Query         psy2711
Match_columns 114
No_of_seqs    131 out of 1036
Neff          6.3 
Searched_HMMs 46136
Date          Fri Aug 16 23:16:51 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2711.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2711hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00379 Chitin_bind_4:  Insect  99.7 5.1E-18 1.1E-22  102.6   7.1   47   41-88      1-52  (52)
  2 COG5294 Uncharacterized protei  93.3    0.47   1E-05   33.0   6.4   45   39-85     28-76  (113)
  3 PF13956 Ibs_toxin:  Toxin Ibs,  91.9   0.098 2.1E-06   25.2   1.1   12    1-12      1-12  (19)
  4 PF06004 DUF903:  Bacterial pro  86.8    0.58 1.3E-05   28.1   2.0   37   44-80      3-40  (50)
  5 TIGR01655 yxeA_fam conserved h  86.0       5 0.00011   27.5   6.7   16   70-85     62-77  (114)
  6 PF13511 DUF4124:  Domain of un  84.2     2.8   6E-05   24.9   4.3   11   65-75     14-24  (60)
  7 PRK05461 apaG CO2+/MG2+ efflux  82.5      10 0.00022   26.7   7.1   20   60-79     94-113 (127)
  8 PF06286 Coleoptericin:  Coleop  81.0    0.44 9.5E-06   34.0  -0.2   15    1-15      1-15  (143)
  9 COG2967 ApaG Uncharacterized p  75.6      20 0.00043   25.4   6.7   21   60-80     93-113 (126)
 10 PF05404 TRAP-delta:  Transloco  71.0      24 0.00052   26.2   6.6   15    1-15      1-16  (167)
 11 PF15240 Pro-rich:  Proline-ric  68.4     4.7  0.0001   30.2   2.4   17    1-17      1-17  (179)
 12 PF07437 YfaZ:  YfaZ precursor;  67.5      32  0.0007   25.5   6.8   10    1-10      1-10  (180)
 13 PF11153 DUF2931:  Protein of u  67.2      12 0.00026   28.0   4.5   16    1-16      1-18  (216)
 14 PF12930 DUF3836:  Family of un  66.3      24 0.00051   25.0   5.6   43   40-83     63-110 (132)
 15 PRK09408 ompX outer membrane p  66.2      44 0.00095   24.5   7.2   12   62-73     61-72  (171)
 16 KOG4088|consensus               61.8      47   0.001   24.3   6.4   17    1-17      1-18  (167)
 17 COG4939 Major membrane immunog  61.1      53  0.0012   23.6   6.5   42   36-77     29-74  (147)
 18 PF13473 Cupredoxin_1:  Cupredo  59.6      19 0.00042   23.5   4.0   42   41-87     45-86  (104)
 19 PF11777 DUF3316:  Protein of u  56.3     7.9 0.00017   26.3   1.7   10    1-10      1-10  (114)
 20 PF11948 DUF3465:  Protein of u  52.6      83  0.0018   22.5   6.7   51   37-90     55-119 (131)
 21 PRK11443 lipoprotein; Provisio  50.4      14 0.00031   25.9   2.2   16    1-16      1-18  (124)
 22 PF11714 Inhibitor_I53:  Thromb  49.7      15 0.00032   23.7   2.0   10    1-10      1-10  (78)
 23 KOG4824|consensus               48.1      72  0.0016   24.6   5.8   24   60-83     65-88  (224)
 24 PF10855 DUF2648:  Protein of u  47.0     6.5 0.00014   21.6   0.0   12    1-12      1-12  (33)
 25 PF00879 Defensin_propep:  Defe  45.7      60  0.0013   19.6   4.1   12    1-12      1-12  (52)
 26 PRK09980 ompL outer membrane p  44.9      68  0.0015   24.8   5.4   34   40-73     40-85  (230)
 27 PF11803 UXS1_N:  UDP-glucurona  44.8      14  0.0003   24.1   1.3   14    1-14     17-30  (78)
 28 PRK15240 resistance to complem  42.5      93   0.002   23.0   5.7   10    1-10      1-10  (185)
 29 PRK15209 long polar fimbrial p  42.3      27  0.0006   24.9   2.7   12    1-12      1-12  (174)
 30 PF09403 FadA:  Adhesion protei  39.9     9.6 0.00021   26.9   0.0   12    1-12      1-12  (126)
 31 PRK09810 entericidin A; Provis  39.4      26 0.00057   20.1   1.8    8    1-8       2-9   (41)
 32 COG5455 Predicted integral mem  39.2      23 0.00051   25.2   1.9   15    1-15      2-16  (129)
 33 PF06316 Ail_Lom:  Enterobacter  38.9      88  0.0019   23.8   5.1   14   63-76     65-78  (199)
 34 PF08139 LPAM_1:  Prokaryotic m  38.5      24 0.00053   18.1   1.4    8    2-9       8-15  (25)
 35 PRK11372 lysozyme inhibitor; P  38.3      24 0.00051   24.1   1.8   16    1-16      3-20  (109)
 36 PF06291 Lambda_Bor:  Bor prote  38.1      28  0.0006   23.5   2.0   10    1-10      1-10  (97)
 37 COG2821 MltA Membrane-bound ly  36.7      44 0.00096   27.8   3.4   27   62-89    192-218 (373)
 38 TIGR02052 MerP mercuric transp  36.0      30 0.00066   20.5   1.9   15    1-15      1-15  (92)
 39 TIGR00156 conserved hypothetic  36.0      25 0.00055   24.8   1.6   10    1-10      1-10  (126)
 40 PRK10159 outer membrane phosph  35.2      35 0.00076   27.4   2.5   12    1-12      1-12  (351)
 41 PF12276 DUF3617:  Protein of u  34.7      68  0.0015   22.4   3.7   12    1-12      1-12  (162)
 42 cd07240 ED_TypeI_classII_N N-t  34.5      67  0.0014   20.1   3.4   20   65-84     97-116 (117)
 43 PRK10053 hypothetical protein;  34.2      33 0.00071   24.3   2.0   10    1-10      1-10  (130)
 44 PF00659 POLO_box:  POLO box du  33.9 1.1E+02  0.0024   18.4   5.3   40   40-79      4-47  (68)
 45 TIGR01643 YD_repeat_2x YD repe  32.8      72  0.0016   17.0   2.9   14   68-81      9-22  (42)
 46 PRK10350 hypothetical protein;  32.4      32 0.00069   24.7   1.7   13    1-13      1-13  (145)
 47 PF05423 Mycobact_memb:  Mycoba  32.2 1.1E+02  0.0024   21.7   4.5   24   63-87     51-74  (140)
 48 COG2140 Thermophilic glucose-6  31.9      61  0.0013   24.9   3.2   29   64-92    113-141 (209)
 49 COG3422 Uncharacterized conser  31.4      65  0.0014   19.9   2.7   20   33-52      7-26  (59)
 50 cd07252 BphC1-RGP6_N_like N-te  31.1      74  0.0016   20.5   3.3   20   65-84    100-119 (120)
 51 PHA02698 hypothetical protein;  31.1      29 0.00063   22.8   1.2   25   86-110    19-43  (89)
