BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy2700
(88 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3OV2|A Chain A, Curcumin Synthase 1 From Curcuma Longa
pdb|3OV2|B Chain B, Curcumin Synthase 1 From Curcuma Longa
pdb|3OV2|C Chain C, Curcumin Synthase 1 From Curcuma Longa
pdb|3OV2|D Chain D, Curcumin Synthase 1 From Curcuma Longa
Length = 393
Score = 29.3 bits (64), Expect = 0.57, Method: Composition-based stats.
Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 2/41 (4%)
Query: 31 EEKPDLMKEEKPDFMKDERSDLMKEEMPDLMKEEMPDLMKE 71
+E+P L ++ F D+R D++ EE+P L KE +KE
Sbjct: 78 KERPKLCSYKEASF--DDRQDIVVEEIPRLAKEAAEKAIKE 116
>pdb|3OV3|A Chain A, G211f Mutant Of Curcumin Synthase 1 From Curcuma Longa
pdb|3OV3|B Chain B, G211f Mutant Of Curcumin Synthase 1 From Curcuma Longa
pdb|3OV3|C Chain C, G211f Mutant Of Curcumin Synthase 1 From Curcuma Longa
pdb|3OV3|D Chain D, G211f Mutant Of Curcumin Synthase 1 From Curcuma Longa
Length = 393
Score = 29.3 bits (64), Expect = 0.58, Method: Composition-based stats.
Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 2/41 (4%)
Query: 31 EEKPDLMKEEKPDFMKDERSDLMKEEMPDLMKEEMPDLMKE 71
+E+P L ++ F D+R D++ EE+P L KE +KE
Sbjct: 78 KERPKLCSYKEASF--DDRQDIVVEEIPRLAKEAAEKAIKE 116
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.311 0.132 0.363
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,793,337
Number of Sequences: 62578
Number of extensions: 109738
Number of successful extensions: 291
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 282
Number of HSP's gapped (non-prelim): 13
length of query: 88
length of database: 14,973,337
effective HSP length: 56
effective length of query: 32
effective length of database: 11,468,969
effective search space: 367007008
effective search space used: 367007008
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 45 (21.9 bits)