Query         psy2702
Match_columns 87
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 46136
Date          Fri Aug 16 23:02:13 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2702.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2702hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03819 MazG:  MazG nucleotide  68.7     6.9 0.00015   23.1   2.8   27   47-73     15-41  (74)
  2 PF01023 S_100:  S-100/ICaBP ty  50.2      12 0.00027   21.3   1.6   20   43-62     24-43  (44)
  3 PF05542 DUF760:  Protein of un  32.3      63  0.0014   20.2   2.9   32   47-78      1-39  (86)
  4 PF06925 MGDG_synth:  Monogalac  29.0      35 0.00076   22.2   1.3   23   39-61     71-93  (169)
  5 PF08776 VASP_tetra:  VASP tetr  28.6 1.4E+02   0.003   17.9   4.4   18   39-56      2-19  (40)
  6 PF05454 DAG1:  Dystroglycan (D  24.7      25 0.00053   27.3   0.0   32    7-38    181-223 (290)
  7 TIGR01461 greB transcription e  23.2      93   0.002   21.4   2.6   23   37-59      5-27  (156)
  8 cd05030 calgranulins Calgranul  22.3      93   0.002   18.7   2.3   11   20-30     27-37  (88)
  9 COG1963 Uncharacterized protei  21.6      79  0.0017   23.5   2.1   30   45-74    102-131 (153)
 10 PF04703 FaeA:  FaeA-like prote  21.0      88  0.0019   19.1   1.9   25   45-69      1-25  (62)

No 1  
>PF03819 MazG:  MazG nucleotide pyrophosphohydrolase domain;  InterPro: IPR004518 This domain is found in a group of prokaryotic proteins which includes Escherichia coli MazG. The domain is about 100 amino acid residues in length and contains four conserved negatively charged residues that probably form an active site or metal binding site.; PDB: 1VMG_A 2YXH_B 2OIE_B 2OIG_C 2Q4P_A 2A3Q_B 2Q9L_C 2Q5Z_B 2Q73_A 3CRC_B ....
Probab=68.73  E-value=6.9  Score=23.10  Aligned_cols=27  Identities=26%  Similarity=0.455  Sum_probs=22.6

Q ss_pred             HHHHHHHHhhCchhHHHHHHHHHHhhh
Q psy2702          47 NELLDLMQKEKPDLVQEEMSDLMKHKM   73 (87)
Q Consensus        47 nelldlmqkekpdlvqeemsdlmkhkm   73 (87)
                      .||.+.++++..+-+.+|+.|++-.-+
T Consensus        15 ~El~~ai~~~~~~~l~eElgDvl~~l~   41 (74)
T PF03819_consen   15 GELAEAIRKEDRENLEEELGDVLFYLL   41 (74)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhcchHHHHHHHHHHHHHHH
Confidence            578888999999999999999876544


No 2  
>PF01023 S_100:  S-100/ICaBP type calcium binding domain;  InterPro: IPR013787 The calcium-binding domain found in S100 and CaBP-9k proteins is a subfamily of the EF-hand calcium-binding domain []. S100s are small dimeric acidic calcium and zinc-binding proteins abundant in the brain, with S100B playing an important role in modulating the proliferation and differentiation of neurons and glia cells []. S100 proteins have two different types of calcium-binding sites: a low affinity one with a special structure, and a 'normal' EF-hand type high-affinity site. Calbindin-D9k (CaBP-9k) also belong to this family of proteins, but it does not form dimers. CaBP-9k is a cytosolic protein expressed in a variety of tissues. Although its precise function is unknown, it appears to be under the control of the steroid hormones oestrogen and progesterone in the female reproductive system []. In the intestine, CaBP-9k may be involved in calcium absorption by mediating intracellular diffusion []. This entry represents a subdomain of the calcium-binding domain found in S100, CaBP-9k, and related proteins.; PDB: 2RGI_A 4DUQ_B 2KAY_B 2KAX_A 2CNP_A 1CNP_A 1A03_A 1JWD_B 2JTT_A 1XK4_B ....
Probab=50.21  E-value=12  Score=21.26  Aligned_cols=20  Identities=40%  Similarity=0.718  Sum_probs=12.6

