Query         psy2701
Match_columns 75
No_of_seqs    3 out of 5
Neff          1.5 
Searched_HMMs 46136
Date          Fri Aug 16 23:01:19 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2701.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2701hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03194 putative disease resi   3.4 5.7E+02   0.012   18.7   0.9   13   60-72    175-187 (187)
  2 PF01221 Dynein_light:  Dynein    3.1 7.9E+02   0.017   14.7   1.2   19   45-63      5-23  (89)
  3 KOG1252|consensus                2.6 7.3E+02   0.016   20.4   0.8   14   53-66    134-147 (362)
  4 COG2841 Uncharacterized protei   2.3 7.6E+02   0.016   16.1   0.4   10   49-58      1-10  (72)
  5 KOG3259|consensus                2.1 7.3E+02   0.016   18.5   0.1   11   64-74     61-71  (163)
  6 PTZ00059 dynein light chain; P   1.8 1.6E+03   0.035   13.7   1.4    7   52-58     13-19  (90)
  7 COG0031 CysK Cysteine synthase   1.8 9.6E+02   0.021   18.6   0.3   14   53-66     92-105 (300)
  8 KOG3231|consensus                1.7 1.1E+03   0.025   18.0   0.6   20   48-67    131-150 (208)
  9 PTZ00163 hypothetical protein;   1.7 7.1E+02   0.015   19.2  -0.5   31   41-71     95-125 (230)
 10 PF05454 DAG1:  Dystroglycan (D   1.6 9.3E+02    0.02   18.6   0.0   47   21-67    191-240 (290)

No 1  
>PLN03194 putative disease resistance protein; Provisional
Probab=3.36  E-value=5.7e+02  Score=18.73  Aligned_cols=13  Identities=46%  Similarity=0.524  Sum_probs=9.8

Q ss_pred             hhhhhhhhccccC
Q psy2701          60 ERLDLMKHEKSVR   72 (75)
Q Consensus        60 ~~~D~M~heksvr   72 (75)
                      +++-+|+.|||||
T Consensus       175 k~l~~~~~~~~~~  187 (187)
T PLN03194        175 KNLIELEEEKSVR  187 (187)
T ss_pred             HHHHHHhhcccCC
Confidence            4566788888886


No 2  
>PF01221 Dynein_light:  Dynein light chain type 1 ;  InterPro: IPR001372 Dynein is a multisubunit microtubule-dependent motor enzyme that acts as the force generating protein of eukaryotic cilia and flagella. The cytoplasmic isoform of dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.  Dynein is composed of a number of ATP-binding large subunits (see IPR004273 from INTERPRO), intermediate size subunits and small subunits. Among the small subunits, there is a family of highly conserved proteins which make up this family [, ]. Both type 1 (DLC1) and 2 (DLC2) dynein light chains have a similar two-layer alpha-beta core structure consisting of beta-alpha(2)-beta-X-beta(2) [, ].; GO: 0007017 microtubule-based process, 0005875 microtubule associated complex; PDB: 1F95_A 1F96_A 1F3C_A 3P8M_B 2XQQ_C 1RE6_A 1CMI_A 1PWK_A 1PWJ_A 4DS1_C ....
Probab=3.06  E-value=7.9e+02  Score=14.69  Aligned_cols=19  Identities=32%  Similarity=0.490  Sum_probs=8.8

Q ss_pred             Cccccccchhhhhhhhhhh
Q psy2701          45 KPDLMKHEMPELMKGERLD   63 (75)
Q Consensus        45 kpDeM~dEMpdeMsd~~~D   63 (75)
                      +..-....||++|..+-.+
T Consensus         5 ~~~i~~~dM~~~~~~~~~~   23 (89)
T PF01221_consen    5 KIVIKSSDMPEEMQEEAIE   23 (89)
T ss_dssp             SEEEEEEES-HHHHHHHHH
T ss_pred             ccEEEECCCCHHHHHHHHH
Confidence            3334445566665554443


No 3  
>KOG1252|consensus
Probab=2.56  E-value=7.3e+02  Score=20.36  Aligned_cols=14  Identities=43%  Similarity=0.631  Sum_probs=10.5

Q ss_pred             hhhhhhhhhhhhhh
Q psy2701          53 MPELMKGERLDLMK   66 (75)
Q Consensus        53 MpdeMsd~~~D~M~   66 (75)
                      ||+.||-++...++
T Consensus       134 mP~~ms~Ek~~~l~  147 (362)
T KOG1252|consen  134 MPEKMSKEKRILLR  147 (362)
T ss_pred             echhhhHHHHHHHH
Confidence            77788888777665


No 4  
>COG2841 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=2.30  E-value=7.6e+02  Score=16.11  Aligned_cols=10  Identities=40%  Similarity=0.687  Sum_probs=5.3

