Query psy2701
Match_columns 75
No_of_seqs 3 out of 5
Neff 1.5
Searched_HMMs 46136
Date Fri Aug 16 23:01:19 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy2701.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2701hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PLN03194 putative disease resi 3.4 5.7E+02 0.012 18.7 0.9 13 60-72 175-187 (187)
2 PF01221 Dynein_light: Dynein 3.1 7.9E+02 0.017 14.7 1.2 19 45-63 5-23 (89)
3 KOG1252|consensus 2.6 7.3E+02 0.016 20.4 0.8 14 53-66 134-147 (362)
4 COG2841 Uncharacterized protei 2.3 7.6E+02 0.016 16.1 0.4 10 49-58 1-10 (72)
5 KOG3259|consensus 2.1 7.3E+02 0.016 18.5 0.1 11 64-74 61-71 (163)
6 PTZ00059 dynein light chain; P 1.8 1.6E+03 0.035 13.7 1.4 7 52-58 13-19 (90)
7 COG0031 CysK Cysteine synthase 1.8 9.6E+02 0.021 18.6 0.3 14 53-66 92-105 (300)
8 KOG3231|consensus 1.7 1.1E+03 0.025 18.0 0.6 20 48-67 131-150 (208)
9 PTZ00163 hypothetical protein; 1.7 7.1E+02 0.015 19.2 -0.5 31 41-71 95-125 (230)
10 PF05454 DAG1: Dystroglycan (D 1.6 9.3E+02 0.02 18.6 0.0 47 21-67 191-240 (290)
No 1
>PLN03194 putative disease resistance protein; Provisional
Probab=3.36 E-value=5.7e+02 Score=18.73 Aligned_cols=13 Identities=46% Similarity=0.524 Sum_probs=9.8
Q ss_pred hhhhhhhhccccC
Q psy2701 60 ERLDLMKHEKSVR 72 (75)
Q Consensus 60 ~~~D~M~heksvr 72 (75)
+++-+|+.|||||
T Consensus 175 k~l~~~~~~~~~~ 187 (187)
T PLN03194 175 KNLIELEEEKSVR 187 (187)
T ss_pred HHHHHHhhcccCC
Confidence 4566788888886
No 2
>PF01221 Dynein_light: Dynein light chain type 1 ; InterPro: IPR001372 Dynein is a multisubunit microtubule-dependent motor enzyme that acts as the force generating protein of eukaryotic cilia and flagella. The cytoplasmic isoform of dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Dynein is composed of a number of ATP-binding large subunits (see IPR004273 from INTERPRO), intermediate size subunits and small subunits. Among the small subunits, there is a family of highly conserved proteins which make up this family [, ]. Both type 1 (DLC1) and 2 (DLC2) dynein light chains have a similar two-layer alpha-beta core structure consisting of beta-alpha(2)-beta-X-beta(2) [, ].; GO: 0007017 microtubule-based process, 0005875 microtubule associated complex; PDB: 1F95_A 1F96_A 1F3C_A 3P8M_B 2XQQ_C 1RE6_A 1CMI_A 1PWK_A 1PWJ_A 4DS1_C ....
Probab=3.06 E-value=7.9e+02 Score=14.69 Aligned_cols=19 Identities=32% Similarity=0.490 Sum_probs=8.8
Q ss_pred Cccccccchhhhhhhhhhh
Q psy2701 45 KPDLMKHEMPELMKGERLD 63 (75)
Q Consensus 45 kpDeM~dEMpdeMsd~~~D 63 (75)
+..-....||++|..+-.+
T Consensus 5 ~~~i~~~dM~~~~~~~~~~ 23 (89)
T PF01221_consen 5 KIVIKSSDMPEEMQEEAIE 23 (89)
T ss_dssp SEEEEEEES-HHHHHHHHH
T ss_pred ccEEEECCCCHHHHHHHHH
Confidence 3334445566665554443
No 3
>KOG1252|consensus
Probab=2.56 E-value=7.3e+02 Score=20.36 Aligned_cols=14 Identities=43% Similarity=0.631 Sum_probs=10.5
Q ss_pred hhhhhhhhhhhhhh
Q psy2701 53 MPELMKGERLDLMK 66 (75)
Q Consensus 53 MpdeMsd~~~D~M~ 66 (75)
||+.||-++...++
T Consensus 134 mP~~ms~Ek~~~l~ 147 (362)
T KOG1252|consen 134 MPEKMSKEKRILLR 147 (362)
T ss_pred echhhhHHHHHHHH
Confidence 77788888777665
No 4
>COG2841 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=2.30 E-value=7.6e+02 Score=16.11 Aligned_cols=10 Identities=40% Similarity=0.687 Sum_probs=5.3
Q ss_pred cccchhhhhh
Q psy2701 49 MKHEMPELMK 58 (75)
Q Consensus 49 M~dEMpdeMs 58 (75)
|.+|.|+++|
T Consensus 1 m~~Efr~~is 10 (72)
T COG2841 1 MFHEFRDLIS 10 (72)
T ss_pred CchhHHHHHH
Confidence 3455555554
No 5
>KOG3259|consensus
Probab=2.08 E-value=7.3e+02 Score=18.45 Aligned_cols=11 Identities=55% Similarity=0.836 Sum_probs=8.6
Q ss_pred hhhhccccCCC
Q psy2701 64 LMKHEKSVRPE 74 (75)
Q Consensus 64 ~M~heksvrpe 74 (75)
|.||..|-||.