 52 KOG4327|consensus               30.9      38 0.00082   26.0   1.9   16   94-109   168-183 (218)
 53 PF03562 MltA:  MltA specific i  30.7      33 0.00071   25.1   1.6   31   62-92     83-114 (158)
 54 PF10584 Proteasome_A_N:  Prote  30.7     1.8 3.9E-05   22.0  -3.6   11   71-81      9-19  (23)
 55 PRK11528 hypothetical protein;  30.3      40 0.00087   26.4   2.1   13    1-13      1-13  (254)
 56 PRK10290 superoxide dismutase;  29.9 1.2E+02  0.0026   22.4   4.5   14    1-14      1-14  (173)
 57 PRK10397 lipoprotein; Provisio  29.6      40 0.00086   24.2   1.8   14    1-14      1-14  (137)
 58 PF11106 YjbE:  Exopolysacchari  29.6      47   0.001   21.7   2.0    8    1-8       1-8   (80)
 59 smart00817 Amelin Ameloblastin  29.3      47   0.001   27.7   2.4   16    1-16      1-16  (411)
 60 COG2834 LolA Outer membrane li  29.2      85  0.0018   23.3   3.6   21   70-90     93-113 (211)
 61 COG5633 Predicted periplasmic   29.2 2.1E+02  0.0045   20.2   6.4   18   60-77     69-86  (123)
 62 PRK13791 lysozyme inhibitor; P  29.1      61  0.0013   22.4   2.6    8   40-47     41-48  (113)
 63 PF13127 DUF3955:  Protein of u  29.1      33 0.00071   21.2   1.2    9    1-9       1-9   (63)
 64 PHA02097 hypothetical protein   28.8 1.1E+02  0.0023   18.7   3.3   24   67-90     14-37  (59)
 65 PF09244 DUF1964:  Domain of un  28.2      69  0.0015   20.2   2.5   21   65-85      4-24  (68)
 66 PF05968 Bacillus_PapR:  Bacill  28.0      54  0.0012   19.3   1.9   10    1-10      1-10  (48)
 67 PRK10449 heat-inducible protei  27.9      46   0.001   23.3   1.9    9    1-9       1-9   (140)
 68 PF10956 DUF2756:  Protein of u  27.8      37 0.00081   23.3   1.3   12    1-12      1-12  (104)
 69 cd08344 MhqB_like_N N-terminal  27.4      79  0.0017   20.1   2.9   16   66-81     93-108 (112)
 70 TIGR03836 termin_org_HMW1 cyta  27.3      57  0.0012   21.2   2.1   20   71-91     29-48  (82)
 71 PRK15184 curli production asse  26.4      63  0.0014   25.9   2.6   12    1-12      1-12  (277)
 72 COG3637 Opacity protein and re  26.1      49  0.0011   24.6   1.8   12    1-12      1-12  (199)
 73 PF09242 FCSD-flav_bind:  Flavo  26.1   1E+02  0.0022   19.3   3.1   27   65-91      9-36  (71)
 74 PRK11627 hypothetical protein;  25.9      54  0.0012   24.6   2.0    8   63-70    115-122 (192)
 75 KOG4737|consensus               25.6      27 0.00059   28.2   0.4   17    1-17      1-17  (326)
 76 PRK12698 flgH flagellar basal   25.4      54  0.0012   25.2   2.0    9    1-9       1-9   (224)
 77 PRK06724 hypothetical protein;  25.4      96  0.0021   20.9   3.1   21   64-84    103-125 (128)
 78 PF08194 DIM:  DIM protein;  In  25.2      79  0.0017   17.7   2.1    6    1-6       1-6   (36)
 79 PRK15346 outer membrane secret  25.0      48   0.001   28.1   1.8   12    1-12      1-12  (499)
 80 PF05593 RHS_repeat:  RHS Repea  24.9 1.2E+02  0.0026   16.2   2.9    8   70-77     11-18  (38)
 81 cd09013 BphC-JF8_N_like N-term  24.9   1E+02  0.0022   19.7   3.1   17   66-82    102-118 (121)
 82 PF15339 Afaf:  Acrosome format  24.7      43 0.00093   25.3   1.3   15    2-16    139-153 (200)
 83 PRK10959 outer membrane protei  24.4      60  0.0013   24.0   2.1   10    1-10      1-10  (212)
 84 PF10972 DUF2803:  Protein of u  24.4      99  0.0022   23.2   3.3   15    1-15      1-15  (213)
 85 COG4764 Uncharacterized protei  23.6      70  0.0015   24.0   2.2   17    1-17      5-23  (197)
 86 PF04379 DUF525:  Protein of un  23.5 1.2E+02  0.0026   19.9   3.1   14   60-73     77-90  (90)
 87 PRK13682 hypothetical protein;  23.3      71  0.0015   19.2   1.8   13    1-13      1-13  (51)
 88 PF03032 Brevenin:  Brevenin/es  23.0      66  0.0014   18.8   1.6   15    1-15      3-17  (46)
 89 PF15016 DUF4520:  Domain of un  22.8 2.3E+02   0.005   18.6   6.0   51   27-80      4-64  (85)
 90 PF06788 UPF0257:  Uncharacteri  22.8 2.1E+02  0.0045   22.3   4.8   28   62-90    140-167 (236)
 91 PF05899 Cupin_3:  Protein of u  22.7 1.3E+02  0.0029   18.5   3.1   24   61-86     30-53  (74)
 92 PF11355 DUF3157:  Protein of u  22.6   1E+02  0.0023   23.5   3.0    8   40-47     37-44  (199)
 93 PF09919 DUF2149:  Uncharacteri  22.4 2.4E+02  0.0053   18.6   5.4   19   60-79     72-90  (92)
 94 cd07266 HPCD_N_class_II N-term  22.3 1.3E+02  0.0027   19.1   3.1   16   66-81    102-117 (121)
 95 TIGR00547 lolA periplasmic cha  22.1      68  0.0015   24.0   1.9   12    1-12      1-12  (204)
 96 TIGR00616 rect recombinase, ph  22.1 1.2E+02  0.0026   23.6   3.4   44   40-84    145-189 (241)
 97 cd07244 FosA FosA, a Fosfomyci  22.1 1.1E+02  0.0025   19.6   2.9   18   66-83     94-111 (121)
 98 PF05643 DUF799:  Putative bact  21.9      65  0.0014   24.8   1.8    9    1-9       1-9   (215)
 99 cd08357 Glo_EDI_BRP_like_18 Th  21.6 1.3E+02  0.0028   19.0   3.0   15   67-81    110-124 (125)
100 PHA02978 hypothetical protein;  21.6      86  0.0019   22.0   2.2   19   62-80     72-90  (135)
101 cd09012 Glo_EDI_BRP_like_24 Th  20.7 1.4E+02   0.003   19.1   3.1   15   67-81    109-123 (124)
102 cd08361 PpCmtC_N N-terminal do  20.6 1.5E+02  0.0033   19.2   3.3   16   67-82    104-119 (124)
103 PF12771 SusD-like_2:  Starch-b  20.6      33 0.00072   28.7   0.0   10    1-10      1-10  (488)
104 cd07241 Glo_EDI_BRP_like_3 Thi  20.5 1.1E+02  0.0024   19.2   2.5   11   69-79    114-124 (125)
105 PF12445 FliC:  Flagellin prote  20.5 1.1E+02  0.0024   21.7   2.6   24   66-89     78-106 (128)