Q ss_pred             hhhHHHHHHHHHhhCchhHH
Q psy2702          43 DLMKNELLDLMQKEKPDLVQ   62 (87)
Q Consensus        43 dlmknelldlmqkekpdlvq   62 (87)
                      -|-|+||-.||++|=|++.+
T Consensus        24 ~Lsk~Elk~Ll~~Elp~flk   43 (44)
T PF01023_consen   24 TLSKKELKELLEKELPNFLK   43 (44)
T ss_dssp             SEEHHHHHHHHHHHSTTTHH
T ss_pred             eEcHHHHHHHHHHHHHHHhc
Confidence            35566777777766666543


No 3  
>PF05542 DUF760:  Protein of unknown function (DUF760);  InterPro: IPR008479 This entry contains uncharacterised proteins.
Probab=32.33  E-value=63  Score=20.23  Aligned_cols=32  Identities=38%  Similarity=0.569  Sum_probs=21.0

Q ss_pred             HHHHHHHHhhCchhHH-------HHHHHHHHhhhhhhhc
Q psy2702          47 NELLDLMQKEKPDLVQ-------EEMSDLMKHKMSVLMK   78 (87)
Q Consensus        47 nelldlmqkekpdlvq-------eemsdlmkhkmsvlmk   78 (87)
                      |.|++.+|.-+|+.++       .|.-+.|++-.+-++.
T Consensus         1 n~L~~yi~~l~pe~~~~l~~~~s~ev~e~m~~~v~~llG   39 (86)
T PF05542_consen    1 NDLLQYIQSLKPERIQQLSEPASPEVLEAMKQHVSGLLG   39 (86)
T ss_pred             ChHHHHHHHCCHHHHHHhhccCCHHHHHHHHHHHHHHHc
Confidence            5677777777775544       3666777776665554


No 4  
>PF06925 MGDG_synth:  Monogalactosyldiacylglycerol (MGDG) synthase;  InterPro: IPR009695 This entry represents a conserved region of approximately 180 residues found towirds the N terminus of a number of plant and bacterial diacylglycerol glucosyltransferases, such as monogalactosyldiacylglycerol synthase [].; GO: 0016758 transferase activity, transferring hexosyl groups, 0009247 glycolipid biosynthetic process
Probab=29.04  E-value=35  Score=22.16  Aligned_cols=23  Identities=30%  Similarity=0.544  Sum_probs=18.5

Q ss_pred             HHhhhhhHHHHHHHHHhhCchhH
Q psy2702          39 DAKYDLMKNELLDLMQKEKPDLV   61 (87)
Q Consensus        39 dakydlmknelldlmqkekpdlv   61 (87)
                      .+-..++.+.|..++++.+||+|
T Consensus        71 ~~~~~~~~~~l~~~l~~~~PD~I   93 (169)
T PF06925_consen   71 SALSRLFARRLIRLLREFQPDLI   93 (169)
T ss_pred             HHHHHHHHHHHHHHHhhcCCCEE
Confidence            34456777889999999999986


No 5  
>PF08776 VASP_tetra:  VASP tetramerisation domain;  InterPro: IPR014885 Vasodilator-stimulated phosphoprotein (VASP) is an actin cytoskeletal regulatory protein. This region corresponds to the tetramerisation domain which forms a right handed alpha helical coiled coil structure []. ; PDB: 1USE_A 1USD_A.
Probab=28.60  E-value=1.4e+02  Score=17.91  Aligned_cols=18  Identities=28%  Similarity=0.547  Sum_probs=13.2

Q ss_pred             HHhhhhhHHHHHHHHHhh
Q psy2702          39 DAKYDLMKNELLDLMQKE   56 (87)
Q Consensus        39 dakydlmknelldlmqke   56 (87)
                      +..++-||.|+|+-|.+|
T Consensus         2 ~~dle~~KqEIL~EvrkE   19 (40)
T PF08776_consen    2 SSDLERLKQEILEEVRKE   19 (40)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             chhHHHHHHHHHHHHHHH
Confidence            345778888888877765


No 6  
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=24.68  E-value=25  Score=27.33  Aligned_cols=32  Identities=41%  Similarity=0.709  Sum_probs=0.0

Q ss_pred             hcCcchhhcCCCCccchhhh-----------hhhhhcccchhh
Q psy2702           7 EEKPDLMQEGKPDLMKDELP-----------ALMKEEKPDLMK   38 (87)
Q Consensus         7 eekpdlmqegkpdlmkdelp-----------almkeekpdlmk   38 (87)
                      ||.......|.|=...|||.           -+||||||-|-.
T Consensus       181 ee~~~f~~KGiPvIF~dElee~kp~~~~~~P~IlkeEkPPl~p  223 (290)
T PF05454_consen  181 EEQKTFISKGIPVIFQDELEESKPEPGSKSPVILKEEKPPLPP  223 (290)
T ss_dssp             -------------------------------------------
T ss_pred             chhHHHHhcCCceeccccccccCCCCCCCCCeeecccCCCCCC
Confidence            56666777788888877774           366777775543