T Consensus 61 LVKH~~SRrps 71 (163)
T KOG3259|consen 61 LVKHKGSRRPS 71 (163)
T ss_pred EEccccCCCCc
Confidence 57888888883
No 6
>PTZ00059 dynein light chain; Provisional
Probab=1.83 E-value=1.6e+03 Score=13.74 Aligned_cols=7 Identities=43% Similarity=0.610 Sum_probs=2.8
Q ss_pred chhhhhh
Q psy2701 52 EMPELMK 58 (75)
Q Consensus 52 EMpdeMs 58 (75)
.||++|.
T Consensus 13 dM~~emq 19 (90)
T PTZ00059 13 DMSEDMQ 19 (90)
T ss_pred CCCHHHH
Confidence 3444443
No 7
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism]
Probab=1.76 E-value=9.6e+02 Score=18.60 Aligned_cols=14 Identities=50% Similarity=0.802 Sum_probs=9.2
Q ss_pred hhhhhhhhhhhhhh
Q psy2701 53 MPELMKGERLDLMK 66 (75)
Q Consensus 53 MpdeMsd~~~D~M~ 66 (75)
||+-||-++..+|+
T Consensus 92 mP~~~S~er~~~l~ 105 (300)
T COG0031 92 MPETMSQERRKLLR 105 (300)
T ss_pred eCCCCCHHHHHHHH
Confidence 66667777666654
No 8
>KOG3231|consensus
Probab=1.70 E-value=1.1e+03 Score=18.03 Aligned_cols=20 Identities=40% Similarity=0.378 Sum_probs=14.3
Q ss_pred ccccchhhhhhhhhhhhhhh
Q psy2701 48 LMKHEMPELMKGERLDLMKH 67 (75)
Q Consensus 48 eM~dEMpdeMsd~~~D~M~h 67 (75)
.|+-||-++|-..|+|-|-.
T Consensus 131 nmKMemTeEMiNDTLDdild 150 (208)
T KOG3231|consen 131 NMKMEMTEEMINDTLDDILD 150 (208)
T ss_pred HHHhhhHHHHHHhhHHHHhc
Confidence 36667888888888876643
No 9
>PTZ00163 hypothetical protein; Provisional
Probab=1.69 E-value=7.1e+02 Score=19.21 Aligned_cols=31 Identities=19% Similarity=0.291 Sum_probs=0.0
Q ss_pred cCCCCccccccchhhhhhhhhhhhhhhcccc
Q psy2701 41 MKDEKPDLMKHEMPELMKGERLDLMKHEKSV 71 (75)
Q Consensus 41 m~dEkpDeM~dEMpdeMsd~~~D~M~heksv 71 (75)
|..|+.+-|.|-.-|-|.|---+..+|-.|+
T Consensus 95 me~em~~h~~d~idd~m~d~m~~~~~hhnsl 125 (230)
T PTZ00163 95 MENEMENHIDDSIDDPMDDLMNDKWEHHNSL 125 (230)
T ss_pred HHHHHHhhhhhccccHHHHHHHHHHHhcccH
No 10
>PF05454 DAG1: Dystroglycan (Dystrophin-associated glycoprotein 1); InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=1.61 E-value=9.3e+02 Score=18.58 Aligned_cols=47 Identities=28% Similarity=0.388 Sum_probs=0.0
Q ss_pred ccccccccCcc---cccCCCCCCcCCCCccccccchhhhhhhhhhhhhhh
Q psy2701 21 LPDLMKDEKPD---LMKHEMPDLMKDEKPDLMKHEMPELMKGERLDLMKH 67 (75)
Q Consensus 21 ~pd~m~DEmpD---em~~Empdem~dEkpDeM~dEMpdeMsd~~~D~M~h 67 (75)
+|=-..||..| +-..-+|-.+++|||-+-+-|-|-...-++.-+..|
T Consensus 191 iPvIF~dElee~kp~~~~~~P~IlkeEkPPl~pp~y~~~~~~~~~p~~~~ 240 (290)
T PF05454_consen 191 IPVIFQDELEESKPEPGSKSPVILKEEKPPLPPPEYPNSNMPESTPLNQD 240 (290)
T ss_dssp --------------------------------------------------
T ss_pred CceeccccccccCCCCCCCCCeeecccCCCCCCCCCCCCCCCCCCCcccc
Done!