No 1  
>PF00379 Chitin_bind_4:  Insect cuticle protein;  InterPro: IPR000618 Insect cuticle is composed of proteins and chitin. The cuticular proteins seem to be specific to the type of cuticle (flexible or stiff) that occur at stages of the insect development. The proteins found in the flexible cuticle of larva and pupa of different insects share a conserved C-terminal section [] such a region is also found in the soft endocuticle of adults insects [] as well as in other cuticular proteins including in arachnids []. In addition, cuticular proteins share hydrophobic regions dominated by tetrapeptide repeats (A-A-P-A/V), which are presumed to be functionally important [, ]. Many insect cuticle proteins also include a 35-36 amino acid motif known as the R and R consensus. An extended form of this motif has been shown [] to bind chitin. It has no sequence similiarity to the cysteine-containing chitin-binding domain of chitinases and some peritrophic membrane proteins, suggesting that arthropods have two distinct classes of chitin-binding proteins, those with the chitin-binding domains found in lectins, chitinases and peritrophic membranes (cysCBD), and those with the type of chitin-binding domains found in cuticular proteins (non-cysCBD) []. The cuticle protein signature has been found in locust cuticle proteins 7 (LM-7), 8 (LM-8), 19 (LM-19) and endocuticle structural glycoprotein ABD-4; Hyalophora cecropia (Cecropia moth) cuticle proteins 12 and 66; Drosophila melanogaster (Fruit fly) larval cuticles proteins I, II, III and IV (LCP1 to LCP4); drosophila pupal cuticle proteins PCP, EDG-78E and EDG-84E; Manduca sexta (Tobacco hawkmoth) cuticle protein LCP-14; Tenebrio molitor (Yellow mealworm) cuticle proteins ACP-20, A1A, A2B and A3A; and Araneus diadematus (Spider) cuticle proteins ACP 11.9, ACP 12.4, ACP 12.6, ACP 15.5 and ACP 15.7.; GO: 0042302 structural constituent of cuticle
Probab=99.75  E-value=5.1e-18  Score=102.57  Aligned_cols=47  Identities=51%  Similarity=0.912  Sum_probs=43.7

