~CgA~Y   67 (122)
                      +|++=+--|+        ++.+.|+||+||+..
T Consensus       199 ~C~GC~m~l~~~~~~~V~~~d~iv~CP~CgRIL  231 (239)
T COG1579         199 VCGGCHMKLPSQTLSKVRKKDEIVFCPYCGRIL  231 (239)
T ss_pred             cccCCeeeecHHHHHHHhcCCCCccCCccchHH
Confidence            6766555544        578999999999853


No 55 
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=57.68  E-value=8.5  Score=25.31  Aligned_cols=26  Identities=31%  Similarity=0.682  Sum_probs=20.9

Q ss_pred             cceecCCCCceecCCCCCcccCcccceeec
Q psy2693          56 ESEACVYCGASYLPKYKGELCAVCTVSVID   85 (122)
Q Consensus        56 ~~v~CP~CgA~Y~p~~kG~lC~VC~ls~IG   85 (122)
                      ...+|+-||...+    ...|++|+....-
T Consensus         4 ~mr~C~~CgvYTL----k~~CP~CG~~t~~   29 (56)
T PRK13130          4 KIRKCPKCGVYTL----KEICPVCGGKTKN   29 (56)
T ss_pred             cceECCCCCCEEc----cccCcCCCCCCCC
Confidence            4568999999999    6789999876555


No 56 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=57.63  E-value=7.3  Score=30.56  Aligned_cols=13  Identities=46%  Similarity=1.050  Sum_probs=7.4

Q ss_pred             CCcceecCCCCce
Q psy2693          54 GRESEACVYCGAS   66 (122)
Q Consensus        54 G~~~v~CP~CgA~   66 (122)
                      |.+...||.|||.
T Consensus       146 ge~P~~CPiCga~  158 (166)
T COG1592         146 GEAPEVCPICGAP  158 (166)
T ss_pred             CCCCCcCCCCCCh
Confidence            3555666666653


No 57 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=57.47  E-value=6.9  Score=39.37  Aligned_cols=44  Identities=25%  Similarity=0.522  Sum_probs=24.0

Q ss_pred             cCCCCceeecCCCCCCeeeecccceeccCCCcceecCCCCceecCCCCCcccCcccc
Q psy2693          25 ANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus        25 ~~~tDa~eIdYD~~npF~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      +.+.-++++.      +..|..==++++.    ..||.||+...|.|   .|+.|+.
T Consensus       657 ~~G~ieVEV~------~rkCPkCG~~t~~----~fCP~CGs~te~vy---~CPsCGa  700 (1337)
T PRK14714        657 EGGVIEVEVG------RRRCPSCGTETYE----NRCPDCGTHTEPVY---VCPDCGA  700 (1337)
T ss_pred             cCCeEEEEEE------EEECCCCCCcccc----ccCcccCCcCCCce---eCccCCC
Confidence            4444445554      4556554444432    27777777765554   5666655


No 58 
>PRK10246 exonuclease subunit SbcC; Provisional
Probab=57.04  E-value=4.6  Score=38.68  Aligned_cols=15  Identities=27%  Similarity=0.780  Sum_probs=12.2

Q ss_pred             ceecCCCCceecCCC
Q psy2693          57 SEACVYCGASYLPKY   71 (122)
Q Consensus        57 ~v~CP~CgA~Y~p~~   71 (122)
                      -.-||.|||..||.-
T Consensus       503 GePCPVCGS~~HP~~  517 (1047)
T PRK10246        503 GQPCPLCGSTSHPAV  517 (1047)
T ss_pred             CCCcCCCCcccCcCc
Confidence            445999999999954


No 59 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=56.89  E-value=8.5  Score=28.60  Aligned_cols=16  Identities=25%  Similarity=0.526  Sum_probs=12.8

Q ss_pred             CcceecCCCCceecCC
Q psy2693          55 RESEACVYCGASYLPK   70 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~p~   70 (122)
                      .....|+-||..+..+
T Consensus        68 p~~~~C~~CG~~~~~~   83 (135)
T PRK03824         68 EAVLKCRNCGNEWSLK   83 (135)
T ss_pred             ceEEECCCCCCEEecc
Confidence            3678899999888775


No 60 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=56.85  E-value=7.9  Score=22.28  Aligned_cols=12  Identities=25%  Similarity=0.648  Sum_probs=7.7

Q ss_pred             cceecCCCCcee
Q psy2693          56 ESEACVYCGASY   67 (122)
Q Consensus        56 ~~v~CP~CgA~Y   67 (122)
                      ..++||.||..+
T Consensus        24 ~~v~C~~C~~~~   35 (38)
T TIGR02098        24 GKVRCGKCGHVW   35 (38)
T ss_pred             CEEECCCCCCEE
Confidence            367777777654


No 61 
>COG3931 Predicted N-formylglutamate amidohydrolase [Amino acid transport and metabolism]
Probab=56.78  E-value=6.5  Score=33.16  Aligned_cols=67  Identities=24%  Similarity=0.371  Sum_probs=40.1

Q ss_pred             CCCCeeeecccceeccCCCccee-------------cCC-------------CCceecCCCCCcccCcccceeecCCCcc
Q psy2693          37 EHNPFQICARSYTPIYHGRESEA-------------CVY-------------CGASYLPKYKGELCAVCTVSVIDTHRNA   90 (122)
Q Consensus        37 ~~npF~ICa~S~tPIY~G~~~v~-------------CP~-------------CgA~Y~p~~kG~lC~VC~ls~IG~~~~a   90 (122)
                      .+.+|.+---||||+|+|.+.--             .|+             -.-.|.|.-.+.       -.+=.|+.+
T Consensus       142 G~~~~vvsvHSFTPvy~G~~Rpw~iGiL~d~D~R~a~pll~~lr~~~~l~Vg~NEPY~~ad~~~-------~Tl~rH~~~  214 (263)
T COG3931         142 GRAPFVVSVHSFTPVYKGRPRPWHIGILHDNDDRLADPLLAALRANAGLTVGDNEPYDPADRVD-------DTLYRHAIA  214 (263)
T ss_pred             CCCcEEEEEeccCccccCCCCccEEEEeeccchhHHHHHHHHHHhcCCcEeccCCCCCcccccc-------chhhhhhcc
Confidence            35689999999999999976310             000             111223322210       112235677


Q ss_pred             cCcceecccchhhhhhccch
Q psy2693          91 YGLQICAGLMKSDVINNIDS  110 (122)
Q Consensus        91 ~GLr~~~~~~~~~~~~~~~~  110 (122)
                      -|+-....-.|.|.|++-..
T Consensus       215 rG~p~vliEIRnDlIad~~g  234 (263)
T COG3931         215 RGLPHVLIEIRNDLIADEGG  234 (263)
T ss_pred             cCccchhhhhhhhhhcChhH
Confidence            88877778888888876543


No 62 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=56.77  E-value=6.1  Score=26.00  Aligned_cols=26  Identities=23%  Similarity=0.535  Sum_probs=22.6

Q ss_pred             cceecCCCCceecCCCCCcccCcccc
Q psy2693          56 ESEACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus        56 ~~v~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      ...+|+.||-.+.++-..-+|+.|+-
T Consensus         4 ~~~~C~~Cg~~~~~~dDiVvCp~Cga   29 (54)
T PF14446_consen    4 EGCKCPVCGKKFKDGDDIVVCPECGA   29 (54)
T ss_pred             cCccChhhCCcccCCCCEEECCCCCC
Confidence            34689999999999999999999974


No 63 
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=55.19  E-value=12  Score=23.93  Aligned_cols=23  Identities=30%  Similarity=0.807  Sum_probs=18.6

Q ss_pred             cceecCCCCceecCCCCCcccCcccc
Q psy2693          56 ESEACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus        56 ~~v~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      ..+.||-||+.-+|-   .+|+-|+.
T Consensus        25 ~l~~c~~cg~~~~~H---~vc~~cG~   47 (56)
T PF01783_consen   25 NLVKCPNCGEPKLPH---RVCPSCGY   47 (56)
T ss_dssp             SEEESSSSSSEESTT---SBCTTTBB
T ss_pred             ceeeeccCCCEeccc---EeeCCCCe
Confidence            568999999877775   68999964


No 64 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=55.07  E-value=8  Score=30.04  Aligned_cols=28  Identities=18%  Similarity=0.265  Sum_probs=18.8

Q ss_pred             CCcceecCCCCceecCC---CCCcccCcccc
Q psy2693          54 GRESEACVYCGASYLPK---YKGELCAVCTV   81 (122)
Q Consensus        54 G~~~v~CP~CgA~Y~p~---~kG~lC~VC~l   81 (122)
                      ...+..||-||.+|.-.   -.|=.|++|+=
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~~~F~Cp~Cg~  144 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAMEYGFRCPQCGE  144 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhhcCCcCCCCCC
Confidence            45667788888887532   13778888863


No 65 
>PF06943 zf-LSD1:  LSD1 zinc finger;  InterPro: IPR005735 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC []. This domain may play a role in the regulation of transcription, via either repression of a prodeath pathway or activation of an antideath pathway, in response to signals emanating from cells undergoing pathogen-induced hypersensitive cell death. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].
Probab=54.65  E-value=8.4  Score=21.74  Aligned_cols=13  Identities=31%  Similarity=0.708  Sum_probs=11.8

Q ss_pred             CCCcceecCCCCc
Q psy2693          53 HGRESEACVYCGA   65 (122)
Q Consensus        53 ~G~~~v~CP~CgA   65 (122)
                      +|.++|+|+.|.+
T Consensus        12 ~GA~sVrCa~C~~   24 (25)
T PF06943_consen   12 RGAPSVRCACCHT   24 (25)
T ss_pred             CCCCCeECCccCc
Confidence            6999999999975


No 66 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=54.48  E-value=4.8  Score=23.76  Aligned_cols=24  Identities=33%  Similarity=0.692  Sum_probs=18.5

Q ss_pred             ecCCCCceecCCCCCcc---cCcccce
Q psy2693          59 ACVYCGASYLPKYKGEL---CAVCTVS   82 (122)
Q Consensus        59 ~CP~CgA~Y~p~~kG~l---C~VC~ls   82 (122)
                      .||.||.-..|+-....   |+.|+..
T Consensus         3 FCp~C~nlL~p~~~~~~~~~C~~C~Y~   29 (35)
T PF02150_consen    3 FCPECGNLLYPKEDKEKRVACRTCGYE   29 (35)
T ss_dssp             BETTTTSBEEEEEETTTTEEESSSS-E
T ss_pred             eCCCCCccceEcCCCccCcCCCCCCCc
Confidence            58899988888877777   8888754


No 67 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=54.19  E-value=5.8  Score=30.12  Aligned_cols=26  Identities=12%  Similarity=0.098  Sum_probs=13.0

Q ss_pred             CcceecCCCCceecCCC---CCcccCccc
Q psy2693          55 RESEACVYCGASYLPKY---KGELCAVCT   80 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~p~~---kG~lC~VC~   80 (122)
                      ..+..||-|+++|.-.-   .|=.|++|+
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~~~F~Cp~Cg  135 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAMELNFTCPRCG  135 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHHcCCcCCCCC
Confidence            34445555665553211   255666665


No 68 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=53.99  E-value=7.3  Score=29.98  Aligned_cols=34  Identities=18%  Similarity=0.373  Sum_probs=22.5

Q ss_pred             ecCCCCc--------eecCC-CC---CcccCcccceeecCCCcccCcc
Q psy2693          59 ACVYCGA--------SYLPK-YK---GELCAVCTVSVIDTHRNAYGLQ   94 (122)
Q Consensus        59 ~CP~CgA--------~Y~p~-~k---G~lC~VC~ls~IG~~~~a~GLr   94 (122)
                      +|||||.        .|.++ +.   -.-|+-|+-.=.+  .+..++.
T Consensus         2 ~cp~c~~~~~~~~~s~~~~~~~~~~~~~~c~~c~~~f~~--~e~~~~~   47 (154)
T PRK00464          2 RCPFCGHPDTRVIDSRPAEDGNAIRRRRECLACGKRFTT--FERVELV   47 (154)
T ss_pred             cCCCCCCCCCEeEeccccCCCCceeeeeeccccCCcceE--eEeccCc
Confidence            6999995        33333 00   1569999988877  7777663


No 69 
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=53.16  E-value=9.6  Score=28.47  Aligned_cols=24  Identities=29%  Similarity=0.827  Sum_probs=20.8

Q ss_pred             ceecCCCCceecCCCCCcccCcccce
Q psy2693          57 SEACVYCGASYLPKYKGELCAVCTVS   82 (122)
Q Consensus        57 ~v~CP~CgA~Y~p~~kG~lC~VC~ls   82 (122)
                      -.+|+-||..|+|-  -..|+-|+-.
T Consensus        29 g~kC~~CG~v~~PP--r~~Cp~C~~~   52 (140)
T COG1545          29 GTKCKKCGRVYFPP--RAYCPKCGSE   52 (140)
T ss_pred             EEEcCCCCeEEcCC--cccCCCCCCC
Confidence            46899999999998  6889999876


No 70 
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=51.74  E-value=8.2  Score=25.54  Aligned_cols=19  Identities=21%  Similarity=0.768  Sum_probs=15.8

Q ss_pred             cCCCcceecCCCCceecCC
Q psy2693          52 YHGRESEACVYCGASYLPK   70 (122)
Q Consensus        52 Y~G~~~v~CP~CgA~Y~p~   70 (122)
                      +.|+.+--|||||.++.+.
T Consensus        34 f~~~rYngCPfC~~~~~~~   52 (55)
T PF14447_consen   34 FPGERYNGCPFCGTPFEFD   52 (55)
T ss_pred             cChhhccCCCCCCCcccCC
Confidence            4688999999999988754


No 71 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=51.70  E-value=11  Score=22.68  Aligned_cols=24  Identities=29%  Similarity=0.654  Sum_probs=14.4

Q ss_pred             ecCCCCceecCCCC----CcccCcccce
Q psy2693          59 ACVYCGASYLPKYK----GELCAVCTVS   82 (122)
Q Consensus        59 ~CP~CgA~Y~p~~k----G~lC~VC~ls   82 (122)
                      .||.||.-..++-.    --+|+.|+..
T Consensus         2 FCp~Cg~~l~~~~~~~~~~~vC~~Cg~~   29 (52)
T smart00661        2 FCPKCGNMLIPKEGKEKRRFVCRKCGYE   29 (52)
T ss_pred             CCCCCCCccccccCCCCCEEECCcCCCe
Confidence            47777776665532    1357777754


No 72 
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=50.78  E-value=7.5  Score=30.92  Aligned_cols=25  Identities=32%  Similarity=0.729  Sum_probs=16.2

Q ss_pred             cCCCCceecCCCCCcccCcccceeec
Q psy2693          60 CVYCGASYLPKYKGELCAVCTVSVID   85 (122)
Q Consensus        60 CP~CgA~Y~p~~kG~lC~VC~ls~IG   85 (122)
                      ||.||..-.|.+. .+|.-|-+.+.+
T Consensus         1 C~~CG~~~~~~~~-~lC~~C~~~~~~   25 (236)
T PF04981_consen    1 CPRCGREIEPLID-GLCPDCYLKRFD   25 (236)
T ss_pred             CCCCCCCCCCccc-ccChHHhcccCC
Confidence            7777776665543 377777666655


No 73 
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=50.24  E-value=8.1  Score=29.39  Aligned_cols=28  Identities=25%  Similarity=0.370  Sum_probs=22.0

Q ss_pred             eeeecccceeccC-CCcceecCCCCceec
Q psy2693          41 FQICARSYTPIYH-GRESEACVYCGASYL   68 (122)
Q Consensus        41 F~ICa~S~tPIY~-G~~~v~CP~CgA~Y~   68 (122)
                      -.||..+=+..|- .+..+.|||||.+|-
T Consensus         9 KridPetg~KFYDLNrdPiVsPytG~s~P   37 (129)
T COG4530           9 KRIDPETGKKFYDLNRDPIVSPYTGKSYP   37 (129)
T ss_pred             cccCccccchhhccCCCccccCcccccch
Confidence            4577777777775 677889999999993


No 74 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=49.64  E-value=13  Score=22.58  Aligned_cols=14  Identities=36%  Similarity=0.878  Sum_probs=11.8

Q ss_pred             ceecCCCCceecCC
Q psy2693          57 SEACVYCGASYLPK   70 (122)
Q Consensus        57 ~v~CP~CgA~Y~p~   70 (122)
                      .++||.||=.|.|.
T Consensus        13 ~~~C~~CgM~Y~~~   26 (41)
T PF13878_consen   13 ATTCPTCGMLYSPG   26 (41)
T ss_pred             CcCCCCCCCEECCC
Confidence            47999999999875


No 75 
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=49.60  E-value=7.7  Score=29.45  Aligned_cols=21  Identities=24%  Similarity=0.551  Sum_probs=15.0

Q ss_pred             ceecCCCCceec---CCCCCcccC
Q psy2693          57 SEACVYCGASYL---PKYKGELCA   77 (122)
Q Consensus        57 ~v~CP~CgA~Y~---p~~kG~lC~   77 (122)
                      .|.||+|||.+-   .+|-.+.|+
T Consensus       105 ~~~cp~c~s~~t~~~s~fg~t~ck  128 (146)
T TIGR02159       105 SVQCPRCGSADTTITSIFGPTACK  128 (146)
T ss_pred             CCcCCCCCCCCcEeecCCCChhhH
Confidence            599999999864   455555553


No 76 
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=49.42  E-value=7.6  Score=24.33  Aligned_cols=10  Identities=30%  Similarity=1.125  Sum_probs=8.0

Q ss_pred             ecCCCCceec
Q psy2693          59 ACVYCGASYL   68 (122)
Q Consensus        59 ~CP~CgA~Y~   68 (122)
                      -|||||..-.
T Consensus         3 PCPfCGg~~~   12 (53)
T TIGR03655         3 PCPFCGGADV   12 (53)
T ss_pred             CCCCCCCcce
Confidence            5999998655


No 77 
>TIGR02387 rpoC1_cyan DNA-directed RNA polymerase, gamma subunit. The RNA polymerase gamma subunit, encoded by the rpoC1 gene, is found in cyanobacteria and corresponds to the N-terminal region the beta' subunit, encoded by rpoC, in other bacteria. The equivalent subunit in plastids and chloroplasts is designated beta', while the product of the rpoC2 gene is designated beta''.
Probab=49.34  E-value=18  Score=33.87  Aligned_cols=51  Identities=29%  Similarity=0.594  Sum_probs=36.1

