Query         psy2697
Match_columns 165
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 46136
Date          Fri Aug 16 22:54:02 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2697.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2697hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06945 DUF1289:  Protein of u  39.6      22 0.00047   22.8   1.6   22  108-129    23-44  (51)
  2 COG3460 Uncharacterized enzyme  30.9      16 0.00035   28.6  -0.1   15  106-120   102-116 (117)
  3 PF05823 Gp-FAR-1:  Nematode fa  20.8      18 0.00039   27.4  -1.4   53   86-138     6-60  (154)
  4 PF10950 DUF2775:  Protein of u  16.6      41 0.00089   25.1  -0.3   10  114-123     6-15  (108)
  5 PF07237 DUF1428:  Protein of u  15.5      49  0.0011   24.7  -0.1   19  114-132    81-99  (103)
  6 PF11491 DUF3213:  Protein of u  11.0      85  0.0018   23.6   0.0   35   86-120    48-86  (88)
  7 KOG0525|consensus                9.1      88  0.0019   28.1  -0.6   22  130-151   270-297 (362)
  8 COG5559 Uncharacterized conser   8.0 1.2E+02  0.0026   21.8  -0.1   13  111-123    38-50  (65)
  9 KOG3921|consensus                8.0 1.5E+02  0.0033   26.8   0.4   15   17-31     19-33  (360)
 10 PF11372 DUF3173:  Domain of un   7.1 1.7E+02  0.0036   20.2   0.2   28   34-61      6-45  (59)

No 1  
>PF06945 DUF1289:  Protein of unknown function (DUF1289);  InterPro: IPR010710 This family consists of a number of hypothetical bacterial proteins. The aligned region spans around 56 residues and contains 4 highly conserved cysteine residues towards the N terminus. The function of this family is unknown.
Probab=39.61  E-value=22  Score=22.75  Aligned_cols=22  Identities=36%  Similarity=0.682  Sum_probs=18.8

Q ss_pred             CHHHhhhhcccchhhhhhhhhh
Q psy2697         108 DLKEILSWKGVMKDERLDLMKE  129 (165)
Q Consensus       108 dlkeilswkgvmkderldlmke  129 (165)
                      .+.||..|+..-.++|..++..
T Consensus        23 T~dEI~~W~~~s~~er~~i~~~   44 (51)
T PF06945_consen   23 TLDEIRDWKSMSDDERRAILAR   44 (51)
T ss_pred             cHHHHHHHhhCCHHHHHHHHHH
Confidence            4789999999999999888764


No 2  
>COG3460 Uncharacterized enzyme of phenylacetate metabolism [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=30.92  E-value=16  Score=28.61  Aligned_cols=15  Identities=53%  Similarity=0.744  Sum_probs=13.0

Q ss_pred             CcCHHHhhhhcccch
Q psy2697         106 KPDLKEILSWKGVMK  120 (165)
Q Consensus       106 kpdlkeilswkgvmk  120 (165)
                      -||.++++|||||-|
T Consensus       102 ~~De~~~m~~~~~~~  116 (117)
T COG3460         102 IPDEIEHMSWKEVKK  116 (117)
T ss_pred             ccchhceeeecccCC
Confidence            589999999999854


No 3  
>PF05823 Gp-FAR-1:  Nematode fatty acid retinoid binding protein (Gp-FAR-1);  InterPro: IPR008632 Parasitic nematodes produce at least two structurally novel classes of small helix-rich retinol- and fatty-acid-binding proteins that have no counterparts in their plant or animal hosts and thus represent potential targets for new nematicides. Gp-FAR-1 is a member of the nematode-specific fatty-acid- and retinol-binding (FAR) family of proteins but localises to the surface of the organism, placing it in a strategic position for interaction with the host. Gp-FAR-1 functions as a broad-spectrum retinol- and fatty-acid-binding protein, and it is thought that it is involved in the evasion of primary host plant defence systems [].; GO: 0008289 lipid binding; PDB: 2W9Y_A.
Probab=20.79  E-value=18  Score=27.43  Aligned_cols=53  Identities=36%  Similarity=0.411  Sum_probs=32.2