Q ss_pred             cccchhhhhh
Q psy2701          49 MKHEMPELMK   58 (75)
Q Consensus        49 M~dEMpdeMs   58 (75)
                      |.+|.|+++|
T Consensus         1 m~~Efr~~is   10 (72)
T COG2841           1 MFHEFRDLIS   10 (72)
T ss_pred             CchhHHHHHH
Confidence            3455555554


No 5  
>KOG3259|consensus
Probab=2.08  E-value=7.3e+02  Score=18.45  Aligned_cols=11  Identities=55%  Similarity=0.836  Sum_probs=8.6

Q ss_pred             hhhhccccCCC
Q psy2701          64 LMKHEKSVRPE   74 (75)
Q Consensus        64 ~M~heksvrpe   74 (75)
                      |.||..|-||.
T Consensus        61 LVKH~~SRrps   71 (163)
T KOG3259|consen   61 LVKHKGSRRPS   71 (163)
T ss_pred             EEccccCCCCc
Confidence            57888888883


No 6  
>PTZ00059 dynein light chain; Provisional
Probab=1.83  E-value=1.6e+03  Score=13.74  Aligned_cols=7  Identities=43%  Similarity=0.610  Sum_probs=2.8

Q ss_pred             chhhhhh
Q psy2701          52 EMPELMK   58 (75)
Q Consensus        52 EMpdeMs   58 (75)
                      .||++|.
T Consensus        13 dM~~emq   19 (90)
T PTZ00059         13 DMSEDMQ   19 (90)
T ss_pred             CCCHHHH
Confidence            3444443


No 7  
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism]
Probab=1.76  E-value=9.6e+02  Score=18.60  Aligned_cols=14  Identities=50%  Similarity=0.802  Sum_probs=9.2

Q ss_pred             hhhhhhhhhhhhhh
Q psy2701          53 MPELMKGERLDLMK   66 (75)
Q Consensus        53 MpdeMsd~~~D~M~   66 (75)
                      ||+-||-++..+|+
T Consensus        92 mP~~~S~er~~~l~  105 (300)
T COG0031          92 MPETMSQERRKLLR  105 (300)
T ss_pred             eCCCCCHHHHHHHH
Confidence            66667777666654


No 8  
>KOG3231|consensus
Probab=1.70  E-value=1.1e+03  Score=18.03  Aligned_cols=20  Identities=40%  Similarity=0.378  Sum_probs=14.3

Q ss_pred             ccccchhhhhhhhhhhhhhh
Q psy2701          48 LMKHEMPELMKGERLDLMKH   67 (75)
Q Consensus        48 eM~dEMpdeMsd~~~D~M~h   67 (75)
                      .|+-||-++|-..|+|-|-.
T Consensus       131 nmKMemTeEMiNDTLDdild  150 (208)
T KOG3231|consen  131 NMKMEMTEEMINDTLDDILD  150 (208)
T ss_pred             HHHhhhHHHHHHhhHHHHhc
Confidence            36667888888888876643


No 9  
>PTZ00163 hypothetical protein; Provisional
Probab=1.69  E-value=7.1e+02  Score=19.21  Aligned_cols=31  Identities=19%  Similarity=0.291  Sum_probs=0.0

Q ss_pred             cCCCCccccccchhhhhhhhhhhhhhhcccc
Q psy2701          41 MKDEKPDLMKHEMPELMKGERLDLMKHEKSV   71 (75)
Q Consensus        41 m~dEkpDeM~dEMpdeMsd~~~D~M~heksv   71 (75)
                      |..|+.+-|.|-.-|-|.|---+..+|-.|+
T Consensus        95 me~em~~h~~d~idd~m~d~m~~~~~hhnsl  125 (230)
T PTZ00163         95 MENEMENHIDDSIDDPMDDLMNDKWEHHNSL  125 (230)
T ss_pred             HHHHHHhhhhhccccHHHHHHHHHHHhcccH


No 10 
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=1.61  E-value=9.3e+02  Score=18.58  Aligned_cols=47  Identities=28%  Similarity=0.388  Sum_probs=0.0

Q ss_pred             ccccccccCcc---cccCCCCCCcCCCCccccccchhhhhhhhhhhhhhh
Q psy2701          21 LPDLMKDEKPD---LMKHEMPDLMKDEKPDLMKHEMPELMKGERLDLMKH   67 (75)
Q Consensus        21 ~pd~m~DEmpD---em~~Empdem~dEkpDeM~dEMpdeMsd~~~D~M~h   67 (75)
                      +|=-..||..|   +-..-+|-.+++|||-+-+-|-|-...-++.-+..|
T Consensus       191 iPvIF~dElee~kp~~~~~~P~IlkeEkPPl~pp~y~~~~~~~~~p~~~~  240 (290)
T PF05454_consen  191 IPVIFQDELEESKPEPGSKSPVILKEEKPPLPPPEYPNSNMPESTPLNQD  240 (290)
T ss_dssp             --------------------------------------------------
T ss_pred             CceeccccccccCCCCCCCCCeeecccCCCCCCCCCCCCCCCCCCCcccc


Done!