Q ss_pred             CCceeecCCCCCC---eeeecccceeccCCCcceecCCCCceecCCCCCcccCccccee
Q psy2693          28 TDEHTIDYDEHNP---FQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTVSV   83 (122)
Q Consensus        28 tDa~eIdYD~~np---F~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC~ls~   83 (122)
                      +...+|||-.+.|   =-.|-.-|-|+.    +-.| .||..-.-+|+|.+|.-|++--
T Consensus        33 ~kp~TinyrT~KPE~dGLFCerIFGP~k----~~eC-~CGkyk~~~~~~~~C~~CgvE~   86 (619)
T TIGR02387        33 TKPETINYRTLKPEMDGLFCEKIFGPSK----DWEC-HCGKYKRVRHRGIVCERCGVEV   86 (619)
T ss_pred             CCCcccccCCCCCCCCCEeechhcCCCc----CcEE-eCCCccccCcCCcCCCCCCCEE
Confidence            4556889865544   347888888864    4567 8995333578999999997543


No 78 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=49.05  E-value=13  Score=34.48  Aligned_cols=64  Identities=16%  Similarity=0.235  Sum_probs=41.3

Q ss_pred             HHHHHHHHHHHHhcCCCCceeecCCCCCCeeee------------cccceeccCCCcceecCCCCceecCCCCCcccCcc
Q psy2693          12 VATQARKLLAICNANPTDEHTIDYDEHNPFQIC------------ARSYTPIYHGRESEACVYCGASYLPKYKGELCAVC   79 (122)
Q Consensus        12 va~qArKIl~~ce~~~tDa~eIdYD~~npF~IC------------a~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC   79 (122)
                      ..+..++.|+   ++ .==+.+|-.-+.||..|            ..++|- .+++...+|.|||...    ....|+.|
T Consensus       358 l~~~i~~~L~---~g-qvll~lnRrGyap~l~C~~Cg~~~~C~~C~~~L~~-h~~~~~l~Ch~CG~~~----~p~~Cp~C  428 (665)
T PRK14873        358 AFRAARDALE---HG-PVLVQVPRRGYVPSLACARCRTPARCRHCTGPLGL-PSAGGTPRCRWCGRAA----PDWRCPRC  428 (665)
T ss_pred             HHHHHHHHHh---cC-cEEEEecCCCCCCeeEhhhCcCeeECCCCCCceeE-ecCCCeeECCCCcCCC----cCccCCCC
Confidence            3344444443   33 33456677778888765            445553 3567789999999753    26799999


Q ss_pred             cceee
Q psy2693          80 TVSVI   84 (122)
Q Consensus        80 ~ls~I   84 (122)
                      +=..+
T Consensus       429 gs~~l  433 (665)
T PRK14873        429 GSDRL  433 (665)
T ss_pred             cCCcc
Confidence            86544


No 79 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=49.03  E-value=12  Score=27.16  Aligned_cols=29  Identities=17%  Similarity=0.384  Sum_probs=21.3

Q ss_pred             CcceecCCCCceecCCCCCcc-cCccccee
Q psy2693          55 RESEACVYCGASYLPKYKGEL-CAVCTVSV   83 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~p~~kG~l-C~VC~ls~   83 (122)
                      ....+|.-||..+.+...+.. ||-|+=..
T Consensus        69 p~~~~C~~Cg~~~~~~~~~~~~CP~Cgs~~   98 (117)
T PRK00564         69 KVELECKDCSHVFKPNALDYGVCEKCHSKN   98 (117)
T ss_pred             CCEEEhhhCCCccccCCccCCcCcCCCCCc
Confidence            467899999988887643444 99998443


No 80 
>PRK02625 rpoC1 DNA-directed RNA polymerase subunit gamma; Provisional
Probab=48.51  E-value=19  Score=33.72  Aligned_cols=49  Identities=29%  Similarity=0.594  Sum_probs=35.4

Q ss_pred             CCceeecCCCCCC---eeeecccceeccCCCcceecCCCCceecCCCCCcccCcccc
Q psy2693          28 TDEHTIDYDEHNP---FQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus        28 tDa~eIdYD~~np---F~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      +...+|||-.+.|   =-.|-.-|-|+.    +-.| .||..-.-+|+|.+|.-|++
T Consensus        40 ~kpeTinyrT~KPE~dGLFCerIFGP~k----~~eC-~CGkyk~~~~~~~~C~~Cgv   91 (627)
T PRK02625         40 TKPETINYRTLKPEMDGLFCEKIFGPSK----DWEC-HCGKYKRVRHRGIVCERCGV   91 (627)
T ss_pred             CCCcccccCCCCCCCCCEeechhcCCcc----CcEE-eCCCccccCcCCcCCCCCCc
Confidence            4556889876544   347888888874    4567 78853335789999999987


No 81 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=48.25  E-value=11  Score=22.10  Aligned_cols=15  Identities=33%  Similarity=1.114  Sum_probs=11.1

Q ss_pred             CCCcceecCCCCcee
Q psy2693          53 HGRESEACVYCGASY   67 (122)
Q Consensus        53 ~G~~~v~CP~CgA~Y   67 (122)
                      +-+....|++||++|
T Consensus        17 ~~~~~~~C~~Cg~~~   31 (33)
T PF08792_consen   17 KEDDYEVCIFCGSSF   31 (33)
T ss_pred             ecCCeEEcccCCcEe
Confidence            666777788888776


No 82 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=46.51  E-value=10  Score=19.18  Aligned_cols=11  Identities=36%  Similarity=0.966  Sum_probs=8.8

Q ss_pred             ecCCCCceecC
Q psy2693          59 ACVYCGASYLP   69 (122)
Q Consensus        59 ~CP~CgA~Y~p   69 (122)
                      +||.||..|..
T Consensus         2 ~C~~C~~~f~~   12 (23)
T PF00096_consen    2 KCPICGKSFSS   12 (23)
T ss_dssp             EETTTTEEESS
T ss_pred             CCCCCCCccCC
Confidence            68999988864


No 83 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=46.42  E-value=10  Score=22.72  Aligned_cols=11  Identities=18%  Similarity=0.489  Sum_probs=9.2

Q ss_pred             ceecCCCCcee
Q psy2693          57 SEACVYCGASY   67 (122)
Q Consensus        57 ~v~CP~CgA~Y   67 (122)
                      .|.||+|++.-
T Consensus         5 ~v~CP~C~s~~   15 (36)
T PF03811_consen    5 DVHCPRCQSTE   15 (36)
T ss_pred             eeeCCCCCCCC
Confidence            58999999875


No 84 
>PRK05580 primosome assembly protein PriA; Validated
Probab=46.41  E-value=16  Score=33.57  Aligned_cols=50  Identities=16%  Similarity=0.276  Sum_probs=30.7

Q ss_pred             eecCCCCCCeeeecccceec-----------cCCCcceecCCCCceecCCCCCcccCcccceee
Q psy2693          32 TIDYDEHNPFQICARSYTPI-----------YHGRESEACVYCGASYLPKYKGELCAVCTVSVI   84 (122)
Q Consensus        32 eIdYD~~npF~ICa~S~tPI-----------Y~G~~~v~CP~CgA~Y~p~~kG~lC~VC~ls~I   84 (122)
                      -++=..+.+|..|..==..+           .+.+....|.|||..+...   ..|+.|+=..+
T Consensus       372 ~~nrrGy~~~~~C~~Cg~~~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~---~~Cp~Cg~~~l  432 (679)
T PRK05580        372 FLNRRGYAPFLLCRDCGWVAECPHCDASLTLHRFQRRLRCHHCGYQEPIP---KACPECGSTDL  432 (679)
T ss_pred             EEcCCCCCCceEhhhCcCccCCCCCCCceeEECCCCeEECCCCcCCCCCC---CCCCCCcCCee
Confidence            44445556666654322221           2467778999999776543   47999966544


No 85 
>PRK00133 metG methionyl-tRNA synthetase; Reviewed
Probab=46.25  E-value=30  Score=31.56  Aligned_cols=63  Identities=17%  Similarity=0.294  Sum_probs=33.6

Q ss_pred             hHHHHHHHHHHHHHhcCCCCceeecCCCCCCeeeeccccee-ccCCCcceecCCCCceecCCCCCcccCcccc
Q psy2693          10 IPVATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTP-IYHGRESEACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus        10 ~~va~qArKIl~~ce~~~tDa~eIdYD~~npF~ICa~S~tP-IY~G~~~v~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      +.-.+.++.+++....++ ..++-+|+  ..|.+-+.+|-| -|   =.-.||+||+.   +..|..|..|+-
T Consensus        97 ~~h~~~v~~~~~~L~~~G-~iy~~~~~--~~y~~~~~~~l~~~~---v~g~cp~C~~~---d~~g~~ce~cg~  160 (673)
T PRK00133         97 EENRELAQEIYLKLKENG-YIYEKTIE--QLYDPEKGMFLPDRF---VKGTCPKCGAE---DQYGDNCEVCGA  160 (673)
T ss_pred             HHHHHHHHHHHHHHHHCC-CEEEeeeE--EEEeCCCCCCccchh---eecccCCCCCc---ccCCchhhhccc
Confidence            344556777777666654 23333332  124444444443 22   11259999986   345777877764


No 86 
>PF14353 CpXC:  CpXC protein
Probab=45.79  E-value=12  Score=26.65  Aligned_cols=15  Identities=33%  Similarity=0.749  Sum_probs=12.9

Q ss_pred             ceecCCCCceecCCC
Q psy2693          57 SEACVYCGASYLPKY   71 (122)
Q Consensus        57 ~v~CP~CgA~Y~p~~   71 (122)
                      .++||.||+.+..+|
T Consensus        38 ~~~CP~Cg~~~~~~~   52 (128)
T PF14353_consen   38 SFTCPSCGHKFRLEY   52 (128)
T ss_pred             EEECCCCCCceecCC
Confidence            689999999987766


No 87 
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=45.75  E-value=14  Score=24.12  Aligned_cols=22  Identities=32%  Similarity=0.810  Sum_probs=15.0

Q ss_pred             cceecCCCCceecCCCCCcccCccc
Q psy2693          56 ESEACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        56 ~~v~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      ..+.||-||+.-.|   -.+|+.|+
T Consensus        26 ~l~~C~~CG~~~~~---H~vC~~CG   47 (57)
T PRK12286         26 GLVECPNCGEPKLP---HRVCPSCG   47 (57)
T ss_pred             cceECCCCCCccCC---eEECCCCC
Confidence            44677777776666   46777776


No 88 
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=45.56  E-value=18  Score=28.67  Aligned_cols=52  Identities=15%  Similarity=0.338  Sum_probs=34.0

Q ss_pred             hHHHHHHHHHHHHHhcCCCCceeecCCCCCCeeeecccceeccCC---CcceecCCCCcee
Q psy2693          10 IPVATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHG---RESEACVYCGASY   67 (122)
Q Consensus        10 ~~va~qArKIl~~ce~~~tDa~eIdYD~~npF~ICa~S~tPIY~G---~~~v~CP~CgA~Y   67 (122)
                      .....+.++++.+..+.      +.|+..|+|-+|.....+---.   .---.||-||+..
T Consensus        88 ~~l~~~~~~~le~Lk~~------le~~~~~~~y~C~~~~~r~sfdeA~~~~F~Cp~Cg~~L  142 (176)
T COG1675          88 EVLKGKKRKILEKLKRK------LEKETENNYYVCPNCHVKYSFDEAMELGFTCPKCGEDL  142 (176)
T ss_pred             HHHHHHHHHHHHHHHHH------HHhhccCCceeCCCCCCcccHHHHHHhCCCCCCCCchh
Confidence            34456788888888765      6777788899997776663111   1225677776643


No 89 
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=44.15  E-value=21  Score=20.74  Aligned_cols=14  Identities=29%  Similarity=0.672  Sum_probs=12.3

Q ss_pred             CCCcceecCCCCce
Q psy2693          53 HGRESEACVYCGAS   66 (122)
Q Consensus        53 ~G~~~v~CP~CgA~   66 (122)
                      +|.++++|+.|.+.
T Consensus        15 ~gA~~vrCs~C~~v   28 (31)
T TIGR01053        15 RGASSVRCALCQTV   28 (31)
T ss_pred             CCCCeEECCCCCeE
Confidence            69999999999864


No 90 
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=43.99  E-value=11  Score=27.37  Aligned_cols=32  Identities=28%  Similarity=0.771  Sum_probs=20.7

Q ss_pred             ceecCCCCceec---------CCC-CC---cccCcccceeecCCCc
Q psy2693          57 SEACVYCGASYL---------PKY-KG---ELCAVCTVSVIDTHRN   89 (122)
Q Consensus        57 ~v~CP~CgA~Y~---------p~~-kG---~lC~VC~ls~IG~~~~   89 (122)
                      .+.|||||....         -.+ .+   -+|+-|+ +-||.|..
T Consensus         2 p~~CpYCg~~~~l~~~~~iYg~~~~~~~~~y~C~~C~-AyVG~H~~   46 (102)
T PF11672_consen    2 PIICPYCGGPAELVDGSEIYGHRYDDGPYLYVCTPCD-AYVGCHPG   46 (102)
T ss_pred             CcccCCCCCeeEEcccchhcCccCCCCceeEECCCCC-ceeeeeCC
Confidence            478999997532         122 11   4799988 56886663


No 91 
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=43.76  E-value=15  Score=23.71  Aligned_cols=24  Identities=29%  Similarity=0.710  Sum_probs=17.6

Q ss_pred             CcceecCCCCceecCCCCCcccCcccc
Q psy2693          55 RESEACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      ...+.||-||+..+|-   .+|+.|+.
T Consensus        24 p~l~~C~~cG~~~~~H---~vc~~cG~   47 (55)
T TIGR01031        24 PTLVVCPNCGEFKLPH---RVCPSCGY   47 (55)
T ss_pred             CcceECCCCCCcccCe---eECCccCe
Confidence            3557899999876664   68888873


No 92 
>COG3809 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=42.79  E-value=14  Score=26.62  Aligned_cols=18  Identities=28%  Similarity=0.658  Sum_probs=11.8

Q ss_pred             cccCcccceeecCCCcccCc
Q psy2693          74 ELCAVCTVSVIDTHRNAYGL   93 (122)
Q Consensus        74 ~lC~VC~ls~IG~~~~a~GL   93 (122)
                      .+|++|+++-+-  ...+|.
T Consensus         2 llCP~C~v~l~~--~~rs~v   19 (88)
T COG3809           2 LLCPICGVELVM--SVRSGV   19 (88)
T ss_pred             cccCcCCceeee--eeecCc
Confidence            467777777666  555555


No 93 
>PF01430 HSP33:  Hsp33 protein;  InterPro: IPR000397 Hsp33 is a molecular chaperone, distinguished from all other known chaperones by its mode of functional regulation. Its activity is redox regulated. Hsp33 is a cytoplasmically localized protein with highly reactive cysteines that respond quickly to changes in the redox environment. Oxidizing conditions like H2O2 cause disulphide bonds to form in Hsp33, a process that leads to the activation of its chaperone function [].; GO: 0051082 unfolded protein binding, 0006457 protein folding, 0005737 cytoplasm; PDB: 1VZY_B 1VQ0_A 1I7F_A 3M7M_X 1XJH_A 1HW7_A.
Probab=42.36  E-value=11  Score=30.83  Aligned_cols=16  Identities=31%  Similarity=0.933  Sum_probs=10.9

Q ss_pred             CCCcceecCCCCceec
Q psy2693          53 HGRESEACVYCGASYL   68 (122)
Q Consensus        53 ~G~~~v~CP~CgA~Y~   68 (122)
                      .|.-.+.|.|||.+|+
T Consensus       262 ~~~iev~C~fC~~~Y~  277 (280)
T PF01430_consen  262 NGKIEVTCEFCGKKYR  277 (280)
T ss_dssp             CSEEEEE-TTT--EEE
T ss_pred             CCCEEEEeeCCCCEEE
Confidence            3778899999999996


No 94 
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=42.10  E-value=20  Score=25.85  Aligned_cols=28  Identities=14%  Similarity=0.226  Sum_probs=20.3

Q ss_pred             CcceecCCCCceecCCCCC-cccCcccce
Q psy2693          55 RESEACVYCGASYLPKYKG-ELCAVCTVS   82 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~p~~kG-~lC~VC~ls   82 (122)
                      ....+|+-||..|...... ..||.|+=.
T Consensus        68 p~~~~C~~Cg~~~~~~~~~~~~CP~Cgs~   96 (114)
T PRK03681         68 EAECWCETCQQYVTLLTQRVRRCPQCHGD   96 (114)
T ss_pred             CcEEEcccCCCeeecCCccCCcCcCcCCC
Confidence            4578999999888764333 569999843


No 95 
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=41.65  E-value=15  Score=25.41  Aligned_cols=22  Identities=32%  Similarity=0.718  Sum_probs=11.2

Q ss_pred             cCCCCceecCCCCCcccCcccc
Q psy2693          60 CVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus        60 CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      ||.||+-..|+-.--.|+.|+-
T Consensus         3 C~~Cg~~l~~~~~~~~C~~C~~   24 (104)
T TIGR01384         3 CPKCGSLMTPKNGVYVCPSCGY   24 (104)
T ss_pred             CcccCcccccCCCeEECcCCCC
Confidence            5555555555433344555553


No 96 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=41.63  E-value=13  Score=28.70  Aligned_cols=24  Identities=25%  Similarity=0.487  Sum_probs=16.2

Q ss_pred             CcceecCCCCceecCCCCCcccCcccc
Q psy2693          55 RESEACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      -.+..||.||.   .+-.--.|+.|+.
T Consensus       307 ~tS~~C~~cg~---~~~r~~~C~~cg~  330 (364)
T COG0675         307 YTSKTCPCCGH---LSGRLFKCPRCGF  330 (364)
T ss_pred             CCcccccccCC---ccceeEECCCCCC
Confidence            45688999999   2222236999986


No 97 
>PHA00159 endonuclease I
Probab=41.58  E-value=26  Score=27.38  Aligned_cols=34  Identities=24%  Similarity=0.357  Sum_probs=26.7