Q ss_pred             eeeeEecCCCcEEEEeec-----CCCeEEeEEEEECCCCcEEEEEEEcCCCCe
Q psy2711          41 FGSAYTQEDGVQFTEESD-----QDGNRRGAYSYIDPSGQRRTITYTAGKNGF   88 (114)
Q Consensus        41 y~f~y~~~dg~~~~E~g~-----~~g~v~GsYsy~~pdG~~~~V~Y~AD~~Gf   88 (114)
                      |+|+|+++|| .++|++.     ..++|+|+|+|++|||++++|+|+||++||
T Consensus         1 Y~f~Y~~~dg-~~~e~~~~~~~~~~~~v~GsY~y~~pdG~~~~V~Y~Ad~~Gf   52 (52)
T PF00379_consen    1 YSFGYETSDG-SRQEEGRPETEDEGGVVRGSYSYIDPDGQTRTVTYVADENGF   52 (52)
T ss_pred             CeeEeEcCCC-CEEEEEEcccCCCCCEEEEEEEEECCCCCEEEEEEECCCCCC
Confidence            7899999999 7777775     788999999999999999999999999998


No 2  
>COG5294 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=93.29  E-value=0.47  Score=33.03  Aligned_cols=45  Identities=27%  Similarity=0.524  Sum_probs=26.1

Q ss_pred             CceeeeEecCCCcEEEEeecCCCeEEeEEEEE----CCCCcEEEEEEEcCC
Q psy2711          39 GQFGSAYTQEDGVQFTEESDQDGNRRGAYSYI----DPSGQRRTITYTAGK   85 (114)
Q Consensus        39 g~y~f~y~~~dg~~~~E~g~~~g~v~GsYsy~----~pdG~~~~V~Y~AD~   85 (114)
                      |+|++--...|.-...++...++..  .|+|.    +.+|+.-+|+|+|+.
T Consensus        28 d~fnpyvk~~~~y~k~~~~t~~~~~--~y~y~i~ayn~~Gkkk~v~f~a~~   76 (113)
T COG5294          28 DRFNPYVKITDSYAKVEEDTQDGSP--GYEYTITAYNKNGKKKEVKFTATH   76 (113)
T ss_pred             CCCCceEEEeccceecccccccCCc--cceeeehhhccCCcEEEEEEEecC
Confidence            3444444444433344544444433  45443    468999999999984


No 3  
>PF13956 Ibs_toxin:  Toxin Ibs, type I toxin-antitoxin system
Probab=91.90  E-value=0.098  Score=25.21  Aligned_cols=12  Identities=33%  Similarity=0.517  Sum_probs=8.2

Q ss_pred             CchHHHHHHHHH
Q psy2711           1 MEKLVFLFAIAS   12 (114)
Q Consensus         1 M~k~v~~~~l~a   12 (114)
                      |||+++++.++.
T Consensus         1 MMk~vIIlvvLL   12 (19)
T PF13956_consen    1 MMKLVIILVVLL   12 (19)
T ss_pred             CceehHHHHHHH
Confidence            888887765443


No 4  
>PF06004 DUF903:  Bacterial protein of unknown function (DUF903);  InterPro: IPR010305 This family consists of several small bacterial proteins several of which are classified as putative lipoproteins. The function of this family is unknown.; PDB: 2RB6_B 3BDU_F 2RA2_F 2RD1_C 3FIF_H 2JN0_A 2K57_A.
Probab=86.78  E-value=0.58  Score=28.05  Aligned_cols=37  Identities=27%  Similarity=0.545  Sum_probs=25.9

Q ss_pred             eEecCCCcEEEEeecCC-CeEEeEEEEECCCCcEEEEE
Q psy2711          44 AYTQEDGVQFTEESDQD-GNRRGAYSYIDPSGQRRTIT   80 (114)
Q Consensus        44 ~y~~~dg~~~~E~g~~~-g~v~GsYsy~~pdG~~~~V~   80 (114)
                      --.+.||....-.|.+. ..-.|-|+|.|.+|+.+.|+
T Consensus         3 vi~t~dG~~i~t~gkP~~D~~tG~~~y~D~~G~~~qIn   40 (50)
T PF06004_consen    3 VITTNDGRTIVTDGKPKYDKDTGMYSYTDADGKEQQIN   40 (50)
T ss_dssp             EEEETTSEEEEESSEEEEETTTTEEEEEBTTS-EEEEE
T ss_pred             EEEeCCCcEEEeCCCccccCCCCcEEEECCCCCEEEEc
Confidence            34567887666655432 23569999999999998875


No 5  
>TIGR01655 yxeA_fam conserved hypothetical protein TIGR01655. This model represents a family of small (about 115 amino acids) uncharacterized proteins with N-terminal signal sequences, found exclusively in Gram-positive organisms. Most genomes that have any members of this family have at least two members.
Probab=85.99  E-value=5  Score=27.53  Aligned_cols=16  Identities=31%  Similarity=0.727  Sum_probs=12.1