Q ss_pred             hhhhchhhhhhcCccchhccCcCHHHhhhhcccch--hhhhhhhhhhcCCchhcc
Q psy2697          86 MKEEMPDLMKEEKPDLMKEEKPDLKEILSWKGVMK--DERLDLMKEEMPDLKEIL  138 (165)
Q Consensus        86 mkeempdlmkeekpdlmkeekpdlkeilswkgvmk--derldlmkeempdlkeil  138 (165)
                      .|+-+|.-..+.--+|-.+||+.++|+++=-+-.+  |+.++.+|+..|.|.+.+
T Consensus         6 ~k~~iP~ev~~~~~~Lt~eeK~~lkev~~~~~~~~~~de~i~~LK~ksP~L~~k~   60 (154)
T PF05823_consen    6 YKELIPSEVVEFYKNLTPEEKAELKEVAKNYAKFKNEDEMIAALKEKSPSLYEKA   60 (154)
T ss_dssp             HHTT--HHHHHHHHH--TTTHHHHHHHHTT-------TTHHHHHHHH-HHHHHHH
T ss_pred             HHHhCcHHHHHHHHcCCHHHHHHHHHHHHHccccCCHHHHHHHHHHhCHHHHHHH
Confidence            45556666666666777889999999875333333  778999999999887653


No 4  
>PF10950 DUF2775:  Protein of unknown function (DUF2775);  InterPro: IPR024489 This eukaryotic family includes a number of plant organ-specific proteins. While their function is unknown, their predicted amino acid sequence suggests that these proteins could be exported and glycosylated [].
Probab=16.61  E-value=41  Score=25.07  Aligned_cols=10  Identities=60%  Similarity=1.066  Sum_probs=8.1

Q ss_pred             hhcccchhhh
Q psy2697         114 SWKGVMKDER  123 (165)
Q Consensus       114 swkgvmkder  123 (165)
                      -||.||||+-
T Consensus         6 YWK~vMKDqp   15 (108)
T PF10950_consen    6 YWKDVMKDQP   15 (108)
T ss_pred             HHHHhhcCCC
Confidence            3999999963


No 5  
>PF07237 DUF1428:  Protein of unknown function (DUF1428);  InterPro: IPR009874 This family consists of several hypothetical bacterial and one archaeal sequence of around 120 residues in length. The function of this family is unknown.; PDB: 2OKQ_A.
Probab=15.54  E-value=49  Score=24.70  Aligned_cols=19  Identities=37%  Similarity=0.571  Sum_probs=14.0

Q ss_pred             hhcccchhhhhhhhhhhcC
Q psy2697         114 SWKGVMKDERLDLMKEEMP  132 (165)
Q Consensus       114 swkgvmkderldlmkeemp  132 (165)
                      .|.-+|.|.|+.-+.++||
T Consensus        81 ~~~k~m~DPrm~~~~~~mP   99 (103)
T PF07237_consen   81 ANAKMMADPRMQEMDNEMP   99 (103)
T ss_dssp             HHHHHHCSHHHHHTTSS-S
T ss_pred             HHHHhhcCcCcCCCCCCCC
Confidence            3567888999888777776


No 6  
>PF11491 DUF3213:  Protein of unknown function (DUF3213)   ;  InterPro: IPR021583  The backbone structure of this family of proteins has been determined however the function remains unknown. The protein has an alpha and beta structure with a ferredoxin-like fold []. ; PDB: 2F40_A.
Probab=10.98  E-value=85  Score=23.61  Aligned_cols=35  Identities=31%  Similarity=0.695  Sum_probs=10.0

