BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy2705
         (203 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2LK2|A Chain A, Solution Nmr Structure Of Homeobox Domain (171-248) Of
          Human Homeobox Protein Tgif1, Northeast Structural
          Genomics Consortium Target Hr4411b
          Length = 89

 Score = 26.6 bits (57), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 29/59 (49%), Gaps = 4/59 (6%)

Query: 23 EEKQELLDLMKDERYDLMKNEKPDLMKEERLDLMKEEKLDWMKNEKRDLMKEEKPDLMK 81
          E  Q L D + + RY+   +E+   +  ++  L   +  +W  N +R L+    PD+++
Sbjct: 15 ESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLL----PDMLR 69


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.312    0.135    0.386 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,749,485
Number of Sequences: 62578
Number of extensions: 304952
Number of successful extensions: 787
Number of sequences better than 100.0: 46
Number of HSP's better than 100.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 32
Number of HSP's that attempted gapping in prelim test: 751
Number of HSP's gapped (non-prelim): 70
length of query: 203
length of database: 14,973,337
effective HSP length: 94
effective length of query: 109
effective length of database: 9,091,005
effective search space: 990919545
effective search space used: 990919545
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 49 (23.5 bits)