Q ss_pred             ECCCCcEEEEEEEcCC
Q psy2711          70 IDPSGQRRTITYTAGK   85 (114)
Q Consensus        70 ~~pdG~~~~V~Y~AD~   85 (114)
                      .|.+|+.+++++.+..
T Consensus        62 yd~~G~~k~i~f~~~~   77 (114)
T TIGR01655        62 YDSSGKKHKVKFMAGT   77 (114)
T ss_pred             ECCCCCEEEEEEEcCC
Confidence            4678888888887763


No 6  
>PF13511 DUF4124:  Domain of unknown function (DUF4124)
Probab=84.21  E-value=2.8  Score=24.93  Aligned_cols=11  Identities=27%  Similarity=0.745  Sum_probs=7.2

Q ss_pred             eEEEEECCCCc
Q psy2711          65 GAYSYIDPSGQ   75 (114)
Q Consensus        65 GsYsy~~pdG~   75 (114)
                      .-|+|+|.+|+
T Consensus        14 ~vYk~~D~~G~   24 (60)
T PF13511_consen   14 EVYKWVDENGV   24 (60)
T ss_pred             cEEEEECCCCC
Confidence            34677777775


No 7  
>PRK05461 apaG CO2+/MG2+ efflux protein ApaG; Reviewed
Probab=82.55  E-value=10  Score=26.75  Aligned_cols=20  Identities=30%  Similarity=0.694  Sum_probs=16.4

Q ss_pred             CCeEEeEEEEECCCCcEEEE
Q psy2711          60 DGNRRGAYSYIDPSGQRRTI   79 (114)
Q Consensus        60 ~g~v~GsYsy~~pdG~~~~V   79 (114)
                      .|..+|+|..+++||+...|
T Consensus        94 ~G~M~G~y~~~~~~G~~F~v  113 (127)
T PRK05461         94 SGTMQGHYQMVDEDGERFEV  113 (127)
T ss_pred             CEEEEEEEEEEeCCCCEEEE
Confidence            46799999999999987554


No 8  
>PF06286 Coleoptericin:  Coleoptericin;  InterPro: IPR009382 This family consists of several insect coleoptericin, acaloleptin, holotricin and rhinocerosin proteins which are all known to be antibacterial proteins []. These all appear to be short, glycine-rich molecules, inducible by infection.; GO: 0042742 defense response to bacterium, 0005576 extracellular region
Probab=81.03  E-value=0.44  Score=33.97  Aligned_cols=15  Identities=40%  Similarity=0.647  Sum_probs=12.4

Q ss_pred             CchHHHHHHHHHHhh
Q psy2711           1 MEKLVFLFAIASLSV   15 (114)
Q Consensus         1 M~k~v~~~~l~a~~a   15 (114)
                      ||||.|+|+|++..+
T Consensus         1 mmkl~i~~~lia~sa   15 (143)
T PF06286_consen    1 MMKLYIIFGLIALSA   15 (143)
T ss_pred             CceEeeehhHHHHHH
Confidence            999999999887444


No 9  
>COG2967 ApaG Uncharacterized protein affecting Mg2+/Co2+ transport [Inorganic ion transport and metabolism]
Probab=75.58  E-value=20  Score=25.42  Aligned_cols=21  Identities=29%  Similarity=0.608  Sum_probs=17.5

Q ss_pred             CCeEEeEEEEECCCCcEEEEE
Q psy2711          60 DGNRRGAYSYIDPSGQRRTIT   80 (114)
Q Consensus        60 ~g~v~GsYsy~~pdG~~~~V~   80 (114)
                      .|..+|+|.-++.||...+|.
T Consensus        93 ~G~M~GhY~M~~e~G~~F~v~  113 (126)
T COG2967          93 SGTMQGHYEMIDEDGETFDVA  113 (126)
T ss_pred             cceEEEEEEEecCCCcEEEee
Confidence            367899999999999987664


No 10 
>PF05404 TRAP-delta:  Translocon-associated protein, delta subunit precursor (TRAP-delta);  InterPro: IPR008855 This family consists of several eukaryotic translocon-associated protein, delta subunit precursors (TRAP-delta or SSR-delta). The exact function of this protein is unknown [].; GO: 0005783 endoplasmic reticulum, 0016021 integral to membrane
Probab=71.04  E-value=24  Score=26.15  Aligned_cols=15  Identities=33%  Similarity=0.529  Sum_probs=9.5

Q ss_pred             CchHHHHHHHHH-Hhh
Q psy2711           1 MEKLVFLFAIAS-LSV   15 (114)
Q Consensus         1 M~k~v~~~~l~a-~~a   15 (114)
                      |+++++++++++ +|+
T Consensus         1 m~~~~~~~~~~~~~~~   16 (167)
T PF05404_consen    1 MKKIVALLALLVSFCA   16 (167)
T ss_pred             ChhHHHHHHHHHHHhh
Confidence            888876666544 444


No 11 
>PF15240 Pro-rich:  Proline-rich
Probab=68.41  E-value=4.7  Score=30.24  Aligned_cols=17  Identities=35%  Similarity=0.362  Sum_probs=11.0