Q ss_pred             HHHHHHHHhcCCCCceeecCCCCCCeeeecccceeccCCCcce
Q psy2693          16 ARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESE   58 (122)
Q Consensus        16 ArKIl~~ce~~~tDa~eIdYD~~npF~ICa~S~tPIY~G~~~v   58 (122)
                      =+|++.+.||.|.=.+.+-|         ..|.++||+|++..
T Consensus        75 R~K~lli~eQ~P~ldiR~VF---------s~s~~klyKgSkTt  108 (148)
T PHA00159         75 RKKHLLIREQYPELDIRFVF---------SSSRTKLYKGSPTS  108 (148)
T ss_pred             HHHHHHHHHHCCCccEEEEE---------ecCCchhhcCCCCc
Confidence            47999999999876555544         56889999998864


No 98 
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=41.57  E-value=8.7  Score=37.25  Aligned_cols=63  Identities=22%  Similarity=0.384  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHHHHHhcCC-CCceeecCC------CCCCeeee--cccce-eccCCCcceecCCCCceecCCCCCcccCcc
Q psy2693          10 IPVATQARKLLAICNANP-TDEHTIDYD------EHNPFQIC--ARSYT-PIYHGRESEACVYCGASYLPKYKGELCAVC   79 (122)
Q Consensus        10 ~~va~qArKIl~~ce~~~-tDa~eIdYD------~~npF~IC--a~S~t-PIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC   79 (122)
                      ++.--..|-|..+++... +..++|-.-      ....+..|  |.+.| |+|      .||-||..+.++    .|+-|
T Consensus       629 G~~GG~~R~i~~A~~~~~g~i~vei~~r~Cp~Cg~~t~~~~Cp~CG~~T~~~~------~Cp~C~~~~~~~----~C~~C  698 (900)
T PF03833_consen  629 GEAGGSRRDIQKAAKKGKGTIEVEIGRRRCPKCGKETFYNRCPECGSHTEPVY------VCPDCGIEVEED----ECPKC  698 (900)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             cccCcccccHHHHHhcCCCeeEEeeecccCcccCCcchhhcCcccCCccccce------eccccccccCcc----ccccc
Confidence            443445677777777554 566666431      11234444  34443 232      566666555544    56666


Q ss_pred             cce
Q psy2693          80 TVS   82 (122)
Q Consensus        80 ~ls   82 (122)
                      +.-
T Consensus       699 ~~~  701 (900)
T PF03833_consen  699 GRE  701 (900)
T ss_dssp             ---
T ss_pred             ccc
Confidence            544


No 99 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=41.26  E-value=14  Score=28.98  Aligned_cols=24  Identities=25%  Similarity=0.560  Sum_probs=20.9

Q ss_pred             ceecCCCCceecCCCCCcccCcccc
Q psy2693          57 SEACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus        57 ~v~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      ...||.||-...- -.-..||||+-
T Consensus       134 ~~vC~vCGy~~~g-e~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYTHEG-EAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCcccC-CCCCcCCCCCC
Confidence            6799999999887 67889999984


No 100
>COG1281 Disulfide bond chaperones of the HSP33 family [Posttranslational modification, protein turnover, chaperones]
Probab=40.99  E-value=13  Score=31.48  Aligned_cols=17  Identities=35%  Similarity=0.856  Sum_probs=14.9

Q ss_pred             CCCcceecCCCCceecC
Q psy2693          53 HGRESEACVYCGASYLP   69 (122)
Q Consensus        53 ~G~~~v~CP~CgA~Y~p   69 (122)
                      .|.-.+.|.|||.+|+=
T Consensus       262 dg~iev~C~FC~~~Y~f  278 (286)
T COG1281         262 DGGIEVTCEFCGTKYLF  278 (286)
T ss_pred             CCCeEEEeeccCCEEec
Confidence            47889999999999973


No 101
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=40.77  E-value=16  Score=21.44  Aligned_cols=12  Identities=17%  Similarity=0.506  Sum_probs=10.2

Q ss_pred             eecCCCCceecC
Q psy2693          58 EACVYCGASYLP   69 (122)
Q Consensus        58 v~CP~CgA~Y~p   69 (122)
                      ++||-|++.|.-
T Consensus         3 i~CP~C~~~f~v   14 (37)
T PF13719_consen    3 ITCPNCQTRFRV   14 (37)
T ss_pred             EECCCCCceEEc
Confidence            689999999973


No 102
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=40.51  E-value=17  Score=30.05  Aligned_cols=27  Identities=30%  Similarity=0.600  Sum_probs=17.6

Q ss_pred             CcceecCCCCce---ecCCCCCcccCcccc
Q psy2693          55 RESEACVYCGAS---YLPKYKGELCAVCTV   81 (122)
Q Consensus        55 ~~~v~CP~CgA~---Y~p~~kG~lC~VC~l   81 (122)
                      .....||.||+.   +..+---.+|.-|++
T Consensus         9 ~~~~~Cp~Cg~~~iv~d~~~Ge~vC~~CG~   38 (310)
T PRK00423          9 EEKLVCPECGSDKLIYDYERGEIVCADCGL   38 (310)
T ss_pred             ccCCcCcCCCCCCeeEECCCCeEeecccCC
Confidence            444679999872   233334568888887


No 103
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=40.34  E-value=18  Score=22.19  Aligned_cols=17  Identities=29%  Similarity=0.862  Sum_probs=14.3

Q ss_pred             CCCcceecCCCCceecC
Q psy2693          53 HGRESEACVYCGASYLP   69 (122)
Q Consensus        53 ~G~~~v~CP~CgA~Y~p   69 (122)
                      .|.+.+.|-+|+..|.-
T Consensus        14 ~g~~~a~C~~C~~~l~~   30 (50)
T smart00614       14 NGKQRAKCKYCGKKLSR   30 (50)
T ss_pred             CCCeEEEecCCCCEeee
Confidence            46689999999999963


No 104
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=40.33  E-value=10  Score=23.81  Aligned_cols=17  Identities=35%  Similarity=0.593  Sum_probs=13.4

Q ss_pred             eccCCCcceecCCCCce
Q psy2693          50 PIYHGRESEACVYCGAS   66 (122)
Q Consensus        50 PIY~G~~~v~CP~CgA~   66 (122)
                      -|.++.+.+.||.||.-
T Consensus        39 ~i~~~~~i~~Cp~CgRi   55 (56)
T PF02591_consen   39 EIRKGDEIVFCPNCGRI   55 (56)
T ss_pred             HHHcCCCeEECcCCCcc
Confidence            34467899999999963


No 105
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=39.91  E-value=13  Score=22.80  Aligned_cols=10  Identities=30%  Similarity=0.727  Sum_probs=7.6

Q ss_pred             ecCCCCceec
Q psy2693          59 ACVYCGASYL   68 (122)
Q Consensus        59 ~CP~CgA~Y~   68 (122)
                      +||.||++..
T Consensus         1 ~CP~Cg~~a~   10 (47)
T PF04606_consen    1 RCPHCGSKAR   10 (47)
T ss_pred             CcCCCCCeeE
Confidence            4899998754


No 106
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=39.71  E-value=8.5  Score=24.00  Aligned_cols=13  Identities=23%  Similarity=0.580  Sum_probs=7.0

Q ss_pred             ecCCCCceecCCC
Q psy2693          59 ACVYCGASYLPKY   71 (122)
Q Consensus        59 ~CP~CgA~Y~p~~   71 (122)
                      .||+||..+.++.
T Consensus        22 ~CPlC~r~l~~e~   34 (54)
T PF04423_consen   22 CCPLCGRPLDEEH   34 (54)
T ss_dssp             E-TTT--EE-HHH
T ss_pred             cCCCCCCCCCHHH
Confidence            8999999887653


No 107
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=39.14  E-value=18  Score=20.83  Aligned_cols=22  Identities=27%  Similarity=0.774  Sum_probs=12.7

Q ss_pred             eecCCCCceecCCCCCcccCcccc
Q psy2693          58 EACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus        58 v~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      -+|+-||..+.|-  -..|+-|+-
T Consensus        12 ~rC~~Cg~~~~pP--r~~Cp~C~s   33 (37)
T PF12172_consen   12 QRCRDCGRVQFPP--RPVCPHCGS   33 (37)
T ss_dssp             EE-TTT--EEES----SEETTTT-
T ss_pred             EEcCCCCCEecCC--CcCCCCcCc
Confidence            4788899888877  478888863


No 108
>COG1110 Reverse gyrase [DNA replication, recombination, and repair]
Probab=39.06  E-value=11  Score=37.43  Aligned_cols=38  Identities=21%  Similarity=0.656  Sum_probs=30.4

Q ss_pred             eecccceeccCCCcceecCCCCceecCCCCCcccCcccceee
Q psy2693          43 ICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTVSVI   84 (122)
Q Consensus        43 ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC~ls~I   84 (122)
                      .-...|.|+|  ..--+|--||..|.-.  ...||.|+=-.|
T Consensus       682 ~~~~~~vPvY--~tIKrC~dcg~q~~~~--~~~cP~Cgs~~v  719 (1187)
T COG1110         682 VKDGKYVPVY--DTIKRCRDCGEQFVDS--EDKCPRCGSRNV  719 (1187)
T ss_pred             ccCCceEehH--HHHHHHhhcCceeccc--cccCCCCCCccc
Confidence            3445699999  7777899999999988  449999986554


No 109
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=38.79  E-value=18  Score=28.85  Aligned_cols=24  Identities=17%  Similarity=0.511  Sum_probs=19.1

Q ss_pred             CcceecCCCCceecCCCCCcccCccc
Q psy2693          55 RESEACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      .-..+|-=|+..|.  +.+..|++|+
T Consensus       137 ~w~~rC~GC~~~f~--~~~~~Cp~CG  160 (177)
T COG1439         137 KWRLRCHGCKRIFP--EPKDFCPICG  160 (177)
T ss_pred             eeeEEEecCceecC--CCCCcCCCCC
Confidence            44567889998888  6688999996


No 110
>CHL00018 rpoC1 RNA polymerase beta' subunit
Probab=38.73  E-value=42  Score=31.69  Aligned_cols=51  Identities=33%  Similarity=0.651  Sum_probs=35.7

Q ss_pred             CCceeecCCCCCC---eeeecccceeccCCCcceecCCCCceec-CC---CCCcccCcccceee
Q psy2693          28 TDEHTIDYDEHNP---FQICARSYTPIYHGRESEACVYCGASYL-PK---YKGELCAVCTVSVI   84 (122)
Q Consensus        28 tDa~eIdYD~~np---F~ICa~S~tPIY~G~~~v~CP~CgA~Y~-p~---~kG~lC~VC~ls~I   84 (122)
                      +...+|||-.+.|   =-.|-.=|-|+.    +-.| .||. |. -+   |+|.+|.-|++--.
T Consensus        38 ~kp~TinyrT~KPE~dGLFCErIFGP~k----~~~C-~CGk-yk~~~~~~~~~~~C~~CgVE~t   95 (663)
T CHL00018         38 TKPYTIHYKTNKPEKDGLFCERIFGPIK----SGIC-ACGN-YRVIGDEKEDPKFCEQCGVEFT   95 (663)
T ss_pred             CCCccccccCCCCCCCCEeechhcCCCc----CCEE-eCCC-ccccCccccCCCccCCcCCEec
Confidence            5666899975544   347888888864    3467 7884 44 33   89999999977544


No 111
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=38.32  E-value=13  Score=24.66  Aligned_cols=23  Identities=26%  Similarity=0.798  Sum_probs=16.9

Q ss_pred             cceecCCCCceecCCCCCcccC-ccc
Q psy2693          56 ESEACVYCGASYLPKYKGELCA-VCT   80 (122)
Q Consensus        56 ~~v~CP~CgA~Y~p~~kG~lC~-VC~   80 (122)
                      |.-.||+||....|+  -..|+ .|+
T Consensus         2 ~HkHC~~CG~~Ip~~--~~fCS~~C~   25 (59)
T PF09889_consen    2 PHKHCPVCGKPIPPD--ESFCSPKCR   25 (59)
T ss_pred             CCCcCCcCCCcCCcc--hhhhCHHHH
Confidence            455799999988887  66774 553


No 112
>cd00498 Hsp33 Heat shock protein 33 (Hsp33):  Cytosolic protein that acts as a molecular chaperone under oxidative conditions.  In normal (reducing) cytosolic conditions, four conserved Cys residues are coordinated by a Zn ion.  Under oxidative stress (such as heat shock), the Cys are reversibly oxidized to disulfide bonds, which causes the chaperone activity to be turned on.  Hsp33 is homodimeric in its functional form.
Probab=38.12  E-value=16  Score=29.81  Aligned_cols=15  Identities=33%  Similarity=0.902  Sum_probs=13.2

Q ss_pred             CCcceecCCCCceec
Q psy2693          54 GRESEACVYCGASYL   68 (122)
Q Consensus        54 G~~~v~CP~CgA~Y~   68 (122)
                      |.-.+.|.|||.+|.
T Consensus       259 g~iev~C~FC~~~Y~  273 (275)
T cd00498         259 GGIEVTCEFCGEKYH  273 (275)
T ss_pred             CCEEEEEeCCCCEEe
Confidence            567899999999996


No 113
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=37.86  E-value=18  Score=30.36  Aligned_cols=25  Identities=24%  Similarity=0.489  Sum_probs=20.2

Q ss_pred             eecCCCCce---ecCCCCCcccCcccce
Q psy2693          58 EACVYCGAS---YLPKYKGELCAVCTVS   82 (122)
Q Consensus        58 v~CP~CgA~---Y~p~~kG~lC~VC~ls   82 (122)
                      ..||.||+.   +..++--.+|.-|++-
T Consensus         2 ~~CpeCg~~~~~~d~~~ge~VC~~CG~V   29 (285)
T COG1405           2 MSCPECGSTNIITDYERGEIVCADCGLV   29 (285)
T ss_pred             CCCCCCCCccceeeccCCeEEeccCCEE
Confidence            479999998   6666777899999864


No 114
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=37.71  E-value=12  Score=25.54  Aligned_cols=16  Identities=31%  Similarity=0.667  Sum_probs=13.7

Q ss_pred             CCCcceecCCCCceec
Q psy2693          53 HGRESEACVYCGASYL   68 (122)
Q Consensus        53 ~G~~~v~CP~CgA~Y~   68 (122)
                      .|+.+.+||-||+.|-
T Consensus        13 DGE~~lrCPRC~~~FR   28 (65)
T COG4049          13 DGEEFLRCPRCGMVFR   28 (65)
T ss_pred             CCceeeeCCchhHHHH
Confidence            4899999999999763


No 115
>PRK14906 DNA-directed RNA polymerase subunit beta'/alpha domain fusion protein; Provisional
Probab=37.70  E-value=42  Score=34.42  Aligned_cols=61  Identities=23%  Similarity=0.519  Sum_probs=42.5

Q ss_pred             HHHHHHHhcCCCCceeecCCCCCC---eeeecccceeccCCCcceecCCCCceecCCCCCcccCcccce
Q psy2693          17 RKLLAICNANPTDEHTIDYDEHNP---FQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTVS   82 (122)
Q Consensus        17 rKIl~~ce~~~tDa~eIdYD~~np---F~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC~ls   82 (122)
                      .+|...+--.=+....|||--..|   =-.|..-|-|+.    ...| .||..-..+|+|.+|.-|++-
T Consensus        20 e~Ir~WS~GEV~kpeTINyrT~KPE~dGLFCerIFGP~k----d~eC-~CGKyk~~~~~g~~C~~CGVE   83 (1460)
T PRK14906         20 EDIRSWSHGEVKKPETINYRTLKPEKDGLFCEKIFGPTK----DWEC-ACGKYKRIRFKGIVCERCGVE   83 (1460)
T ss_pred             HHHHhhhceeEcCccccccccCCCCCCCeeeceeccCcc----CcEE-eCccccccCcCCeEcCCCCcE
Confidence            455555544445666899976654   347888888863    5678 799533368999999999654


No 116
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase. This model represents the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase. The mechanism of the enzyme involves a glycine-centered radical, a C-terminal zinc binding site, and a set of conserved active site cysteines and asparagines. This enzyme requires an activating component, NrdG, a radical-SAM domain containing enzyme (TIGR02491). Together the two form an alpha-2/beta-2 heterodimer.
Probab=37.60  E-value=45  Score=30.28  Aligned_cols=46  Identities=20%  Similarity=0.462  Sum_probs=24.6

Q ss_pred             HHHHHHHHHHHhcCCCCceeecCCCCCCeeeecc-cceeccCCCcc-eecCCCCce
Q psy2693          13 ATQARKLLAICNANPTDEHTIDYDEHNPFQICAR-SYTPIYHGRES-EACVYCGAS   66 (122)
Q Consensus        13 a~qArKIl~~ce~~~tDa~eIdYD~~npF~ICa~-S~tPIY~G~~~-v~CP~CgA~   66 (122)
                      .+..++|+..+-+++..-..++.    +|++|-. .    |.|+-. .+||.||+.
T Consensus       500 ~eal~~lv~~a~~~~i~Y~~~n~----~~~~C~~CG----~~g~~~~~~CP~Cgs~  547 (579)
T TIGR02487       500 PEALKDITKKAMKNGIGYFGINP----PVDVCEDCG----YTGEGLNDKCPKCGSH  547 (579)
T ss_pred             HHHHHHHHHHHHhcCCceEEecc----CCccCCCCC----CCCCCCCCcCcCCCCc
Confidence            35566777766555333333333    3777763 2    234443 567777764


No 117
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=37.48  E-value=19  Score=20.31  Aligned_cols=18  Identities=22%  Similarity=0.575  Sum_probs=8.8

Q ss_pred             ecCCCCceec--CCCCCccc
Q psy2693          59 ACVYCGASYL--PKYKGELC   76 (122)
Q Consensus        59 ~CP~CgA~Y~--p~~kG~lC   76 (122)
                      .||.||+...  ++.....|
T Consensus         1 ~CP~C~s~l~~~~~ev~~~C   20 (28)
T PF03119_consen    1 TCPVCGSKLVREEGEVDIRC   20 (28)
T ss_dssp             B-TTT--BEEE-CCTTCEEE
T ss_pred             CcCCCCCEeEcCCCCEeEEC
Confidence            4888988887  44333333


No 118
>PRK08665 ribonucleotide-diphosphate reductase subunit alpha; Validated
Probab=37.19  E-value=19  Score=33.91  Aligned_cols=26  Identities=27%  Similarity=0.474  Sum_probs=21.8