No 7  
>TIGR01461 greB transcription elongation factor GreB. The GreA and GreB transcription elongation factors enable to continuation of RNA transcription past template-encoded arresting sites. Among the Proteobacteria, distinct clades of GreA and GreB are found. GreB differs functionally in that it releases larger oligonucleotides. This model describes proteobacterial GreB.
Probab=23.18  E-value=93  Score=21.38  Aligned_cols=23  Identities=30%  Similarity=0.580  Sum_probs=10.2

Q ss_pred             hhHHhhhhhHHHHHHHHHhhCch
Q psy2702          37 MKDAKYDLMKNELLDLMQKEKPD   59 (87)
Q Consensus        37 mkdakydlmknelldlmqkekpd   59 (87)
                      |-...|+-++.||-.|.+.+.|+
T Consensus         5 lT~~G~~~L~~El~~L~~~~r~~   27 (156)
T TIGR01461         5 ITPEGYEKLKQELNYLWREERPE   27 (156)
T ss_pred             cCHHHHHHHHHHHHHHHhcccHH
Confidence            33344444444444444444443


No 8  
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 . Note that the S-100 hierarchy, to which this Calgranulin group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. These proteins are expressed mainly in granulocytes, and are involved in inflammation, allergy, and neuritogenesis, as well as in host-parasite response. Calgranulins are modulated not only by calcium, but also by other metals such as zinc and copper. Structural data suggested that calgranulins may exist in  multiple structural forms, homodimers, as well as hetero-oligomers. For example, the S100A8/S100A9 complex called calprotectin plays important roles in the regulation of inflammatory processes, wound repair, and regulating zinc-dependent enzymes as well as microbial growth.
Probab=22.32  E-value=93  Score=18.75  Aligned_cols=11  Identities=36%  Similarity=0.579  Sum_probs=5.0

Q ss_pred             ccchhhhhhhh
Q psy2702          20 LMKDELPALMK   30 (87)
Q Consensus        20 lmkdelpalmk   30 (87)
                      +-.+||-.+|.
T Consensus        27 Is~~El~~ll~   37 (88)
T cd05030          27 LYKKEFKQLVE   37 (88)
T ss_pred             CCHHHHHHHHH
Confidence            33444444444


No 9  
>COG1963 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.60  E-value=79  Score=23.46  Aligned_cols=30  Identities=23%  Similarity=0.453  Sum_probs=25.8

Q ss_pred             hHHHHHHHHHhhCchhHHHHHHHHHHhhhh
Q psy2702          45 MKNELLDLMQKEKPDLVQEEMSDLMKHKMS   74 (87)
Q Consensus        45 mknelldlmqkekpdlvqeemsdlmkhkms   74 (87)
                      .-|+|.+-.-+|++|+-+.+...|+-|+-.
T Consensus       102 iLN~l~~~~~~e~~~~~~~~lKellGH~p~  131 (153)
T COG1963         102 ILNQLIEELVNEKKDFDKKRLKELLGHTPL  131 (153)
T ss_pred             HHHHHHHHHHHhhccCCHHHHHHHhCCChH
Confidence            458888888999999999999999999743


No 10 
>PF04703 FaeA:  FaeA-like protein; PDB: 2JT1_A 2HTJ_A.
Probab=21.03  E-value=88  Score=19.11  Aligned_cols=25  Identities=24%  Similarity=0.543  Sum_probs=17.1

Q ss_pred             hHHHHHHHHHhhCchhHHHHHHHHH
Q psy2702          45 MKNELLDLMQKEKPDLVQEEMSDLM   69 (87)
Q Consensus        45 mknelldlmqkekpdlvqeemsdlm   69 (87)
                      ||+++++.++..+..+--.|+.+..
T Consensus         1 ~ke~Il~~i~~~~~p~~T~eiA~~~   25 (62)
T PF04703_consen    1 MKEKILEYIKEQNGPLKTREIADAL   25 (62)
T ss_dssp             -HHCHHHHHHHHTS-EEHHHHHHHH
T ss_pred             CcHHHHHHHHHcCCCCCHHHHHHHh
Confidence            7888999998844446666777764


Done!