Q ss_pred             CchHHHHHHHHHHhhcc
Q psy2711           1 MEKLVFLFAIASLSVAQ   17 (114)
Q Consensus         1 M~k~v~~~~l~a~~aa~   17 (114)
                      |+.+||.+||||+.+|.
T Consensus         1 MLlVLLSvALLALSSAQ   17 (179)
T PF15240_consen    1 MLLVLLSVALLALSSAQ   17 (179)
T ss_pred             ChhHHHHHHHHHhhhcc
Confidence            66666667777655544


No 12 
>PF07437 YfaZ:  YfaZ precursor;  InterPro: IPR009998 This family contains the precursor of the bacterial protein YfaZ (approximately 180 residues long). Many members of this family are hypothetical proteins.
Probab=67.54  E-value=32  Score=25.46  Aligned_cols=10  Identities=30%  Similarity=0.404  Sum_probs=7.5

Q ss_pred             CchHHHHHHH
Q psy2711           1 MEKLVFLFAI   10 (114)
Q Consensus         1 M~k~v~~~~l   10 (114)
                      |+|+++++++
T Consensus         1 m~k~~~a~~~   10 (180)
T PF07437_consen    1 MKKFLLASAA   10 (180)
T ss_pred             CchHHHHHHH
Confidence            8998876654


No 13 
>PF11153 DUF2931:  Protein of unknown function (DUF2931);  InterPro: IPR021326  Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Currently, there is no known function. 
Probab=67.22  E-value=12  Score=27.96  Aligned_cols=16  Identities=19%  Similarity=0.312  Sum_probs=9.0

Q ss_pred             CchHHHHHHHHH--Hhhc
Q psy2711           1 MEKLVFLFAIAS--LSVA   16 (114)
Q Consensus         1 M~k~v~~~~l~a--~~aa   16 (114)
                      |+|++++++++.  +|+.
T Consensus         1 mk~i~~l~l~lll~~C~~   18 (216)
T PF11153_consen    1 MKKILLLLLLLLLTGCST   18 (216)
T ss_pred             ChHHHHHHHHHHHHhhcC
Confidence            778776554333  4543


No 14 
>PF12930 DUF3836:  Family of unknown function (DUF3836);  InterPro: IPR024339 This entry represents a family of bacterial proteins of unknown function.; PDB: 3MSW_A.
Probab=66.31  E-value=24  Score=24.99  Aligned_cols=43  Identities=16%  Similarity=0.245  Sum_probs=21.0

Q ss_pred             ceeeeEecCCCcEEEEee--cC---CCeEEeEEEEECCCCcEEEEEEEc
Q psy2711          40 QFGSAYTQEDGVQFTEES--DQ---DGNRRGAYSYIDPSGQRRTITYTA   83 (114)
Q Consensus        40 ~y~f~y~~~dg~~~~E~g--~~---~g~v~GsYsy~~pdG~~~~V~Y~A   83 (114)
                      .|.|.|+..+-....|.-  +.   ...-.-.+.|. -+|..++++|..
T Consensus        63 KY~Y~YD~~grl~eK~a~kWn~~k~~W~~~~~~~y~-Y~~~~~~~~Y~~  110 (132)
T PF12930_consen   63 KYNYKYDDNGRLTEKEAYKWNSNKNGWENYYKLNYS-YNGNEVTIEYAK  110 (132)
T ss_dssp             EEEEEEETTTTEEEEEEEEEETTTTEEEEEEEEEEE-EETTEEEEEEEE
T ss_pred             EEEEEECCCCCEeeeeeeeecccccceeeeEEEEEE-eCCcEEEEEEee
Confidence            677888776655444432  11   12222333333 233367777754


No 15 
>PRK09408 ompX outer membrane protein X; Provisional
Probab=66.18  E-value=44  Score=24.54  Aligned_cols=12  Identities=25%  Similarity=0.606  Sum_probs=7.0

Q ss_pred             eEEeEEEEECCC
Q psy2711          62 NRRGAYSYIDPS   73 (114)
Q Consensus        62 ~v~GsYsy~~pd   73 (114)
                      -+.||++|...|
T Consensus        61 Gvi~sfty~~~~   72 (171)
T PRK09408         61 GVIGSFTYTEKS   72 (171)
T ss_pred             EEEEEEEEecCc
Confidence            356666666543


No 16 
>KOG4088|consensus
Probab=61.76  E-value=47  Score=24.34  Aligned_cols=17  Identities=12%  Similarity=0.335  Sum_probs=11.7

Q ss_pred             CchHHHHHHHHH-Hhhcc
Q psy2711           1 MEKLVFLFAIAS-LSVAQ   17 (114)
Q Consensus         1 M~k~v~~~~l~a-~~aa~   17 (114)
                      |.|.++.+||++ +|+++
T Consensus         1 ms~~a~AlcLvas~C~~~   18 (167)
T KOG4088|consen    1 MSKIAVALCLVASACLCA   18 (167)
T ss_pred             CchhHHHHHHHHHHHHHH
Confidence            777777777776 55554


No 17 
>COG4939 Major membrane immunogen, membrane-anchored lipoprotein [Function unknown]
Probab=61.05  E-value=53  Score=23.64  Aligned_cols=42  Identities=21%  Similarity=0.294  Sum_probs=27.8