Q ss_pred             eecCCCCceecCCCCCcccCccccee
Q psy2693          58 EACVYCGASYLPKYKGELCAVCTVSV   83 (122)
Q Consensus        58 v~CP~CgA~Y~p~~kG~lC~VC~ls~   83 (122)
                      ..||-||.....+---.+|..|+.|+
T Consensus       725 ~~Cp~Cg~~l~~~~GC~~C~~CG~sk  750 (752)
T PRK08665        725 GACPECGSILEHEEGCVVCHSCGYSK  750 (752)
T ss_pred             CCCCCCCcccEECCCCCcCCCCCCCC
Confidence            47999999888777778899998876


No 119
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=37.00  E-value=20  Score=21.57  Aligned_cols=11  Identities=27%  Similarity=0.830  Sum_probs=8.1

Q ss_pred             CcceecCCCCc
Q psy2693          55 RESEACVYCGA   65 (122)
Q Consensus        55 ~~~v~CP~CgA   65 (122)
                      .+.+.||-||+
T Consensus        24 ~~~~~CP~Cg~   34 (42)
T PF09723_consen   24 DDPVPCPECGS   34 (42)
T ss_pred             CCCCcCCCCCC
Confidence            56777888877


No 120
>PRK00114 hslO Hsp33-like chaperonin; Reviewed
Probab=36.91  E-value=17  Score=29.97  Aligned_cols=15  Identities=40%  Similarity=1.081  Sum_probs=13.4

Q ss_pred             CCcceecCCCCceec
Q psy2693          54 GRESEACVYCGASYL   68 (122)
Q Consensus        54 G~~~v~CP~CgA~Y~   68 (122)
                      |.-.+.|.||+.+|.
T Consensus       265 ~~iev~C~FC~~~Y~  279 (293)
T PRK00114        265 GGAEMVCQFCGNKYL  279 (293)
T ss_pred             CCEEEEEeCCCCEEE
Confidence            567899999999996


No 121
>KOG4080|consensus
Probab=36.56  E-value=11  Score=30.15  Aligned_cols=22  Identities=32%  Similarity=0.807  Sum_probs=17.3

Q ss_pred             CcceecCCCCceecCCCCCcccCcc
Q psy2693          55 RESEACVYCGASYLPKYKGELCAVC   79 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~p~~kG~lC~VC   79 (122)
                      ....+||-||. |++.  ++||.-|
T Consensus        91 ~nl~~CP~CGh-~k~a--~~LC~~C  112 (176)
T KOG4080|consen   91 DNLNTCPACGH-IKPA--HTLCDYC  112 (176)
T ss_pred             hccccCcccCc-cccc--cccHHHH
Confidence            45789999995 4454  8999988


No 122
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=36.46  E-value=16  Score=27.01  Aligned_cols=28  Identities=25%  Similarity=0.634  Sum_probs=17.7

Q ss_pred             CcceecCCCCceecCC-------CCC-cccCcccce
Q psy2693          55 RESEACVYCGASYLPK-------YKG-ELCAVCTVS   82 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~p~-------~kG-~lC~VC~ls   82 (122)
                      .....||+||+--...       ..| -.|.+|+++
T Consensus        20 ~k~FtCp~Cghe~vs~ctvkk~~~~g~~~Cg~CGls   55 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTVKKTVNIGTAVCGNCGLS   55 (104)
T ss_pred             CceEecCccCCeeeeEEEEEecCceeEEEcccCcce
Confidence            3457899999876551       112 257777765


No 123
>KOG2807|consensus
Probab=36.09  E-value=46  Score=29.45  Aligned_cols=53  Identities=15%  Similarity=0.311  Sum_probs=37.3

Q ss_pred             CCceeecCCCCC---CeeeecccceeccCCCcceecCCCCceecCCCCCcccCcccceeec
Q psy2693          28 TDEHTIDYDEHN---PFQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTVSVID   85 (122)
Q Consensus        28 tDa~eIdYD~~n---pF~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC~ls~IG   85 (122)
                      -+.+.+.|-.+.   .-.+|+--..+++.|   ..||-|+|++-.=  -.-|++|++.-|-
T Consensus       247 ~sLvkmGFP~~~~e~~ps~C~CH~~~~~~G---y~CP~CkakvCsL--P~eCpiC~ltLVs  302 (378)
T KOG2807|consen  247 CSLVKMGFPSRSPEDTPSFCACHSELSGGG---YFCPQCKAKVCSL--PIECPICSLTLVS  302 (378)
T ss_pred             CceEEecCCCcccccCcchheeccccccCc---eeCCcccCeeecC--CccCCccceeEec
Confidence            345677774332   135676665566655   6899999999754  5679999999887


No 124
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=36.06  E-value=25  Score=23.85  Aligned_cols=43  Identities=19%  Similarity=0.245  Sum_probs=24.4

Q ss_pred             ceecCCCCceecCCCCCcccCcccceeecCCCcccCcceecccchhhhh
Q psy2693          57 SEACVYCGASYLPKYKGELCAVCTVSVIDTHRNAYGLQICAGLMKSDVI  105 (122)
Q Consensus        57 ~v~CP~CgA~Y~p~~kG~lC~VC~ls~IG~~~~a~GLr~~~~~~~~~~~  105 (122)
                      ...|--|+..-    .++.|++|+-+..-  .+-.|+-+...-.+|.|-
T Consensus         5 ~~AC~~C~~i~----~~~~Cp~Cgs~~~S--~~w~G~v~i~dPe~S~vA   47 (64)
T PRK06393          5 YRACKKCKRLT----PEKTCPVHGDEKTT--TEWFGFLIITEPEGSAIA   47 (64)
T ss_pred             hhhHhhCCccc----CCCcCCCCCCCcCC--cCcceEEEEECCchhHHH
Confidence            34455555544    24467777766555  666677555544455543


No 125
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=35.93  E-value=89  Score=29.71  Aligned_cols=67  Identities=18%  Similarity=0.266  Sum_probs=46.7

Q ss_pred             ChHHHHHHHHHHHHHhcCCCCceeecCCCCCCeeee------------cccceeccCCCcceecCCCCceecCCCCCccc
Q psy2693           9 IIPVATQARKLLAICNANPTDEHTIDYDEHNPFQIC------------ARSYTPIYHGRESEACVYCGASYLPKYKGELC   76 (122)
Q Consensus         9 ~~~va~qArKIl~~ce~~~tDa~eIdYD~~npF~IC------------a~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC   76 (122)
                      +++..+..++-|++-||.   -+-+|---+.||..|            ..+||- ++.+..-+|.|||....+   -.-|
T Consensus       406 S~~Ll~~i~~~l~~geQ~---llflnRRGys~~l~C~~Cg~v~~Cp~Cd~~lt~-H~~~~~L~CH~Cg~~~~~---p~~C  478 (730)
T COG1198         406 SPALLEAIRKTLERGEQV---LLFLNRRGYAPLLLCRDCGYIAECPNCDSPLTL-HKATGQLRCHYCGYQEPI---PQSC  478 (730)
T ss_pred             CHHHHHHHHHHHhcCCeE---EEEEccCCccceeecccCCCcccCCCCCcceEE-ecCCCeeEeCCCCCCCCC---CCCC
Confidence            477777788877776654   345566666777765            345554 567889999999988443   3579


Q ss_pred             Ccccce
Q psy2693          77 AVCTVS   82 (122)
Q Consensus        77 ~VC~ls   82 (122)
                      +-|+=-
T Consensus       479 p~Cgs~  484 (730)
T COG1198         479 PECGSE  484 (730)
T ss_pred             CCCCCC
Confidence            999854


No 126
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=35.54  E-value=27  Score=23.03  Aligned_cols=12  Identities=25%  Similarity=0.564  Sum_probs=5.5

Q ss_pred             CcceecCCCCce
Q psy2693          55 RESEACVYCGAS   66 (122)
Q Consensus        55 ~~~v~CP~CgA~   66 (122)
                      .....||.||=.
T Consensus        12 ~v~~~Cp~cGip   23 (55)
T PF13824_consen   12 HVNFECPDCGIP   23 (55)
T ss_pred             ccCCcCCCCCCc
Confidence            444445555443


No 127
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=35.48  E-value=18  Score=20.42  Aligned_cols=23  Identities=30%  Similarity=0.608  Sum_probs=10.8

Q ss_pred             ecCCCCceecCCCC--CcccCcccc
Q psy2693          59 ACVYCGASYLPKYK--GELCAVCTV   81 (122)
Q Consensus        59 ~CP~CgA~Y~p~~k--G~lC~VC~l   81 (122)
                      -||-||+.-.+.-.  ..+|+.|+.
T Consensus         5 fC~~CG~~t~~~~~g~~r~C~~Cg~   29 (32)
T PF09297_consen    5 FCGRCGAPTKPAPGGWARRCPSCGH   29 (32)
T ss_dssp             B-TTT--BEEE-SSSS-EEESSSS-
T ss_pred             ccCcCCccccCCCCcCEeECCCCcC
Confidence            47778877765544  346666654


No 128
>TIGR00269 conserved hypothetical protein TIGR00269.
Probab=35.46  E-value=20  Score=25.20  Aligned_cols=23  Identities=26%  Similarity=0.808  Sum_probs=17.2

Q ss_pred             CcceecCCCCceecCCCCCcccCcccc
Q psy2693          55 RESEACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      .+.-.|..||..-.    |.+|++|.+
T Consensus        78 ~~~~~C~~CG~pss----~~iC~~C~l  100 (104)
T TIGR00269        78 EDLRRCERCGEPTS----GRICKACKF  100 (104)
T ss_pred             ccCCcCCcCcCcCC----ccccHhhhh
Confidence            34567999995432    789999987


No 129
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=35.27  E-value=17  Score=26.00  Aligned_cols=20  Identities=25%  Similarity=0.471  Sum_probs=16.9

Q ss_pred             ccCCCcceecCCCCceecCC
Q psy2693          51 IYHGRESEACVYCGASYLPK   70 (122)
Q Consensus        51 IY~G~~~v~CP~CgA~Y~p~   70 (122)
                      +-+..|...|+-||..|+.+
T Consensus        29 vIknVPa~~C~~CGe~y~~d   48 (89)
T TIGR03829        29 EIKETPSISCSHCGMEYQDD   48 (89)
T ss_pred             EEecCCcccccCCCcEeecH
Confidence            34678999999999999865


No 130
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=34.92  E-value=24  Score=20.78  Aligned_cols=11  Identities=36%  Similarity=0.733  Sum_probs=9.9

Q ss_pred             eecCCCCceec
Q psy2693          58 EACVYCGASYL   68 (122)
Q Consensus        58 v~CP~CgA~Y~   68 (122)
                      +.||-|+++|.
T Consensus         3 i~Cp~C~~~y~   13 (36)
T PF13717_consen    3 ITCPNCQAKYE   13 (36)
T ss_pred             EECCCCCCEEe
Confidence            68999999996


No 131
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=34.66  E-value=35  Score=22.86  Aligned_cols=42  Identities=21%  Similarity=0.395  Sum_probs=28.5

Q ss_pred             ecCCCCceecCCCCCcccCcccceeecCCCcccCcceecccchhhhhh
Q psy2693          59 ACVYCGASYLPKYKGELCAVCTVSVIDTHRNAYGLQICAGLMKSDVIN  106 (122)
Q Consensus        59 ~CP~CgA~Y~p~~kG~lC~VC~ls~IG~~~~a~GLr~~~~~~~~~~~~  106 (122)
                      .|--|+..-.    ++.|++|+-+..=  .+-.|+-+...--+|.+-.
T Consensus         5 AC~~C~~i~~----~~~CP~Cgs~~~T--~~W~G~viI~dPe~S~IAk   46 (61)
T PRK08351          5 ACRHCHYITT----EDRCPVCGSRDLS--DEWFDLVIIIDVENSRIAK   46 (61)
T ss_pred             hhhhCCcccC----CCcCCCCcCCccc--cccccEEEEeCCcHhHHHH
Confidence            4666665552    4468888888877  7888887766566676653


No 132
>PRK12268 methionyl-tRNA synthetase; Reviewed
Probab=34.55  E-value=71  Score=28.05  Aligned_cols=60  Identities=18%  Similarity=0.314  Sum_probs=32.2

Q ss_pred             hHHHHHHHHHHHHHhcCC---CCceeecCCCCCCeeeecccceeccCCCcceecCCCCceecCCCCCcccCccc
Q psy2693          10 IPVATQARKLLAICNANP---TDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        10 ~~va~qArKIl~~ce~~~---tDa~eIdYD~~npF~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      ++-.+.+++++...-+++   +......|++.     |-..++.-|   -.-.||.|++   .+..|..|-.|+
T Consensus        99 ~~~~~~~~~~~~~L~~~G~~y~~~~~~~~~~~-----~~~~l~~~~---v~g~cp~c~~---~~~~G~~ce~cg  161 (556)
T PRK12268         99 PNHHEVVQEFFLKLYENGYIYKKTIEQAYCPS-----DGRFLPDRY---VEGTCPYCGY---EGARGDQCDNCG  161 (556)
T ss_pred             HHHHHHHHHHHHHHHHCCCeEEeeeEEEecCC-----CCcCcCccc---eeccCCCCCC---cccCCchhhhcc
Confidence            445566777777665555   24455555544     222222222   1125888885   244677777774


No 133
>PRK06260 threonine synthase; Validated
Probab=34.29  E-value=27  Score=29.62  Aligned_cols=23  Identities=30%  Similarity=0.660  Sum_probs=17.1

Q ss_pred             eecCCCCceecCCCCCcccCccc
Q psy2693          58 EACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        58 v~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      .+|+-||..|.++..-..|+-|+
T Consensus         4 ~~C~~cg~~~~~~~~~~~Cp~cg   26 (397)
T PRK06260          4 LKCIECGKEYDPDEIIYTCPECG   26 (397)
T ss_pred             EEECCCCCCCCCCCccccCCCCC
Confidence            57888888888776556687774


No 134
>COG3919 Predicted ATP-grasp enzyme [General function prediction only]
Probab=34.05  E-value=41  Score=29.83  Aligned_cols=34  Identities=21%  Similarity=0.177  Sum_probs=29.8

Q ss_pred             ccCCChHHHHHHHHHHHHHhcCCCCceeecCCCC
Q psy2693           5 AKFQIIPVATQARKLLAICNANPTDEHTIDYDEH   38 (122)
Q Consensus         5 el~p~~~va~qArKIl~~ce~~~tDa~eIdYD~~   38 (122)
                      ++.....+.++||++|...+-.+--+++.-||++
T Consensus       242 evvDn~Q~i~aar~~L~si~htGlvevefK~D~R  275 (415)
T COG3919         242 EVVDNQQVIQAARDFLESIEHTGLVEVEFKYDPR  275 (415)
T ss_pred             EecCcHHHHHHHHHHHHhhcccceEEEEEEecCC
Confidence            3444578899999999999999999999999998


No 135
>smart00238 BIR Baculoviral inhibition of apoptosis protein repeat. Domain found in inhibitor of apoptosis proteins (IAPs) and other proteins. Acts as a direct inhibitor of caspase enzymes.
Probab=33.70  E-value=34  Score=21.72  Aligned_cols=18  Identities=28%  Similarity=0.820  Sum_probs=13.4

Q ss_pred             cCC-CcceecCCCCceecC
Q psy2693          52 YHG-RESEACVYCGASYLP   69 (122)
Q Consensus        52 Y~G-~~~v~CP~CgA~Y~p   69 (122)
                      |.| ...++|.+||-.+..
T Consensus        30 y~~~~d~v~C~~C~~~l~~   48 (71)
T smart00238       30 YTGVGDEVKCFFCGGELDN   48 (71)
T ss_pred             ECCCCCEEEeCCCCCCcCC
Confidence            455 557999999987654


No 136
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=32.94  E-value=23  Score=28.05  Aligned_cols=31  Identities=29%  Similarity=0.836  Sum_probs=23.6

Q ss_pred             CcceecCCCCceec-------------------CCCCC--------cccCcccceeec
Q psy2693          55 RESEACVYCGASYL-------------------PKYKG--------ELCAVCTVSVID   85 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~-------------------p~~kG--------~lC~VC~ls~IG   85 (122)
                      ...++||+|+..+.                   |.|+|        .+|+.|+.+..-
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~   60 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFE   60 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCcccc
Confidence            56789999998764                   33443        589999999886


No 137
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=32.90  E-value=21  Score=27.53  Aligned_cols=16  Identities=25%  Similarity=0.632  Sum_probs=11.3

Q ss_pred             CCcceecCCCCceecC
Q psy2693          54 GRESEACVYCGASYLP   69 (122)
Q Consensus        54 G~~~v~CP~CgA~Y~p   69 (122)
                      ....+.||+||+.-..
T Consensus        29 ~~glv~CP~Cgs~~V~   44 (148)
T PF06676_consen   29 ARGLVSCPVCGSTEVS   44 (148)
T ss_pred             HcCCccCCCCCCCeEe
Confidence            4567889999886543


No 138
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=32.74  E-value=20  Score=26.51  Aligned_cols=30  Identities=30%  Similarity=0.630  Sum_probs=20.1

Q ss_pred             eeeeccc---ceec-cCCCcceecCCCCceecCCCC
Q psy2693          41 FQICARS---YTPI-YHGRESEACVYCGASYLPKYK   72 (122)
Q Consensus        41 F~ICa~S---~tPI-Y~G~~~v~CP~CgA~Y~p~~k   72 (122)
                      -.||+.-   +|-- |  ...++||||.+.+.|.-+
T Consensus        62 ~iiCGvC~~~LT~~EY--~~~~~Cp~C~spFNp~Ck   95 (105)
T COG4357          62 AIICGVCRKLLTRAEY--GMCGSCPYCQSPFNPGCK   95 (105)
T ss_pred             cEEhhhhhhhhhHHHH--hhcCCCCCcCCCCCcccc
Confidence            4566653   3331 4  345679999999999854


No 139
>PLN02294 cytochrome c oxidase subunit Vb
Probab=32.67  E-value=22  Score=28.47  Aligned_cols=28  Identities=14%  Similarity=0.380  Sum_probs=20.6

Q ss_pred             ccceecc----CCCcceecCCCCceecCCCCCc
Q psy2693          46 RSYTPIY----HGRESEACVYCGASYLPKYKGE   74 (122)
Q Consensus        46 ~S~tPIY----~G~~~v~CP~CgA~Y~p~~kG~   74 (122)
                      .+..+++    +|++. +||-||..|.-+|-|.
T Consensus       127 Dsh~v~Wf~L~kGkp~-RCpeCG~~fkL~~vG~  158 (174)
T PLN02294        127 DEHDVVWFWLEKGKSF-ECPVCTQYFELEVVGP  158 (174)
T ss_pred             CCceeEEEEecCCCce-eCCCCCCEEEEEEeCC
Confidence            3666663    68654 5999999999887663


