BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy2701
(75 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1CDO|A Chain A, Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Complexed
With Nicotinamide Adenine Dinucleotide (Nad), And Zinc
pdb|1CDO|B Chain B, Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Complexed
With Nicotinamide Adenine Dinucleotide (Nad), And Zinc
Length = 374
Score = 27.7 bits (60), Expect = 1.5, Method: Composition-based stats.
Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 2/47 (4%)
Query: 26 KDEKPDLMKHEMPDLMKDEKPDLMKHEMPELMKGERLDLMKHEKSVR 72
KD P ++K + +K + + + H MP + +DLMKH K +R
Sbjct: 325 KDGVPKMVKAYLDKKVKLD--EFITHRMPLESVNDAIDLMKHGKCIR 369
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.309 0.132 0.369
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,552,020
Number of Sequences: 62578
Number of extensions: 91361
Number of successful extensions: 210
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 206
Number of HSP's gapped (non-prelim): 5
length of query: 75
length of database: 14,973,337
effective HSP length: 44
effective length of query: 31
effective length of database: 12,219,905
effective search space: 378817055
effective search space used: 378817055
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 45 (21.9 bits)