Q ss_pred             CCCCceeeeEecCCCcE----EEEeecCCCeEEeEEEEECCCCcEE
Q psy2711          36 SNNGQFGSAYTQEDGVQ----FTEESDQDGNRRGAYSYIDPSGQRR   77 (114)
Q Consensus        36 ~~~g~y~f~y~~~dg~~----~~E~g~~~g~v~GsYsy~~pdG~~~   77 (114)
                      -.+|.|+-.|+.-|...    -+-+-+.+..|+=.|-|.+-+|+..
T Consensus        29 ~~dGtY~~~y~~fDd~gwk~f~~iti~dGKiv~~~ydy~~k~G~~K   74 (147)
T COG4939          29 FNDGTYQGHYESFDDHGWKAFVTITIQDGKIVACTYDYRDKKGNIK   74 (147)
T ss_pred             ccCCceeeeeccccccCccceEEEEEeCCEEEEEEeeeecCCCCcc
Confidence            46788998888765321    1112234457888899999998864


No 18 
>PF13473 Cupredoxin_1:  Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D.
Probab=59.59  E-value=19  Score=23.48  Aligned_cols=42  Identities=24%  Similarity=0.260  Sum_probs=17.0

Q ss_pred             eeeeEecCCCcEEEEeecCCCeEEeEEEEECCCCcEEEEEEEcCCCC
Q psy2711          41 FGSAYTQEDGVQFTEESDQDGNRRGAYSYIDPSGQRRTITYTAGKNG   87 (114)
Q Consensus        41 y~f~y~~~dg~~~~E~g~~~g~v~GsYsy~~pdG~~~~V~Y~AD~~G   87 (114)
                      +.+.+...|...+.=.-+. ..    -+-..+-|+..+++.++++-|
T Consensus        45 v~l~~~N~~~~~h~~~i~~-~~----~~~~l~~g~~~~~~f~~~~~G   86 (104)
T PF13473_consen   45 VTLTFTNNDSRPHEFVIPD-LG----ISKVLPPGETATVTFTPLKPG   86 (104)
T ss_dssp             EEEEEEE-SSS-EEEEEGG-GT----EEEEE-TT-EEEEEEEE-S-E
T ss_pred             EEEEEEECCCCcEEEEECC-Cc----eEEEECCCCEEEEEEcCCCCE
Confidence            7777766655542222221 11    112334456666666666544


No 19 
>PF11777 DUF3316:  Protein of unknown function (DUF3316);  InterPro: IPR016879 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=56.29  E-value=7.9  Score=26.34  Aligned_cols=10  Identities=30%  Similarity=0.740  Sum_probs=7.5

Q ss_pred             CchHHHHHHH
Q psy2711           1 MEKLVFLFAI   10 (114)
Q Consensus         1 M~k~v~~~~l   10 (114)
                      |+|+++++++
T Consensus         1 MKk~~ll~~~   10 (114)
T PF11777_consen    1 MKKIILLASL   10 (114)
T ss_pred             CchHHHHHHH
Confidence            8898877754


No 20 
>PF11948 DUF3465:  Protein of unknown function (DUF3465);  InterPro: IPR021856  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 131 to 151 amino acids in length. This protein has a conserved HWTH sequence motif. 
Probab=52.58  E-value=83  Score=22.46  Aligned_cols=51  Identities=14%  Similarity=0.175  Sum_probs=29.1

Q ss_pred             CCCceeeeEecCCCcEEEEeec-----------CC--CeEEeEEEEECCCCcEEEEEEEc-CCCCeee
Q psy2711          37 NNGQFGSAYTQEDGVQFTEESD-----------QD--GNRRGAYSYIDPSGQRRTITYTA-GKNGFQA   90 (114)
Q Consensus        37 ~~g~y~f~y~~~dg~~~~E~g~-----------~~--g~v~GsYsy~~pdG~~~~V~Y~A-D~~Gf~~   90 (114)
                      +...-.|-.+.++|.+-.-.-+           .+  -.+.|+|.|.. .|.  .|.||- |..|=++
T Consensus        55 GsrHQ~Fiv~l~~g~tllIahNIDlaprip~l~~GD~V~f~GeYe~n~-kgg--vIHWTH~dp~~~h~  119 (131)
T PF11948_consen   55 GSRHQRFIVRLSSGQTLLIAHNIDLAPRIPWLQKGDQVEFYGEYEWNP-KGG--VIHWTHHDPRGRHP  119 (131)
T ss_pred             CCcceEEEEEeCCCCEEEEEeccCccccCcCcCCCCEEEEEEEEEECC-CCC--EEEeeccCCCCCCC
Confidence            3345667777888876332211           11  25889998877 554  456665 4444333


No 21 
>PRK11443 lipoprotein; Provisional
Probab=50.37  E-value=14  Score=25.87  Aligned_cols=16  Identities=19%  Similarity=0.077  Sum_probs=9.6

Q ss_pred             CchHHHHHHH--HHHhhc
Q psy2711           1 MEKLVFLFAI--ASLSVA   16 (114)
Q Consensus         1 M~k~v~~~~l--~a~~aa   16 (114)
                      |+++++++++  |+.|++
T Consensus         1 Mk~~~~~~~~~lLsgCa~   18 (124)
T PRK11443          1 MKKFIAPLLALLLSGCQI   18 (124)
T ss_pred             ChHHHHHHHHHHHHhccC
Confidence            8887766653  334554


No 22 
>PF11714 Inhibitor_I53:  Thrombin inhibitor Madanin  ;  InterPro: IPR021716  Members of this family are the peptidase inhibitor madanin proteins. These proteins were isolated from tick saliva []. 
Probab=49.70  E-value=15  Score=23.70  Aligned_cols=10  Identities=20%  Similarity=0.408  Sum_probs=7.2