No 140
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=32.58  E-value=29  Score=19.34  Aligned_cols=19  Identities=32%  Similarity=0.791  Sum_probs=10.1

Q ss_pred             ecccceeccCC-CcceecCCCC
Q psy2693          44 CARSYTPIYHG-RESEACVYCG   64 (122)
Q Consensus        44 Ca~S~tPIY~G-~~~v~CP~Cg   64 (122)
                      |...+.|  ++ .-...||-||
T Consensus         4 C~~~i~~--r~~~v~f~CPnCG   23 (24)
T PF07754_consen    4 CGRPIAP--REQAVPFPCPNCG   23 (24)
T ss_pred             CCCcccC--cccCceEeCCCCC
Confidence            4444555  22 4445677776


No 141
>PRK06450 threonine synthase; Validated
Probab=32.35  E-value=28  Score=29.18  Aligned_cols=22  Identities=32%  Similarity=0.760  Sum_probs=16.2

Q ss_pred             eecCCCCceecCCCCCcccCccc
Q psy2693          58 EACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        58 v~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      .+|+-||..|.+.+. ..|+-|+
T Consensus         4 ~~C~~Cg~~~~~~~~-~~C~~cg   25 (338)
T PRK06450          4 EVCMKCGKERESIYE-IRCKKCG   25 (338)
T ss_pred             eEECCcCCcCCCccc-ccCCcCC
Confidence            478888888877443 6788885


No 142
>KOG3352|consensus
Probab=32.23  E-value=80  Score=24.81  Aligned_cols=56  Identities=16%  Similarity=0.242  Sum_probs=35.1

Q ss_pred             HHHHHHHhcCCCCceeecCCCC------CCee------------eecccce-----eccCCCcceecCCCCceecCCCCC
Q psy2693          17 RKLLAICNANPTDEHTIDYDEH------NPFQ------------ICARSYT-----PIYHGRESEACVYCGASYLPKYKG   73 (122)
Q Consensus        17 rKIl~~ce~~~tDa~eIdYD~~------npF~------------ICa~S~t-----PIY~G~~~v~CP~CgA~Y~p~~kG   73 (122)
                      .|---.++..+.|.++++|+..      +|-.            +|...=.     =|++|+..- ||-||..|.=+..|
T Consensus        71 Ek~eLla~l~G~d~~d~k~~~~~~GTkedP~lV~S~~d~RiVGC~c~eD~~~V~Wmwl~Kge~~r-c~eCG~~fkL~~v~  149 (153)
T KOG3352|consen   71 EKEELLAELEGRDPFDMKVPRGPSGTKEDPNLVPSYYDKRIVGCGCEEDSHAVVWMWLEKGETQR-CPECGHYFKLVPVG  149 (153)
T ss_pred             HHHHHHHHhhCCCccccccccCCCCcccCCccccccCCceEEeecccCCCcceEEEEEEcCCccc-CCcccceEEeeecC
Confidence            3444467788889888888754      2222            2333222     246777665 99999998765544


No 143
>PRK07591 threonine synthase; Validated
Probab=31.74  E-value=29  Score=29.86  Aligned_cols=23  Identities=30%  Similarity=0.629  Sum_probs=18.0

Q ss_pred             ceecCCCCceecCCCCCcccCccc
Q psy2693          57 SEACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        57 ~v~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      ..+|+-||..|.+++. -.|+-|+
T Consensus        18 ~l~C~~Cg~~~~~~~~-~~C~~cg   40 (421)
T PRK07591         18 ALKCRECGAEYPLGPI-HVCEECF   40 (421)
T ss_pred             EEEeCCCCCcCCCCCC-ccCCCCC
Confidence            3688888888888776 7788784


No 144
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=31.66  E-value=37  Score=22.37  Aligned_cols=29  Identities=14%  Similarity=0.291  Sum_probs=13.7

Q ss_pred             ceecCCCCceecCCCCCcccC----cccceeec
Q psy2693          57 SEACVYCGASYLPKYKGELCA----VCTVSVID   85 (122)
Q Consensus        57 ~v~CP~CgA~Y~p~~kG~lC~----VC~ls~IG   85 (122)
                      .+.||-||...........=+    -|.+--+|
T Consensus         2 ~v~CP~C~k~~~~~~~n~~rPFCS~RCk~iDLg   34 (57)
T PF03884_consen    2 TVKCPICGKPVEWSPENPFRPFCSERCKLIDLG   34 (57)
T ss_dssp             EEE-TTT--EEE-SSSSS--SSSSHHHHHHHHS
T ss_pred             cccCCCCCCeecccCCCCcCCcccHhhcccCHH
Confidence            478999999998833333222    34555555


No 145
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=31.14  E-value=30  Score=25.65  Aligned_cols=35  Identities=23%  Similarity=0.452  Sum_probs=26.6

Q ss_pred             eecccc----eeccCCCcceecCCCCceecCCCCCcccC
Q psy2693          43 ICARSY----TPIYHGRESEACVYCGASYLPKYKGELCA   77 (122)
Q Consensus        43 ICa~S~----tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~   77 (122)
                      .|..++    .++.+|.+..+|+-|+..+.-++...++.
T Consensus        35 ~C~s~~~~k~g~~~~~~qRyrC~~C~~tf~~~~~~~~~~   73 (129)
T COG3677          35 RCKSSNVVKIGGIRRGHQRYKCKSCGSTFTVETGSPLSK   73 (129)
T ss_pred             CCCccceeeECCccccccccccCCcCcceeeeccCcccc
Confidence            355555    44566788889999999998888888877


No 146
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=30.52  E-value=37  Score=23.18  Aligned_cols=30  Identities=30%  Similarity=0.581  Sum_probs=21.3

Q ss_pred             CcccCcccceeecCCCcccCcceecccchhhh
Q psy2693          73 GELCAVCTVSVIDTHRNAYGLQICAGLMKSDV  104 (122)
Q Consensus        73 G~lC~VC~ls~IG~~~~a~GLr~~~~~~~~~~  104 (122)
                      -++|++|+-.+.-  .+-.||-+...--+|+.
T Consensus        18 ~e~CP~Cgs~~~t--e~W~G~~iIidpe~SeI   47 (64)
T COG2093          18 TEICPVCGSTDLT--EEWFGLLIIIDPEKSEI   47 (64)
T ss_pred             CccCCCCCCcccc--hhhccEEEEEcCcHHHH
Confidence            5678888888777  78888866655555543


No 147
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=30.49  E-value=25  Score=21.87  Aligned_cols=37  Identities=22%  Similarity=0.452  Sum_probs=21.5

Q ss_pred             eecccceeccCCCcceecCCCCceecCCC-----CCcccCcc
Q psy2693          43 ICARSYTPIYHGRESEACVYCGASYLPKY-----KGELCAVC   79 (122)
Q Consensus        43 ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~-----kG~lC~VC   79 (122)
                      +-...++|=....-.=+|+.||-.|...-     .+.-|+.|
T Consensus        14 ~~p~~v~~~s~~~v~W~C~~Cgh~w~~~v~~R~~~~~~CP~C   55 (55)
T PF14311_consen   14 LDPSEVTPGSNKKVWWKCPKCGHEWKASVNDRTRRGKGCPYC   55 (55)
T ss_pred             CCHHHhCcCCCCEEEEECCCCCCeeEccHhhhccCCCCCCCC
Confidence            44444444333344468999988887542     35556655


No 148
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional
Probab=30.37  E-value=28  Score=29.71  Aligned_cols=33  Identities=18%  Similarity=0.192  Sum_probs=24.1

Q ss_pred             eeeecccceeccCCCcceecCCCCceecCCCCCcc
Q psy2693          41 FQICARSYTPIYHGRESEACVYCGASYLPKYKGEL   75 (122)
Q Consensus        41 F~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~l   75 (122)
                      |-.|..  -|=++-...-+||+||--+.|.|.|+-
T Consensus        44 ~~~~pm--~p~~~~~~pg~~p~~~m~lvp~y~~~~   76 (409)
T PRK09783         44 FWYDPM--YPNTRFDKPGKSPFMDMDLVPKYADEE   76 (409)
T ss_pred             EEeCCC--CCCcCCCCCCCCCCCCCeeeEEecCCC
Confidence            344543  476666667799999999999987653


No 149
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=30.33  E-value=17  Score=27.61  Aligned_cols=22  Identities=23%  Similarity=0.786  Sum_probs=18.4

Q ss_pred             eecCCCCceecCCCCCcccCccc
Q psy2693          58 EACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        58 v~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      ..||-||.-|... ...+|+.|.
T Consensus         4 ~nC~~CgklF~~~-~~~iCp~C~   25 (137)
T TIGR03826         4 ANCPKCGRLFVKT-GRDVCPSCY   25 (137)
T ss_pred             ccccccchhhhhc-CCccCHHHh
Confidence            4699999999885 567999996


No 150
>PF14169 YdjO:  Cold-inducible protein YdjO
Probab=30.02  E-value=31  Score=23.05  Aligned_cols=19  Identities=16%  Similarity=0.335  Sum_probs=13.9

Q ss_pred             CCCcceecCCCCceecCCC
Q psy2693          53 HGRESEACVYCGASYLPKY   71 (122)
Q Consensus        53 ~G~~~v~CP~CgA~Y~p~~   71 (122)
                      ..+..-.||+|++.-..+.
T Consensus        35 s~~~~p~CPlC~s~M~~~~   53 (59)
T PF14169_consen   35 SFEEEPVCPLCKSPMVSGT   53 (59)
T ss_pred             ccCCCccCCCcCCccccce
Confidence            4566678999998776553


No 151
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=29.73  E-value=49  Score=26.20  Aligned_cols=10  Identities=40%  Similarity=0.999  Sum_probs=5.6

Q ss_pred             cCCCCceecC
Q psy2693          60 CVYCGASYLP   69 (122)
Q Consensus        60 CP~CgA~Y~p   69 (122)
                      ||.||..|=+
T Consensus       133 C~~CgkiYW~  142 (165)
T COG1656         133 CPKCGKIYWK  142 (165)
T ss_pred             CCCCcccccC
Confidence            6666655543


No 152
>PF05325 DUF730:  Protein of unknown function (DUF730);  InterPro: IPR007989 This family consists of several uncharacterised Arabidopsis thaliana proteins of unknown function.
Probab=28.80  E-value=38  Score=25.35  Aligned_cols=32  Identities=28%  Similarity=0.393  Sum_probs=26.6

Q ss_pred             eeecCCCCCCeeeecccceeccCCCcceecCCC
Q psy2693          31 HTIDYDEHNPFQICARSYTPIYHGRESEACVYC   63 (122)
Q Consensus        31 ~eIdYD~~npF~ICa~S~tPIY~G~~~v~CP~C   63 (122)
                      +.|++| -|.-++-+.|..||-.|.-..+|||=
T Consensus        19 v~ie~d-cnakvvvats~dpvts~klyfscpye   50 (122)
T PF05325_consen   19 VPIECD-CNAKVVVATSRDPVTSGKLYFSCPYE   50 (122)
T ss_pred             cceecc-CCceEEEEeccCCcccceeeecCccc
Confidence            566775 46678889999999999999999983


No 153
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=28.73  E-value=31  Score=30.89  Aligned_cols=24  Identities=25%  Similarity=0.592  Sum_probs=18.3

Q ss_pred             eecCCCCceecCCCC-CcccCcccc
Q psy2693          58 EACVYCGASYLPKYK-GELCAVCTV   81 (122)
Q Consensus        58 v~CP~CgA~Y~p~~k-G~lC~VC~l   81 (122)
                      -.||+||.+....=+ |--|+-|+-
T Consensus       351 p~Cp~Cg~~m~S~G~~g~rC~kCg~  375 (421)
T COG1571         351 PVCPRCGGRMKSAGRNGFRCKKCGT  375 (421)
T ss_pred             CCCCccCCchhhcCCCCcccccccc
Confidence            379999999887755 667888863


No 154
>PF13806 Rieske_2:  Rieske-like [2Fe-2S] domain; PDB: 2JO6_A 3C0D_A 3D89_A 2JZA_A.
Probab=28.49  E-value=34  Score=24.05  Aligned_cols=21  Identities=24%  Similarity=0.376  Sum_probs=17.1

Q ss_pred             CCCcceecCCCCceecCCCCCc
Q psy2693          53 HGRESEACVYCGASYLPKYKGE   74 (122)
Q Consensus        53 ~G~~~v~CP~CgA~Y~p~~kG~   74 (122)
                      .|.+.|.||+.++.|.-+ .|+
T Consensus        60 ~g~~~V~CPlH~~~f~L~-tG~   80 (104)
T PF13806_consen   60 NGEPCVACPLHKWRFDLR-TGE   80 (104)
T ss_dssp             TTEEEEEETTTTEEEETT-TTE
T ss_pred             CCCEEEECCCCCCeEECC-CcC
Confidence            467799999999999986 353


No 155
>PRK01343 zinc-binding protein; Provisional
Probab=28.45  E-value=47  Score=22.04  Aligned_cols=31  Identities=19%  Similarity=0.427  Sum_probs=21.5

Q ss_pred             CCcceecCCCCceecCCCCCccc-Ccccceeec
Q psy2693          54 GRESEACVYCGASYLPKYKGELC-AVCTVSVID   85 (122)
Q Consensus        54 G~~~v~CP~CgA~Y~p~~kG~lC-~VC~ls~IG   85 (122)
                      ..+.+.||-||.....+|. -.| .-|..--+|
T Consensus         6 ~~p~~~CP~C~k~~~~~~r-PFCS~RC~~iDLg   37 (57)
T PRK01343          6 LRPTRPCPECGKPSTREAY-PFCSERCRDIDLN   37 (57)
T ss_pred             CCCCCcCCCCCCcCcCCCC-cccCHHHhhhhHH
Confidence            3578999999998877665 344 346655555


No 156
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=28.42  E-value=33  Score=22.25  Aligned_cols=13  Identities=38%  Similarity=0.580  Sum_probs=10.8

Q ss_pred             cceecCCCCceec
Q psy2693          56 ESEACVYCGASYL   68 (122)
Q Consensus        56 ~~v~CP~CgA~Y~   68 (122)
                      ..|.||-||+.|-
T Consensus        21 eiV~Cp~CGaele   33 (54)
T TIGR01206        21 ELVICDECGAELE   33 (54)
T ss_pred             CEEeCCCCCCEEE
Confidence            4789999999874


No 157
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=28.32  E-value=30  Score=24.88  Aligned_cols=26  Identities=27%  Similarity=0.428  Sum_probs=19.3

Q ss_pred             cceec----cCCCcceecCCCCceecCCCCC
Q psy2693          47 SYTPI----YHGRESEACVYCGASYLPKYKG   73 (122)
Q Consensus        47 S~tPI----Y~G~~~v~CP~CgA~Y~p~~kG   73 (122)
                      ++.++    .+| +..+||-||..|.=.+.|
T Consensus        66 ~h~v~W~~l~~g-~~~rC~eCG~~fkL~~v~   95 (97)
T cd00924          66 SHDVIWMWLEKG-KPKRCPECGHVFKLVDVG   95 (97)
T ss_pred             CceEEEEEEeCC-CceeCCCCCcEEEEEECC
Confidence            45555    478 689999999999766544


No 158
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=28.23  E-value=25  Score=27.30  Aligned_cols=7  Identities=29%  Similarity=1.127  Sum_probs=6.1

Q ss_pred             ecCCCCc
Q psy2693          59 ACVYCGA   65 (122)
Q Consensus        59 ~CP~CgA   65 (122)
                      +|||||.
T Consensus         2 ~CP~C~~    8 (147)
T TIGR00244         2 HCPFCQH    8 (147)
T ss_pred             CCCCCCC
Confidence            6999997


No 159
>cd03532 Rieske_RO_Alpha_VanA_DdmC Rieske non-heme iron oxygenase (RO) family, Vanillate-O-demethylase oxygenase (VanA) and dicamba O-demethylase oxygenase (DdmC) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. Vanillate-O-demethylase is a heterodimeric enzyme consisting of a terminal oxygenase (VanA) and reductase (VanB) components. This enzyme reductively catalyzes the conversion of vanillate into protocatechuate and formaldehyde. Protocatechuate and vanillate are important intermediate metabolites in the degrad
Probab=28.12  E-value=56  Score=22.81  Aligned_cols=35  Identities=20%  Similarity=0.473  Sum_probs=25.0

Q ss_pred             eeecccceeccCC---CcceecCCCCceecCCCCCcccCc
Q psy2693          42 QICARSYTPIYHG---RESEACVYCGASYLPKYKGELCAV   78 (122)
Q Consensus        42 ~ICa~S~tPIY~G---~~~v~CP~CgA~Y~p~~kG~lC~V   78 (122)
                      ++|.---.|+..|   ...+.|||-|+.|..  .|++-.+
T Consensus        44 n~CpH~g~~L~~G~~~~~~i~Cp~Hg~~fd~--~G~~~~~   81 (116)
T cd03532          44 DRCPHRSAPLSKGSVEGGGLVCGYHGLEFDS--DGRCVHM   81 (116)
T ss_pred             CcCCCCCCCccCCcccCCEEEeCCCCcEEcC--CCCEEeC
Confidence            3666666666544   457999999999994  5876543


No 160
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=27.92  E-value=56  Score=26.39  Aligned_cols=60  Identities=15%  Similarity=0.277  Sum_probs=39.8

Q ss_pred             CCCCceeecCCCC--------------CCeeeecccceeccCCCcceecCCCCceec----CCCC-CcccCcccceeec
Q psy2693          26 NPTDEHTIDYDEH--------------NPFQICARSYTPIYHGRESEACVYCGASYL----PKYK-GELCAVCTVSVID   85 (122)
Q Consensus        26 ~~tDa~eIdYD~~--------------npF~ICa~S~tPIY~G~~~v~CP~CgA~Y~----p~~k-G~lC~VC~ls~IG   85 (122)
                      ...|-++|+|-+.              ..-.+|..|+..+-....+|-=-=||-.|.    .+.+ +..|++|+-.--.
T Consensus        84 ~LKDl~~l~~~~n~~~~~~~~~~~~~~~~~~~CPvt~~~~~~~~~fv~l~~cG~V~s~~alke~k~~~~Cp~c~~~f~~  162 (260)
T PF04641_consen   84 SLKDLVELKFTKNPSYKEEDKSSGDNSEGRFICPVTGKEFNGKHKFVYLRPCGCVFSEKALKELKKSKKCPVCGKPFTE  162 (260)
T ss_pred             CccceeeEEeEecCccccccccccccCCceeECCCCCcccCCceeEEEEcCCCCEeeHHHHHhhcccccccccCCcccc
Confidence            4567778877533              334599999999854566666566777664    3445 6788888755433