Q ss_pred             hhhhchhhhhhcCccchhccCcCHHH----hhhhcccch
Q psy2697          86 MKEEMPDLMKEEKPDLMKEEKPDLKE----ILSWKGVMK  120 (165)
Q Consensus        86 mkeempdlmkeekpdlmkeekpdlke----ilswkgvmk  120 (165)
                      -+++.-....+-+|....|..-.+.|    -+||+.||+
T Consensus        48 ~~e~lL~~le~~kpEVi~ek~lTveELIE~SmSW~Ni~~   86 (88)
T PF11491_consen   48 SKEELLEMLEEFKPEVIEEKELTVEELIESSMSWNNIMG   86 (88)
T ss_dssp             SHHHH---HHHTTT-SS-------SS-------------
T ss_pred             CHHHHHHHHHhcChhheeeccccHHHHHHHhccHhhhhc
Confidence            35566666777888887776655544    479998885


No 7  
>KOG0525|consensus
Probab=9.07  E-value=88  Score=28.10  Aligned_cols=22  Identities=55%  Similarity=0.963  Sum_probs=18.3

Q ss_pred             hcCCchhccccc------cccccccccc
Q psy2697         130 EMPDLKEILPWK------GVMKDGRLDL  151 (165)
Q Consensus       130 empdlkeilpwk------gvmkdgrldl  151 (165)
                      |.-||+.|+||.      .|.|.|||-.
T Consensus       270 evidlkti~pwd~d~v~~sv~ktgrlli  297 (362)
T KOG0525|consen  270 EVIDLKTIIPWDKDTVEESVQKTGRLLI  297 (362)
T ss_pred             EEEeeecccCccHHHHHHHHHhhceEEE
Confidence            567999999995      6889999843


No 8  
>COG5559 Uncharacterized conserved small protein [Function unknown]
Probab=8.05  E-value=1.2e+02  Score=21.81  Aligned_cols=13  Identities=54%  Similarity=0.923  Sum_probs=9.6

Q ss_pred             Hhhhhcccchhhh
Q psy2697         111 EILSWKGVMKDER  123 (165)
Q Consensus       111 eilswkgvmkder  123 (165)
                      =-+||||..+.-|
T Consensus        38 L~lswKGalkelr   50 (65)
T COG5559          38 LKLSWKGALKELR   50 (65)
T ss_pred             cceehhhhhhhhc
Confidence            3589999887544


No 9  
>KOG3921|consensus
Probab=8.04  E-value=1.5e+02  Score=26.85  Aligned_cols=15  Identities=40%  Similarity=0.835  Sum_probs=12.0

Q ss_pred             CCCcccccccccccc
Q psy2697          17 KPDLNEILPWKGVMK   31 (165)
Q Consensus        17 kpdlneilpwkgvmk   31 (165)
                      ++|.|+|+||.|-|.
T Consensus        19 ~i~y~~~fp~~~~~d   33 (360)
T KOG3921|consen   19 DIDYNERFPWEGAND   33 (360)
T ss_pred             ccchhhhCCcccccc
Confidence            578899999998543


No 10 
>PF11372 DUF3173:  Domain of unknown function (DUF3173);  InterPro: IPR021512  This family of proteins with unknown function appears to be restricted to Firmicutes. 
Probab=7.11  E-value=1.7e+02  Score=20.18  Aligned_cols=28  Identities=29%  Similarity=0.434  Sum_probs=16.4

Q ss_pred             CcchhhcCcchh------------hhccccchhhhhhhhh
Q psy2697          34 KPDLMKEGMPDL------------MQNERPDLMQNKRLDL   61 (165)
Q Consensus        34 kpdlmkegmpdl------------mqnerpdlmqnkrldl   61 (165)
                      +-|||+-|+|+-            |-+..-...+|+|+..
T Consensus         6 k~dLi~lGf~~~tA~~IIrqAK~~lV~~G~~~Y~nkRlg~   45 (59)
T PF11372_consen    6 KKDLIELGFSESTARDIIRQAKALLVQKGFSFYNNKRLGR   45 (59)
T ss_pred             HHHHHHcCCCHHHHHHHHHHHHHHHHHcCCCcccCCccCc
Confidence            457777777752            3334445566666654


Done!