No 161
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=27.92  E-value=58  Score=24.70  Aligned_cols=26  Identities=23%  Similarity=0.621  Sum_probs=14.6

Q ss_pred             eeeecccceeccCCCcceecCCCCce
Q psy2693          41 FQICARSYTPIYHGRESEACVYCGAS   66 (122)
Q Consensus        41 F~ICa~S~tPIY~G~~~v~CP~CgA~   66 (122)
                      |.+|.=--..=|.|+..+.||-||..
T Consensus        89 fa~C~CGkl~Ci~g~~~~~CPwCg~~  114 (131)
T PF15616_consen   89 FAVCGCGKLFCIDGEGEVTCPWCGNE  114 (131)
T ss_pred             EEEecCCCEEEeCCCCCEECCCCCCe
Confidence            55554443344566666666666654


No 162
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=27.91  E-value=35  Score=20.48  Aligned_cols=17  Identities=18%  Similarity=0.335  Sum_probs=13.3

Q ss_pred             CcceecCCCCceecCCC
Q psy2693          55 RESEACVYCGASYLPKY   71 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~p~~   71 (122)
                      +..+.|+.||+.+....
T Consensus         3 ~g~l~C~~CG~~m~~~~   19 (58)
T PF13408_consen    3 SGLLRCGHCGSKMTRRK   19 (58)
T ss_pred             CCcEEcccCCcEeEEEE
Confidence            34689999999988643


No 163
>PF13395 HNH_4:  HNH endonuclease
Probab=27.76  E-value=26  Score=21.86  Aligned_cols=11  Identities=36%  Similarity=0.951  Sum_probs=9.1

Q ss_pred             cCCCCceecCC
Q psy2693          60 CVYCGASYLPK   70 (122)
Q Consensus        60 CP~CgA~Y~p~   70 (122)
                      |+|||.....+
T Consensus         1 C~Y~g~~i~~~   11 (54)
T PF13395_consen    1 CPYCGKPISIE   11 (54)
T ss_pred             CCCCCCCCChh
Confidence            89999888765


No 164
>COG4311 SoxD Sarcosine oxidase delta subunit [Amino acid transport and metabolism]
Probab=27.52  E-value=25  Score=25.73  Aligned_cols=15  Identities=27%  Similarity=0.685  Sum_probs=11.0

Q ss_pred             ceecCCCCceecCCC
Q psy2693          57 SEACVYCGASYLPKY   71 (122)
Q Consensus        57 ~v~CP~CgA~Y~p~~   71 (122)
                      .+.|||||-+-.-+|
T Consensus         3 LI~CP~Cg~R~e~EF   17 (97)
T COG4311           3 LIPCPYCGERPEEEF   17 (97)
T ss_pred             eecCCCCCCCchhhe
Confidence            368999999655554


No 165
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion]
Probab=27.44  E-value=44  Score=26.14  Aligned_cols=36  Identities=19%  Similarity=0.426  Sum_probs=23.9

Q ss_pred             CCCCceeecCCCCCCeeeecccceeccCCCcceecCCCCc
Q psy2693          26 NPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGA   65 (122)
Q Consensus        26 ~~tDa~eIdYD~~npF~ICa~S~tPIY~G~~~v~CP~CgA   65 (122)
                      =|+|++++.-++..+    -.+-.+-+..=...+|-|||=
T Consensus        67 CP~~aI~m~~~~~~~----~g~~~~~~~~In~grCIfCg~  102 (172)
T COG1143          67 CPANAITMETAERKV----DGRKKPKRPDINLGRCIFCGL  102 (172)
T ss_pred             CCcCceEEEEcccCC----CCccccccceeccccccccCc
Confidence            378899888887765    333333344556778888873


No 166
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=26.81  E-value=37  Score=31.61  Aligned_cols=22  Identities=23%  Similarity=0.608  Sum_probs=17.1

Q ss_pred             ecCCCCceecCCCCCcccCcccce
Q psy2693          59 ACVYCGASYLPKYKGELCAVCTVS   82 (122)
Q Consensus        59 ~CP~CgA~Y~p~~kG~lC~VC~ls   82 (122)
                      .||-||+...++  .+.|+-|+-.
T Consensus        29 ~Cp~CG~~~~~~--~~fC~~CG~~   50 (645)
T PRK14559         29 PCPQCGTEVPVD--EAHCPNCGAE   50 (645)
T ss_pred             cCCCCCCCCCcc--cccccccCCc
Confidence            688888887777  5689988853


No 167
>TIGR00201 comF comF family protein. This protein is found in species that do (Bacillus subtilis, Haemophilus influenzae) or do not (E. coli, Borrelia burgdorferi) have described systems for natural transformation with exogenous DNA. It is involved in competence for transformation in Bacillus subtilis.
Probab=26.74  E-value=31  Score=26.14  Aligned_cols=19  Identities=37%  Similarity=0.976  Sum_probs=12.0

Q ss_pred             cCCCCceecCCCCCcccCccc
Q psy2693          60 CVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        60 CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      |+.||+...+.  ..+|..|.
T Consensus         1 C~~C~~~~~~~--~~~C~~C~   19 (190)
T TIGR00201         1 CSLCGRPYQSV--HALCRQCG   19 (190)
T ss_pred             CCccccccccc--cCCchhhC
Confidence            67777765543  45777774


No 168
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=26.31  E-value=64  Score=18.33  Aligned_cols=23  Identities=30%  Similarity=0.762  Sum_probs=11.4

Q ss_pred             ecCCCCceecCCCCCcccCcccc
Q psy2693          59 ACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus        59 ~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      .|-.|+....-...|--|..|++
T Consensus        13 ~C~~C~~~i~~~~~~~~C~~C~~   35 (49)
T smart00109       13 KCCVCRKSIWGSFQGLRCSWCKV   35 (49)
T ss_pred             CccccccccCcCCCCcCCCCCCc
Confidence            45555555443223555555544


No 169
>PF08782 c-SKI_SMAD_bind:  c-SKI Smad4 binding domain;  InterPro: IPR014890 c-SKI is an oncoprotein that inhibits TGF-beta signalling through interaction with Smad proteins []. This protein binds to Smad4 [].; GO: 0005634 nucleus; PDB: 1MR1_C.
Probab=26.06  E-value=26  Score=25.41  Aligned_cols=30  Identities=27%  Similarity=0.742  Sum_probs=17.1

Q ss_pred             eeeeccccee-ccC--CCcceecCCCCceecCC
Q psy2693          41 FQICARSYTP-IYH--GRESEACVYCGASYLPK   70 (122)
Q Consensus        41 F~ICa~S~tP-IY~--G~~~v~CP~CgA~Y~p~   70 (122)
                      |--|-++|.| .|.  ..+-++|-+|+..|.|+
T Consensus         9 ~g~c~G~f~P~lY~~~~a~CI~C~~C~~~FsP~   41 (96)
T PF08782_consen    9 FGGCRGSFIPELYSSPNAKCIECLECRGMFSPQ   41 (96)
T ss_dssp             TT-EEEEE-GGG--STT---EEETTT--EE-HH
T ss_pred             cCccceEechhhcCCCCCCceEcccCCCEeCCc
Confidence            6678999999 564  46899999999999885


No 170
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=25.78  E-value=32  Score=20.79  Aligned_cols=9  Identities=33%  Similarity=0.903  Sum_probs=7.6

Q ss_pred             eecCCCCce
Q psy2693          58 EACVYCGAS   66 (122)
Q Consensus        58 v~CP~CgA~   66 (122)
                      +.||.||+.
T Consensus        19 ~~CP~Cg~~   27 (46)
T PF12760_consen   19 FVCPHCGST   27 (46)
T ss_pred             CCCCCCCCe
Confidence            569999986


No 171
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase. This model represents the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase. The mechanism of the enzyme involves a glycine-centered radical, a C-terminal zinc binding site, and a set of conserved active site cysteines and asparagines. This enzyme requires an activating component, NrdG, a radical-SAM domain containing enzyme (TIGR02491). Together the two form an alpha-2/beta-2 heterodimer.
Probab=25.76  E-value=44  Score=30.36  Aligned_cols=25  Identities=24%  Similarity=0.611  Sum_probs=18.8

Q ss_pred             CcceecCCCCceecCCCCCcccCcccc
Q psy2693          55 RESEACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      .+.-.|+-||  |.-++.+..||.|+=
T Consensus       522 ~~~~~C~~CG--~~g~~~~~~CP~Cgs  546 (579)
T TIGR02487       522 PPVDVCEDCG--YTGEGLNDKCPKCGS  546 (579)
T ss_pred             cCCccCCCCC--CCCCCCCCcCcCCCC
Confidence            4667899998  456655578999983


No 172
>PRK01402 hslO Hsp33-like chaperonin; Reviewed
Probab=25.71  E-value=36  Score=28.98  Aligned_cols=15  Identities=33%  Similarity=0.846  Sum_probs=13.5

Q ss_pred             CCcceecCCCCceec
Q psy2693          54 GRESEACVYCGASYL   68 (122)
Q Consensus        54 G~~~v~CP~CgA~Y~   68 (122)
                      |.-.+.|-|||.+|+
T Consensus       305 g~iev~CeFC~~~Y~  319 (328)
T PRK01402        305 GKISVTCEFCSRVYR  319 (328)
T ss_pred             CCEEEEeeCCCCEEE
Confidence            677899999999997


No 173
>cd00022 BIR Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins. In higher eukaryotes, BIR domains inhibit apoptosis by acting as direct inhibitors of the caspase family of protease enzymes. In yeast, BIR domains are involved in regulating cytokinesis. This novel fold is stabilized by zinc tetrahedrally coordinated by one histidine and three cysteine residues and resembles a classical zinc finger.
Probab=25.63  E-value=58  Score=20.52  Aligned_cols=15  Identities=20%  Similarity=0.676  Sum_probs=12.1

Q ss_pred             CcceecCCCCceecC
Q psy2693          55 RESEACVYCGASYLP   69 (122)
Q Consensus        55 ~~~v~CP~CgA~Y~p   69 (122)
                      ...++|.||+-.+..
T Consensus        32 ~d~v~C~~C~~~~~~   46 (69)
T cd00022          32 GDEVKCFFCGLELKN   46 (69)
T ss_pred             CCEEEeCCCCCCccC
Confidence            578999999987754


No 174
>PRK09263 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=25.55  E-value=42  Score=31.44  Aligned_cols=8  Identities=38%  Similarity=0.920  Sum_probs=4.0

Q ss_pred             eecCCCCc
Q psy2693          58 EACVYCGA   65 (122)
Q Consensus        58 v~CP~CgA   65 (122)
                      ..||.||+
T Consensus       660 ~~CP~CG~  667 (711)
T PRK09263        660 FTCPKCGN  667 (711)
T ss_pred             CcCcCCCC
Confidence            34555554


No 175
>PRK10445 endonuclease VIII; Provisional
Probab=25.50  E-value=1.5e+02  Score=24.09  Aligned_cols=63  Identities=17%  Similarity=0.278  Sum_probs=31.3

Q ss_pred             hHHHHHHHHHHHHHhcCCCCceeecCCCCCCeeeecccceeccCCCcceecCCCCceecCCCC----CcccCccc
Q psy2693          10 IPVATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKYK----GELCAVCT   80 (122)
Q Consensus        10 ~~va~qArKIl~~ce~~~tDa~eIdYD~~npF~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~k----G~lC~VC~   80 (122)
                      ..+.+.+++||+.+=.......  ..+....|    .. .-+| |..-..||-||+.....--    --.|+.|+
T Consensus       196 ~~L~~~i~~vl~~ai~~gg~~~--~~~~~g~~----~~-~~Vy-~r~g~~Cp~Cg~~I~~~~~~gR~t~~CP~CQ  262 (263)
T PRK10445        196 DALAHALLDIPRLSYATRGQVD--ENKHHGAL----FR-FKVF-HRDGEACERCGGIIEKTTLSSRPFYWCPGCQ  262 (263)
T ss_pred             HHHHHHHHHHHHHHHHcCCCCC--CCCCCCCc----ce-EEEe-CCCCCCCCCCCCEeEEEEECCCCcEECCCCc
Confidence            4456778888887654432221  00111222    11 2345 3444568888887653221    22566665


No 176
>PF14122 YokU:  YokU-like protein
Probab=25.48  E-value=41  Score=24.20  Aligned_cols=18  Identities=22%  Similarity=0.523  Sum_probs=16.0

Q ss_pred             CCCcceecCCCCceecCC
Q psy2693          53 HGRESEACVYCGASYLPK   70 (122)
Q Consensus        53 ~G~~~v~CP~CgA~Y~p~   70 (122)
                      ...|++.|.-||..|..+
T Consensus        31 ~~tP~i~C~~CgmvYq~d   48 (87)
T PF14122_consen   31 TDTPAIICSNCGMVYQDD   48 (87)
T ss_pred             cCCceeeecCCCcEEehh
Confidence            567999999999999876


No 177
>PF13597 NRDD:  Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A.
Probab=25.44  E-value=77  Score=28.61  Aligned_cols=49  Identities=24%  Similarity=0.395  Sum_probs=18.8

Q ss_pred             HHHHHHHHHHHHhc-CCCCceeecCCCCCCeeeecccceeccCCCcceecCCCCcee
Q psy2693          12 VATQARKLLAICNA-NPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASY   67 (122)
Q Consensus        12 va~qArKIl~~ce~-~~tDa~eIdYD~~npF~ICa~S~tPIY~G~~~v~CP~CgA~Y   67 (122)
                      -.++.++++..+=+ ....=+.|++    ||++|..=-.   .+.....||.||+.-
T Consensus       465 n~~al~~lv~~~~~~~~i~Y~~in~----~~~~C~~CG~---~~~~~~~CP~CGs~~  514 (546)
T PF13597_consen  465 NPEALEKLVRYAMENTGIPYFTINP----PIDICPDCGY---IGGEGDKCPKCGSEN  514 (546)
T ss_dssp             -HHHHHHHHHHHHH--H-SEEEEE------EEEETTT------S--EEE-CCC----
T ss_pred             CHHHHHHHHHHHHHhCCCCeEEEec----CcccccCCCc---CCCCCCCCCCCCCcc
Confidence            44556666665544 2222233333    3777755432   223366777777763


No 178
>PRK09710 lar restriction alleviation and modification protein; Reviewed
Probab=25.21  E-value=30  Score=23.52  Aligned_cols=9  Identities=33%  Similarity=1.305  Sum_probs=6.9

Q ss_pred             eecCCCCce
Q psy2693          58 EACVYCGAS   66 (122)
Q Consensus        58 v~CP~CgA~   66 (122)
                      .-|||||-.
T Consensus         7 KPCPFCG~~   15 (64)
T PRK09710          7 KPCPFCGCP   15 (64)
T ss_pred             cCCCCCCCc
Confidence            459999964


No 179
>PF11238 DUF3039:  Protein of unknown function (DUF3039);  InterPro: IPR021400  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=24.80  E-value=23  Score=23.72  Aligned_cols=27  Identities=19%  Similarity=0.544  Sum_probs=20.9

Q ss_pred             eeecccceeccCCCcceecCCCCceec
Q psy2693          42 QICARSYTPIYHGRESEACVYCGASYL   68 (122)
Q Consensus        42 ~ICa~S~tPIY~G~~~v~CP~CgA~Y~   68 (122)
                      .+|+..|.|.-.-+++-.||-|...|.
T Consensus        29 ALCGk~wvp~rdp~~~PVCP~Ck~iye   55 (58)
T PF11238_consen   29 ALCGKVWVPTRDPKPFPVCPECKEIYE   55 (58)
T ss_pred             eeeCceeCCCCCCCCCCCCcCHHHHHH
Confidence            589999999766677888888877663


No 180
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=24.46  E-value=37  Score=24.10  Aligned_cols=22  Identities=23%  Similarity=0.685  Sum_probs=8.6

Q ss_pred             cCCCCCcccCcccceeecCCCcccC
Q psy2693          68 LPKYKGELCAVCTVSVIDTHRNAYG   92 (122)
Q Consensus        68 ~p~~kG~lC~VC~ls~IG~~~~a~G   92 (122)
                      +.+..|++|.||+ -.||  ..+.|
T Consensus         4 ~k~~~~qiCqiCG-D~VG--l~~~G   25 (80)
T PF14569_consen    4 LKNLNGQICQICG-DDVG--LTENG   25 (80)
T ss_dssp             -S--SS-B-SSS---B----B-SSS
T ss_pred             hhhcCCccccccc-Cccc--cCCCC
Confidence            4567899999997 3455  44444


No 181
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=24.45  E-value=33  Score=23.49  Aligned_cols=9  Identities=22%  Similarity=0.648  Sum_probs=7.7

Q ss_pred             ecCCCCcee
Q psy2693          59 ACVYCGASY   67 (122)
Q Consensus        59 ~CP~CgA~Y   67 (122)
                      .||+||+..
T Consensus         3 ~CP~Cg~~a   11 (72)
T PRK09678          3 HCPLCQHAA   11 (72)
T ss_pred             cCCCCCCcc
Confidence            699999876


No 182
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=23.98  E-value=37  Score=19.92  Aligned_cols=10  Identities=30%  Similarity=0.803  Sum_probs=6.9

Q ss_pred             eecCCCCcee
Q psy2693          58 EACVYCGASY   67 (122)
Q Consensus        58 v~CP~CgA~Y   67 (122)
                      ..||.||+.-
T Consensus         3 ~~Cp~Cg~~~   12 (47)
T PF14690_consen    3 PRCPHCGSPS   12 (47)
T ss_pred             ccCCCcCCCc
Confidence            4688888554


No 183
>PRK14894 glycyl-tRNA synthetase; Provisional
Probab=23.82  E-value=50  Score=30.52  Aligned_cols=40  Identities=18%  Similarity=0.289  Sum_probs=31.1

Q ss_pred             eeeecccceec----cCC------CcceecCCCCceecCCCCCcccCccc
Q psy2693          41 FQICARSYTPI----YHG------RESEACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        41 F~ICa~S~tPI----Y~G------~~~v~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      +.|.+..++|-    +.|      .+.|.|.-|+.+|-.+.-...|+.|+
T Consensus        62 ~~id~~il~~~~v~~aSGH~~~F~DpmV~CkkCk~ryRaD~LiikCP~CG  111 (539)
T PRK14894         62 EGLDAAILMNRLVWKYSGHEETFNDPLVDCRDCKMRWRADHIQGVCPNCG  111 (539)
T ss_pred             EEeeccccCCHhHeeeccCCCCCCCceeECCCCCccccCccceeeCCCCC
Confidence            56777777662    223      67899999999998887777899997


No 184
>PRK14526 adenylate kinase; Provisional
Probab=23.40  E-value=51  Score=25.79  Aligned_cols=30  Identities=17%  Similarity=0.401  Sum_probs=19.7

Q ss_pred             cceecCCCCceecCCCC----CcccCcccceeec
Q psy2693          56 ESEACVYCGASYLPKYK----GELCAVCTVSVID   85 (122)
Q Consensus        56 ~~v~CP~CgA~Y~p~~k----G~lC~VC~ls~IG   85 (122)
                      ..-.||-||..|+-.|.    ...|.+|+=--++
T Consensus       121 ~R~~~~~~g~~y~~~~~pp~~~~~~~~~~~~l~~  154 (211)
T PRK14526        121 GRRICKSCNNIFNIYTLPTKEKGICDVCKGDLYQ  154 (211)
T ss_pred             CCCcccccCCccccccCCCCccCcCCCCCCeeec
Confidence            34569999999985543    4467777533333


No 185
>PHA02942 putative transposase; Provisional
Probab=23.22  E-value=76  Score=27.33  Aligned_cols=33  Identities=24%  Similarity=0.507  Sum_probs=21.2

Q ss_pred             cceecCCCCceecCCCCC--cccCcccceeecCCCcccC
Q psy2693          56 ESEACVYCGASYLPKYKG--ELCAVCTVSVIDTHRNAYG   92 (122)
Q Consensus        56 ~~v~CP~CgA~Y~p~~kG--~lC~VC~ls~IG~~~~a~G   92 (122)
                      .+-.||.||.... +..+  -.|+-|+.. ..  ++..|
T Consensus       324 TSq~Cs~CG~~~~-~l~~r~f~C~~CG~~-~d--rD~nA  358 (383)
T PHA02942        324 SSVSCPKCGHKMV-EIAHRYFHCPSCGYE-ND--RDVIA  358 (383)
T ss_pred             CCccCCCCCCccC-cCCCCEEECCCCCCE-eC--cHHHH
Confidence            5678999998764 3333  378888874 33  55443


No 186
>PF11475 VP_N-CPKC:  Virion protein N terminal domain ;  InterPro: IPR021573  This is the N-terminal domain of a family of virion proteins which contains a zinc finger domain. Currently no function is known. ; PDB: 2BAI_A.
Probab=23.20  E-value=10  Score=22.52  Aligned_cols=18  Identities=50%  Similarity=0.833  Sum_probs=9.5

Q ss_pred             eeeecccceeccCCCcceecCCCCc
Q psy2693          41 FQICARSYTPIYHGRESEACVYCGA   65 (122)
Q Consensus        41 F~ICa~S~tPIY~G~~~v~CP~CgA   65 (122)
                      -+||+.|++       ++.||-|.|
T Consensus         7 qeicahslt-------f~ecpkcsa   24 (32)
T PF11475_consen    7 QEICAHSLT-------FEECPKCSA   24 (32)
T ss_dssp             S---SSSS--------GGGHHHHH-
T ss_pred             HHHHhcccc-------cccCcchhH
Confidence            368888876       467888876


No 187
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=23.20  E-value=26  Score=29.49  Aligned_cols=23  Identities=30%  Similarity=0.827  Sum_probs=8.4

Q ss_pred             eecCCCCceecCCCCCc------ccCccc
Q psy2693          58 EACVYCGASYLPKYKGE------LCAVCT   80 (122)
Q Consensus        58 v~CP~CgA~Y~p~~kG~------lC~VC~   80 (122)
                      .-||-||+.++.+|...      .|+.|+
T Consensus        32 ~yCP~Cg~~~L~~f~NN~PVaDF~C~~C~   60 (254)
T PF06044_consen   32 MYCPNCGSKPLSKFENNRPVADFYCPNCN   60 (254)
T ss_dssp             ---TTT--SS-EE--------EEE-TTT-
T ss_pred             CcCCCCCChhHhhccCCCccceeECCCCc
Confidence            46888888877777554      577774


No 188
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=23.18  E-value=45  Score=27.07  Aligned_cols=21  Identities=19%  Similarity=0.425  Sum_probs=13.8

Q ss_pred             CCCcceecCCCCceecCCCCC
Q psy2693          53 HGRESEACVYCGASYLPKYKG   73 (122)
Q Consensus        53 ~G~~~v~CP~CgA~Y~p~~kG   73 (122)
                      .+.-.-.||-||..+.|....
T Consensus       113 ~~~~~~~C~~c~~~~yp~~~p  133 (256)
T PRK00241        113 KTEWAMLCPHCRERYYPRIAP  133 (256)
T ss_pred             CCceeEECCCCCCEECCCCCC
Confidence            344556688888777777543


No 189
>TIGR01374 soxD sarcosine oxidase, delta subunit family, heterotetrameric form. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) form
Probab=22.98  E-value=31  Score=24.44  Aligned_cols=14  Identities=29%  Similarity=0.790  Sum_probs=10.9

Q ss_pred             eecCCCCceecCCC
Q psy2693          58 EACVYCGASYLPKY   71 (122)
Q Consensus        58 v~CP~CgA~Y~p~~   71 (122)
                      +.||+||.+=..+|
T Consensus         2 I~CP~CG~R~~~EF   15 (84)
T TIGR01374         2 IPCPYCGPRPEEEF   15 (84)
T ss_pred             ccCCCCCCccHhhE
Confidence            57999997766665


No 190
>cd03531 Rieske_RO_Alpha_KSH The alignment model represents the N-terminal rieske iron-sulfur domain of KshA, the oxygenase component of 3-ketosteroid 9-alpha-hydroxylase (KSH).  The terminal oxygenase component of KSH is a key enzyme in the microbial steroid degradation pathway, catalyzing the 9 alpha-hydroxylation of 4-androstene-3,17-dione (AD) and 1,4-androstadiene-3,17-dione (ADD). KSH is a two-component class IA monooxygenase, with terminal oxygenase (KshA) and oxygenase reductase (KshB) components.  KSH activity has been found in many actino- and proteo- bacterial genera including Rhodococcus, Nocardia, Arthrobacter, Mycobacterium, and Burkholderia.
Probab=22.87  E-value=84  Score=22.05  Aligned_cols=56  Identities=13%  Similarity=0.144  Sum_probs=32.7

Q ss_pred             eecccceeccCC---CcceecCCCCceecCCCCCcccCcccceeecCCCcccCcceecccchhh
Q psy2693          43 ICARSYTPIYHG---RESEACVYCGASYLPKYKGELCAVCTVSVIDTHRNAYGLQICAGLMKSD  103 (122)
Q Consensus        43 ICa~S~tPIY~G---~~~v~CP~CgA~Y~p~~kG~lC~VC~ls~IG~~~~a~GLr~~~~~~~~~  103 (122)
                      +|.---.|+-.|   ...++|||-|..|..  .|+.-.+-....+.   ...+|+.....-+.+
T Consensus        42 ~CpH~ga~L~~G~~~~~~i~CP~Hg~~fd~--~G~~~~~p~~~~~p---~~~~l~~ypv~~~~g  100 (115)
T cd03531          42 YCRHMGGDLSQGTVKGDEIACPFHDWRWGG--DGRCKAIPYARRVP---PLARTRAWPTLERNG  100 (115)
T ss_pred             cCCCCCCCCccCcccCCEEECCCCCCEECC--CCCEEECCcccCCC---cccccceEeEEEECC
Confidence            566666666544   357999999999998  58655442222222   234455554444443


No 191
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=22.78  E-value=1.4e+02  Score=24.31  Aligned_cols=65  Identities=26%  Similarity=0.452  Sum_probs=34.9

Q ss_pred             hHHHHHHHHHHHHHhcCCCCceeecCCC----CCCeeeecccceeccCCCcceecCCCCceecCCCCC----cccCccc
Q psy2693          10 IPVATQARKLLAICNANPTDEHTIDYDE----HNPFQICARSYTPIYHGRESEACVYCGASYLPKYKG----ELCAVCT   80 (122)
Q Consensus        10 ~~va~qArKIl~~ce~~~tDa~eIdYD~----~npF~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG----~lC~VC~   80 (122)
                      ..+.+.+++|++.+-+.+...+. +|-.    ...|.    ..--+| |..-..||-||+.....--|    -.|+.|+
T Consensus       200 ~~L~~~~~~vl~~ai~~gg~t~~-~~~~~~g~~g~~~----~~l~Vy-~R~g~pC~~Cg~~I~~~~~~gR~t~~CP~CQ  272 (274)
T PRK01103        200 ERLVDAIKAVLAEAIEQGGTTLR-DYVNADGKPGYFQ----QSLQVY-GREGEPCRRCGTPIEKIKQGGRSTFFCPRCQ  272 (274)
T ss_pred             HHHHHHHHHHHHHHHHcCCCccc-cccccCCCCCCcc----ceeEEc-CCCCCCCCCCCCeeEEEEECCCCcEECcCCC
Confidence            45567799999988776544332 3321    11121    111245 23334588888776643333    3577776


No 192
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=22.64  E-value=39  Score=25.06  Aligned_cols=24  Identities=21%  Similarity=0.605  Sum_probs=16.5

Q ss_pred             cCCCCceecCCCCCcccCcccceeec
Q psy2693          60 CVYCGASYLPKYKGELCAVCTVSVID   85 (122)
Q Consensus        60 CP~CgA~Y~p~~kG~lC~VC~ls~IG   85 (122)
                      ||.||....-.  .--|+.|+..--|
T Consensus         1 CPvCg~~l~vt--~l~C~~C~t~i~G   24 (113)
T PF09862_consen    1 CPVCGGELVVT--RLKCPSCGTEIEG   24 (113)
T ss_pred             CCCCCCceEEE--EEEcCCCCCEEEe
Confidence            77777766544  4457777777777


No 193
>PRK08579 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=22.61  E-value=52  Score=30.48  Aligned_cols=22  Identities=27%  Similarity=0.487  Sum_probs=10.1

Q ss_pred             ceecCCCCceecCCCCCcccCccc
Q psy2693          57 SEACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        57 ~v~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      ...|+-||..+.-.  +..||+|+
T Consensus       568 ~~~C~~CG~~~~g~--~~~CP~CG  589 (625)
T PRK08579        568 ITVCNKCGRSTTGL--YTRCPRCG  589 (625)
T ss_pred             CccCCCCCCccCCC--CCcCcCCC
Confidence            34455555543211  44555554


No 194
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=22.52  E-value=78  Score=19.09  Aligned_cols=15  Identities=33%  Similarity=0.775  Sum_probs=12.2

Q ss_pred             CCCcceecCCCCcee
Q psy2693          53 HGRESEACVYCGASY   67 (122)
Q Consensus        53 ~G~~~v~CP~CgA~Y   67 (122)
                      .+.+.|+||.||..+
T Consensus        36 ~~~~~v~C~~C~~~f   50 (64)
T smart00647       36 EGCNRVTCPKCGFSF   50 (64)
T ss_pred             CCCCeeECCCCCCeE
Confidence            378899999998766


No 195
>PRK09603 bifunctional DNA-directed RNA polymerase subunit beta/beta'; Reviewed
Probab=22.48  E-value=96  Score=34.13  Aligned_cols=62  Identities=24%  Similarity=0.557  Sum_probs=43.6

Q ss_pred             HHHHHHHhcCCCCceeecCCCCCC---eeeecccceeccCCCcceecCCCCceecCCCCCc-ccCccccee
Q psy2693          17 RKLLAICNANPTDEHTIDYDEHNP---FQICARSYTPIYHGRESEACVYCGASYLPKYKGE-LCAVCTVSV   83 (122)
Q Consensus        17 rKIl~~ce~~~tDa~eIdYD~~np---F~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~-lC~VC~ls~   83 (122)
                      .+|+..+--.=+..-.|||-.+.|   =-.|..=|-|+.    ...| .||..-..+|+|. +|.-|++-.
T Consensus      1407 e~I~~ws~GeV~kpeTinyrt~kPe~dGLFcerIFGp~k----d~eC-~Cgkyk~~~~~g~~~C~~Cgvev 1472 (2890)
T PRK09603       1407 EKIHSWSYGEVKKPETINYRTLKPERDGLFCMKIFGPTK----DYEC-LCGKYKKPRFKDIGTCEKCGVAI 1472 (2890)
T ss_pred             HHHHHhhceeEccccccccccCccCCCCEeeceeccCcc----CcEE-eCCCcccccCCCCEEcCCCCcEe
Confidence            456666655556666899976654   347888888863    4678 8995334789999 999997643


No 196
>cd03469 Rieske_RO_Alpha_N Rieske non-heme iron oxygenase (RO) family, N-terminal Rieske domain of the oxygenase alpha subunit; The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms. These enzymes enable microorganisms to tolerate and even exclusively utilize aromatic compounds for growth. ROs consist of two or three components: reductase, oxygenase, and ferredoxin (in some cases) components. The oxygenase component may contain alpha and beta subunits, with the beta subunit having a purely structural function. Some oxygenase components contain only an alpha subunit. The oxygenase alpha subunit has two domains, an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from the reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. Reduced pyridine nucleotide is used as the i
Probab=22.39  E-value=93  Score=21.13  Aligned_cols=32  Identities=22%  Similarity=0.470  Sum_probs=23.8

Q ss_pred             eeecccceeccC----CCcceecCCCCceecCCCCCcc
Q psy2693          42 QICARSYTPIYH----GRESEACVYCGASYLPKYKGEL   75 (122)
Q Consensus        42 ~ICa~S~tPIY~----G~~~v~CP~CgA~Y~p~~kG~l   75 (122)
                      ++|.---.|+..    ....+.|||-|+.|..+  |+.
T Consensus        41 n~CpH~g~~L~~g~~~~~~~i~Cp~Hg~~Fd~~--G~~   76 (118)
T cd03469          41 NVCPHRGARLCEGRGGNAGRLVCPYHGWTYDLD--GKL   76 (118)
T ss_pred             EeCCCCCCEeeeccCCCCCEEECCCCCCEECCC--CcE
Confidence            466666666644    34589999999999998  864


No 197
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis]
Probab=22.35  E-value=55  Score=22.03  Aligned_cols=18  Identities=44%  Similarity=0.951  Sum_probs=9.1

Q ss_pred             ecCCCCceecCCCCCcccCccc
Q psy2693          59 ACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        59 ~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      +||-||..-+.    ..|++|+
T Consensus         7 kC~~cg~YTLk----e~Cp~CG   24 (59)
T COG2260           7 KCPKCGRYTLK----EKCPVCG   24 (59)
T ss_pred             cCcCCCceeec----ccCCCCC
Confidence            45555554443    3566654


No 198
>TIGR02378 nirD_assim_sml nitrite reductase [NAD(P)H], small subunit. This model describes NirD, the small subunit of nitrite reductase [NAD(P)H] (the assimilatory nitrite reductase), which associates with NirB, the large subunit (TIGR02374). In a few bacteria such as Klebsiella pneumoniae and in Fungi, the two regions are fused.
Probab=22.35  E-value=55  Score=22.21  Aligned_cols=17  Identities=18%  Similarity=0.278  Sum_probs=14.3

Q ss_pred             ceecCCCCceecCCCCCc
Q psy2693          57 SEACVYCGASYLPKYKGE   74 (122)
Q Consensus        57 ~v~CP~CgA~Y~p~~kG~   74 (122)
                      .+.||+.|+.|..+ .|.
T Consensus        64 ~i~Cp~Hg~~Fdl~-tG~   80 (105)
T TIGR02378        64 WVACPLHKRNFRLE-DGR   80 (105)
T ss_pred             EEECCcCCCEEEcC-Ccc
Confidence            49999999999987 454


No 199
>PRK08329 threonine synthase; Validated
Probab=22.31  E-value=49  Score=27.56  Aligned_cols=21  Identities=38%  Similarity=0.872  Sum_probs=16.1

Q ss_pred             eecCCCCceecCCCCCcccCccc
Q psy2693          58 EACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        58 v~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      .+|+-||..|.+++. ..| -|+
T Consensus         2 l~C~~Cg~~~~~~~~-~~C-~c~   22 (347)
T PRK08329          2 LRCTKCGRTYEEKFK-LRC-DCG   22 (347)
T ss_pred             cCcCCCCCCcCCCCc-eec-CCC
Confidence            479999999987765 678 574


No 200
>COG0333 RpmF Ribosomal protein L32 [Translation, ribosomal structure and biogenesis]
Probab=22.26  E-value=57  Score=21.59  Aligned_cols=22  Identities=32%  Similarity=0.771  Sum_probs=17.4

Q ss_pred             ceecCCCCceecCCCCCcccCcccc
Q psy2693          57 SEACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus        57 ~v~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      .+.||-||..-+|   ..+|..|+.
T Consensus        27 ~~~c~~cG~~~l~---Hrvc~~cg~   48 (57)
T COG0333          27 LSVCPNCGEYKLP---HRVCLKCGY   48 (57)
T ss_pred             ceeccCCCCcccC---ceEcCCCCC
Confidence            5789999988777   478888873


No 201
>PRK00420 hypothetical protein; Validated
Probab=22.18  E-value=60  Score=23.97  Aligned_cols=28  Identities=21%  Similarity=0.469  Sum_probs=19.1

Q ss_pred             ecccceeccC-CCcceecCCCCceecCCC
Q psy2693          44 CARSYTPIYH-GRESEACVYCGASYLPKY   71 (122)
Q Consensus        44 Ca~S~tPIY~-G~~~v~CP~CgA~Y~p~~   71 (122)
                      |..=-+|.++ -...+.||-||..+.-+-
T Consensus        26 CP~Cg~pLf~lk~g~~~Cp~Cg~~~~v~~   54 (112)
T PRK00420         26 CPVCGLPLFELKDGEVVCPVHGKVYIVKS   54 (112)
T ss_pred             CCCCCCcceecCCCceECCCCCCeeeecc
Confidence            3333366665 466899999999887543


No 202
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=22.12  E-value=56  Score=30.35  Aligned_cols=11  Identities=45%  Similarity=0.510  Sum_probs=5.4

Q ss_pred             HHHHHHHHHHH
Q psy2693          13 ATQARKLLAIC   23 (122)
Q Consensus        13 a~qArKIl~~c   23 (122)
                      .+..++++..+
T Consensus       542 ~eal~~lv~~~  552 (623)
T PRK08271        542 EEGYRKLLNIA  552 (623)
T ss_pred             HHHHHHHHHHH
Confidence            34455555544


No 203
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=22.04  E-value=41  Score=25.25  Aligned_cols=25  Identities=20%  Similarity=0.420  Sum_probs=13.3

Q ss_pred             cceecCCCCceecCCCCCcccCccc
Q psy2693          56 ESEACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        56 ~~v~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      ..|+||-|+...+--=+-..|.-|+
T Consensus        68 v~V~CP~C~K~TKmLGr~D~CM~C~   92 (114)
T PF11023_consen   68 VQVECPNCGKQTKMLGRVDACMHCK   92 (114)
T ss_pred             eeeECCCCCChHhhhchhhccCcCC
Confidence            4566777776654332234555553


No 204
>TIGR02386 rpoC_TIGR DNA-directed RNA polymerase, beta' subunit, predominant form. Bacteria have a single DNA-directed RNA polymerase, with required subunits that include alpha, beta, and beta-prime. This model describes the predominant architecture of the beta-prime subunit in most bacteria. This model excludes from among the bacterial mostly sequences from the cyanobacteria, where RpoC is replaced by two tandem genes homologous to it but also encoding an additional domain.
Probab=21.85  E-value=91  Score=31.26  Aligned_cols=61  Identities=28%  Similarity=0.586  Sum_probs=39.3

Q ss_pred             HHHHHHhcCCCCceeecCCCCCC---eeeecccceeccCCCcceecCCCCceecCCCCCcccCccccee
Q psy2693          18 KLLAICNANPTDEHTIDYDEHNP---FQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTVSV   83 (122)
Q Consensus        18 KIl~~ce~~~tDa~eIdYD~~np---F~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC~ls~   83 (122)
                      +|++.+--.=+..-.|||-...|   =-.|..=|-|+.    ...| .||..-..+|+|.+|..|++--
T Consensus        11 ~I~~ws~geV~~petiny~t~kPe~~GLfcerIFGp~k----~~ec-~Cgkyk~~~~~~~~C~~Cgve~   74 (1140)
T TIGR02386        11 TIRNWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTK----DWEC-YCGKYKKIRYKGVVCERCGVEV   74 (1140)
T ss_pred             HHHhhhceEEeccceecCCCCccCCCCcccchhcCCcc----Ccee-ccccccccCcCCcCCCCCCCCc
Confidence            34444433334556888864443   336888788863    4678 7995333578999999997643


No 205
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=21.68  E-value=25  Score=26.80  Aligned_cols=27  Identities=33%  Similarity=0.626  Sum_probs=17.5

Q ss_pred             ccceec----cCCCcceecCCCCceecCCCCC
Q psy2693          46 RSYTPI----YHGRESEACVYCGASYLPKYKG   73 (122)
Q Consensus        46 ~S~tPI----Y~G~~~v~CP~CgA~Y~p~~kG   73 (122)
                      .|+.++    .+|++ .+||-||..|.-++-|
T Consensus        98 ~sH~v~W~~l~~g~~-~RCpeCG~~fkL~~vg  128 (136)
T PF01215_consen   98 DSHDVIWFWLHKGKP-QRCPECGQVFKLKYVG  128 (136)
T ss_dssp             -SSS-EEEEEETTSE-EEETTTEEEEEEEE--
T ss_pred             CcceeEEEEEeCCCc-cCCCCCCeEEEEEEcC
Confidence            454554    47875 7999999999876644


No 206
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=21.58  E-value=46  Score=21.38  Aligned_cols=34  Identities=18%  Similarity=0.477  Sum_probs=17.1

Q ss_pred             eeecccceeccCCCcceecCCCCceecC--------CCCCcccCc
Q psy2693          42 QICARSYTPIYHGRESEACVYCGASYLP--------KYKGELCAV   78 (122)
Q Consensus        42 ~ICa~S~tPIY~G~~~v~CP~CgA~Y~p--------~~kG~lC~V   78 (122)
                      .+|..|..|+   +..|+..-||-.|..        ..+..-|++
T Consensus        12 ~~CPiT~~~~---~~PV~s~~C~H~fek~aI~~~i~~~~~~~CPv   53 (57)
T PF11789_consen   12 LKCPITLQPF---EDPVKSKKCGHTFEKEAILQYIQRNGSKRCPV   53 (57)
T ss_dssp             SB-TTTSSB----SSEEEESSS--EEEHHHHHHHCTTTS-EE-SC
T ss_pred             cCCCCcCChh---hCCcCcCCCCCeecHHHHHHHHHhcCCCCCCC
Confidence            3677777776   566666677766543        244555655


No 207
>PF04267 SoxD:  Sarcosine oxidase, delta subunit family ;  InterPro: IPR006279 These sequences represent the delta subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Rhizobium loti (Mesorhizobium loti) and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members share the same function. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate [].  Bacterial sarcosine oxidases have been isolated from over a dozen different organisms and fall into two major classes (1) monomeric form that contains only covalent flavin and (2) heterotetrameric (alpha, beta, gamma, delta) form that contain a covalent and noncovalent flavin, this entry represents the heterotetrameric form.; GO: 0008115 sarcosine oxidase activity, 0046653 tetrahydrofolate metabolic process; PDB: 3AD7_D 1X31_D 1VRQ_D 3AD8_D 3ADA_D 3AD9_D 2GAG_D 2GAH_D.
Probab=21.57  E-value=36  Score=24.08  Aligned_cols=14  Identities=21%  Similarity=0.581  Sum_probs=11.3

Q ss_pred             eecCCCCceecCCC
Q psy2693          58 EACVYCGASYLPKY   71 (122)
Q Consensus        58 v~CP~CgA~Y~p~~   71 (122)
                      +.||+||.+=..+|
T Consensus         2 I~CP~CG~R~~~EF   15 (84)
T PF04267_consen    2 IPCPHCGPRDESEF   15 (84)
T ss_dssp             EEETTTEEEEGGGS
T ss_pred             ccCCCCCccchhhe
Confidence            47999999877776


No 208
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=21.54  E-value=1.7e+02  Score=23.82  Aligned_cols=66  Identities=18%  Similarity=0.243  Sum_probs=32.4

Q ss_pred             hHHHHHHHHHHHHHhcCCCCceeecCCC---CCCeeeecccceeccCCCcceecCCCCceecCCCC----CcccCccc
Q psy2693          10 IPVATQARKLLAICNANPTDEHTIDYDE---HNPFQICARSYTPIYHGRESEACVYCGASYLPKYK----GELCAVCT   80 (122)
Q Consensus        10 ~~va~qArKIl~~ce~~~tDa~eIdYD~---~npF~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~k----G~lC~VC~   80 (122)
                      ..+.+..+.|++.+-+.+...+.--.+.   ...|.   ..| -+| |..-..||-||+.....--    --.|+.|+
T Consensus       199 ~~l~~a~~~vl~~ai~~gg~~~~~~~~~~g~~g~~~---~~~-~Vy-~R~g~pCprCG~~I~~~~~~gR~t~~CP~CQ  271 (272)
T PRK14810        199 RKLHDAIGEVLREAIELGGSSVSDYVDAEGRSGFFQ---LSH-RVY-QRTGEPCLNCKTPIRRVVVAGRSSHYCPHCQ  271 (272)
T ss_pred             HHHHHHHHHHHHHHHHcCCCccccccCCCCCCCcch---hhE-eec-CCCCCcCCCCCCeeEEEEECCCccEECcCCc
Confidence            3445667888887776655443211111   11221   111 245 3444458888876642211    23566665


No 209
>PRK14844 bifunctional DNA-directed RNA polymerase subunit beta/beta'; Provisional
Probab=21.50  E-value=92  Score=34.18  Aligned_cols=62  Identities=21%  Similarity=0.533  Sum_probs=42.1

Q ss_pred             HHHHHHHhcCCCCceeecCCCCCC---eeeecccceeccCCCcceecCCCCceecCCCCCcccCccccee
Q psy2693          17 RKLLAICNANPTDEHTIDYDEHNP---FQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTVSV   83 (122)
Q Consensus        17 rKIl~~ce~~~tDa~eIdYD~~np---F~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC~ls~   83 (122)
                      .+|+..+--.=+..-.|||-.+.|   =-.|..=|-|+.    ...| .||..-..+|+|.+|.-|++-.
T Consensus      1459 e~I~~Ws~GeV~kpeTinyrt~kPE~dGLFcerIFGp~k----d~eC-~Cgkyk~~~~~g~~C~~Cgvev 1523 (2836)
T PRK14844       1459 ESIKRMSYGEIEDVSTANYRTFKVEKGGLFCPKIFGPVN----DDEC-LCGKYKKRRHRGRICEKCGVEV 1523 (2836)
T ss_pred             HHHHhhhceeECCcccccccCCCCCCCCeehhhhcCCCc----CcEE-ecccccccccCCcCcCCCCcEe
Confidence            455555544445666888865544   336888888863    4678 8995333589999999997643


No 210
>cd03474 Rieske_T4moC Toluene-4-monooxygenase effector protein complex (T4mo), Rieske ferredoxin subunit; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. T4mo is a four-protein complex that catalyzes the NADH- and O2-dependent hydroxylation of toluene to form p-cresol. T4mo consists of an NADH oxidoreductase (T4moF), a diiron hydroxylase (T4moH), a catalytic effector protein (T4moD), and a Rieske ferredoxin (T4moC). T4moC contains a Rieske domain and functions as an obligate electron carrier between T4moF and T4moH. Rieske ferredoxins are found as subunits of membrane oxidase complexes, cis-dihydrodiol-forming aromatic dioxygenases, bacterial assimilatory nitrite reductases, and arsenite oxidase. Rieske ferredoxins are also found as soluble electron carriers in bacterial dioxygenase and monooxygenase complexes.
Probab=20.88  E-value=1e+02  Score=20.89  Aligned_cols=51  Identities=12%  Similarity=0.117  Sum_probs=34.1

Q ss_pred             eeecccceeccCC---CcceecCCCCceecCCCCCcccCcccceeecCCCcccCcceecccchhh
Q psy2693          42 QICARSYTPIYHG---RESEACVYCGASYLPKYKGELCAVCTVSVIDTHRNAYGLQICAGLMKSD  103 (122)
Q Consensus        42 ~ICa~S~tPIY~G---~~~v~CP~CgA~Y~p~~kG~lC~VC~ls~IG~~~~a~GLr~~~~~~~~~  103 (122)
                      ++|.---.|+-.|   ...+.||+=|+.|..+  |..|       ++  ....+|+......+.+
T Consensus        40 n~CpH~g~~L~~g~~~g~~i~CP~Hg~~Fdl~--~G~~-------~~--~~~~~L~~~~v~v~~g   93 (108)
T cd03474          40 GICPHQEIPLAEGGFDGGVLTCRAHLWQFDAD--TGEG-------LN--PRDCRLARYPVKVEGG   93 (108)
T ss_pred             CcCCCCCCCcccCcccCCEEEeCCcCCEEECC--Cccc-------cC--CCCCccceEeEEEECC
Confidence            3677666676544   2479999999999987  4333       24  4556777766666554


No 211
>PF11793 FANCL_C:  FANCL C-terminal domain; PDB: 3K1L_A.
Probab=20.82  E-value=42  Score=22.15  Aligned_cols=13  Identities=23%  Similarity=0.575  Sum_probs=7.7

Q ss_pred             eecCCCCceecCC
Q psy2693          58 EACVYCGASYLPK   70 (122)
Q Consensus        58 v~CP~CgA~Y~p~   70 (122)
                      -+||||.+...-+
T Consensus        56 G~CP~C~~~i~~~   68 (70)
T PF11793_consen   56 GECPYCSSPISWS   68 (70)
T ss_dssp             EE-TTT-SEEEGG
T ss_pred             cCCcCCCCeeeEe
Confidence            5799998876543


No 212
>PHA02551 19 tail tube protein; Provisional
Probab=20.79  E-value=59  Score=25.45  Aligned_cols=22  Identities=18%  Similarity=0.406  Sum_probs=18.5

Q ss_pred             CceeecCCCCCCeeeeccccee
Q psy2693          29 DEHTIDYDEHNPFQICARSYTP   50 (122)
Q Consensus        29 Da~eIdYD~~npF~ICa~S~tP   50 (122)
                      -++|++||+.|+...|..+|.-
T Consensus       138 geveLdy~~nn~i~tF~Vtf~y  159 (163)
T PHA02551        138 GEIDLDWDSNNEIETFEVTFAL  159 (163)
T ss_pred             cceeecccCCCcEEEEEEEEEe
Confidence            4789999999999988888753


No 213
>PRK05638 threonine synthase; Validated
Probab=20.72  E-value=58  Score=28.07  Aligned_cols=21  Identities=29%  Similarity=0.812  Sum_probs=15.5

Q ss_pred             eecCCCCceecCCCCCcccCccc
Q psy2693          58 EACVYCGASYLPKYKGELCAVCT   80 (122)
Q Consensus        58 v~CP~CgA~Y~p~~kG~lC~VC~   80 (122)
                      .+|+-||..|.+++. ..| -|+
T Consensus         2 l~C~~Cg~~~~~~~~-~~C-~c~   22 (442)
T PRK05638          2 MKCPKCGREYNSYIP-PFC-ICG   22 (442)
T ss_pred             eEeCCCCCCCCCCCc-eec-CCC
Confidence            478888888877665 668 674


No 214
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=20.51  E-value=43  Score=26.37  Aligned_cols=22  Identities=32%  Similarity=0.856  Sum_probs=14.2

Q ss_pred             ecCCCCceec------CCCCC------cccCccc
Q psy2693          59 ACVYCGASYL------PKYKG------ELCAVCT   80 (122)
Q Consensus        59 ~CP~CgA~Y~------p~~kG------~lC~VC~   80 (122)
                      +||||++...      |.-.|      .-|..|+
T Consensus         2 ~CPfC~~~~tkViDSR~~edg~aIRRRReC~~C~   35 (156)
T COG1327           2 KCPFCGHEDTKVIDSRPAEEGNAIRRRRECLECG   35 (156)
T ss_pred             CCCCCCCCCCeeeecccccccchhhhhhcccccc
Confidence            6999997653      22334      3588886


No 215
>TIGR02827 RNR_anaer_Bdell anaerobic ribonucleoside-triphosphate reductase. Members of this family belong to the class III anaerobic ribonucleoside-triphosphate reductases (RNR). These glycine-radical-containing enzymes are oxygen-sensitive and operate under anaerobic conditions. The genes for this family are pair with genes for an acitivating protein that creates a glycine radical. Members of this family, though related, fall outside the scope of TIGR02487, a functionally equivalent protein set; no genome has members in both familes. Identification as RNR is supported by gene pairing with the activating protein, lack of other anaerobic RNR, and presence of an upstream regulatory element strongly conserved upstream of most RNR operons.
Probab=20.19  E-value=1.6e+02  Score=27.20  Aligned_cols=44  Identities=30%  Similarity=0.500  Sum_probs=22.3

Q ss_pred             HHHHHHHHHHhcCCCCceeecCCCCC-Ceeeecc-cceeccCCCcceecCCCCc
Q psy2693          14 TQARKLLAICNANPTDEHTIDYDEHN-PFQICAR-SYTPIYHGRESEACVYCGA   65 (122)
Q Consensus        14 ~qArKIl~~ce~~~tDa~eIdYD~~n-pF~ICa~-S~tPIY~G~~~v~CP~CgA   65 (122)
                      +..++++..+-++     .|.|=..| +|+||.. .|  | .|.-...||.||+
T Consensus       509 ea~~~lv~~~~~~-----~i~Y~tin~~~siC~~CGy--~-~g~~~~~CP~CGs  554 (586)
T TIGR02827       509 DGYRKLLRVAADT-----GCNYFCFNIKITICNDCHH--I-DKRTLHRCPVCGS  554 (586)
T ss_pred             HHHHHHHHHHHhc-----CCceEEeCCCCeecCCCCC--c-CCCcCCcCcCCCC
Confidence            4556666654332     34443333 3777753 22  1 3444467777775


No 216
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PF02489 Herpes_glycop_H:  Herpesvirus glycoprotein H;  InterPro: IPR003493 Herpesviruses are enveloped by a lipid bilayer that contains at least a dozen glycoproteins. The virion surface glycoproteins mediate recognition of susceptible cells and promote fusion of the viral envelope with the cell membrane, leading to virus entry. No single glycoprotein associated with the virion membrane has been identified as the fusogen []. Glycoprotein L (gL) forms a non-covalently linked heterodimer with glycoprotein H (gH). This heterodimer is essential for virus-cell and cell-cell fusion since the association of gH and gL is necessary for correct localisation of gH to the virion or cell surface. gH anchoring the heterodimer to the plasma membrane through its transmembrane domain. gL lacks a transmembrane domain and is secreted from cells when expressed in the absence of gH []. This entry represents Herpesvirus glycoprotein H (gH), which is a virion associated envelope glycoprotein []. Heterodimer formation between gH and gL has been demonstrated in both virions and infected cells []. Heterodimer formation between gL and gH is important for the proper folding of gH and its insertion into the membrane because the anti-gH conformation-dependent monoclonal antibodies (mAbs) 53S and LP11 bind gH only when gL is present [, ].; PDB: 3PHF_S 3M1C_A 2LQY_A 2XQY_A.
Probab=20.02  E-value=52  Score=29.94  Aligned_cols=27  Identities=30%  Similarity=0.666  Sum_probs=13.1

Q ss_pred             eeecccceeccCCCcceecCCCCceec
Q psy2693          42 QICARSYTPIYHGRESEACVYCGASYL   68 (122)
Q Consensus        42 ~ICa~S~tPIY~G~~~v~CP~CgA~Y~   68 (122)
                      .+-.....-+|.-++...|+|||+...
T Consensus       546 ~~~~~~i~~~~Nit~~~~C~~Cgsv~l  572 (657)
T PF02489_consen  546 IIETRRIPVVYNITPSKDCPFCGSVFL  572 (657)
T ss_dssp             -SEEEE--EE--SSS-SS-STTT-EEE
T ss_pred             CCCccccCCCcCCCCCCCCCCCCcEEE
Confidence            334445555665557889999999865


Done!