Q ss_pred             CchHHHHHHH
Q psy2711           1 MEKLVFLFAI   10 (114)
Q Consensus         1 M~k~v~~~~l   10 (114)
                      |++|.+|+++
T Consensus         1 MKhFaiLila   10 (78)
T PF11714_consen    1 MKHFAILILA   10 (78)
T ss_pred             CchHHHHHHH
Confidence            8888766554


No 23 
>KOG4824|consensus
Probab=48.08  E-value=72  Score=24.63  Aligned_cols=24  Identities=21%  Similarity=0.461  Sum_probs=19.7

Q ss_pred             CCeEEeEEEEECCCCcEEEEEEEc
Q psy2711          60 DGNRRGAYSYIDPSGQRRTITYTA   83 (114)
Q Consensus        60 ~g~v~GsYsy~~pdG~~~~V~Y~A   83 (114)
                      +|..+|.|++.++||+++..+-.-
T Consensus        65 ~gctt~~y~~~nkngkI~Vln~~v   88 (224)
T KOG4824|consen   65 GGCTTGAYTFDNKNGKIHVLNECV   88 (224)
T ss_pred             CCceeeeeEecCCCceEEEeeeee
Confidence            457899999999999998877554


No 24 
>PF10855 DUF2648:  Protein of unknown function (DUF2648);  InterPro: IPR022561  This family of proteins with unknown function appears to be restricted to eubacteia. 
Probab=47.01  E-value=6.5  Score=21.55  Aligned_cols=12  Identities=25%  Similarity=0.598  Sum_probs=9.0

Q ss_pred             CchHHHHHHHHH
Q psy2711           1 MEKLVFLFAIAS   12 (114)
Q Consensus         1 M~k~v~~~~l~a   12 (114)
                      |+||.+++.|..
T Consensus         1 MKkl~i~L~l~g   12 (33)
T PF10855_consen    1 MKKLAIILILGG   12 (33)
T ss_pred             CCceeehhhhhh
Confidence            889888777654


No 25 
>PF00879 Defensin_propep:  Defensin propeptide The pattern for this Prosite entry doesn't match the propeptide.;  InterPro: IPR002366 Defensins are 2-6 kDa, cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses [], containing three pairs of intramolecular disulphide bonds []. On the basis of their size and pattern of disulphide bonding, mammalian defensins are classified into alpha, beta and theta categories. Alpha-defensins, which have been identified in humans, monkeys and several rodent species, are particularly abundant in neutrophils, certain macrophage populations and Paneth cells of the small intestine. Every mammalian species explored thus far has beta-defensins. In cows, as many as 13 beta-defensins exist in neutrophils. However, in other species, beta-defensins are more often produced by epithelial cells lining various organs (e.g. the epidermis, bronchial tree and genitourinary tract). Theta-defensins are cyclic and have so far only been identified in primate phagocytes.   Defensins are produced constitutively and/or in response to microbial products or proinflammatory cytokines. Some defensins are also called corticostatins (CS) because they inhibit corticotropin-stimulated corticosteroid production. The mechanism(s) by which microorganisms are killed and/or inactivated by defensins is not understood completely. However, it is generally believed that killing is a consequence of disruption of the microbial membrane. The polar topology of defensins, with spatially separated charged and hydrophobic regions, allows them to insert themselves into the phospholipid membranes so that their hydrophobic regions are buried within the lipid membrane interior and their charged (mostly cationic) regions interact with anionic phospholipid head groups and water. Subsequently, some defensins can aggregate to form `channel-like' pores; others might bind to and cover the microbial membrane in a `carpet-like' manner. The net outcome is the disruption of membrane integrity and function, which ultimately leads to the lysis of microorganisms. Some defensins are synthesized as propeptides which may be relevant to this process - in neutrophils only the mature peptides have been identified but in Paneth cells, the propeptide is stored in vesicles [] and appears to be cleaved by trypsin on activation.  ; GO: 0006952 defense response
Probab=45.67  E-value=60  Score=19.56  Aligned_cols=12  Identities=33%  Similarity=0.404  Sum_probs=8.5

Q ss_pred             CchHHHHHHHHH
Q psy2711           1 MEKLVFLFAIAS   12 (114)
Q Consensus         1 M~k~v~~~~l~a   12 (114)
                      |..|+++.+|+.
T Consensus         1 MRTL~LLaAlLL   12 (52)
T PF00879_consen    1 MRTLALLAALLL   12 (52)
T ss_pred             CcHHHHHHHHHH
Confidence            777877777554


No 26 
>PRK09980 ompL outer membrane porin L; Provisional
Probab=44.88  E-value=68  Score=24.76  Aligned_cols=34  Identities=12%  Similarity=0.134  Sum_probs=18.1

Q ss_pred             ceeeeEecCCCcEEEEeec-----------CCCeEEeEEEE-ECCC
Q psy2711          40 QFGSAYTQEDGVQFTEESD-----------QDGNRRGAYSY-IDPS   73 (114)
Q Consensus        40 ~y~f~y~~~dg~~~~E~g~-----------~~g~v~GsYsy-~~pd   73 (114)
                      ....++..+||.-...+..           ...++.++|.| ..-|
T Consensus        40 Ri~vsh~f~nG~Gf~~eak~~~~~dd~~~~~~~E~~~sY~~~k~~d   85 (230)
T PRK09980         40 MLRVGYNFDMGAGIMLTNTYTFQRDDELKHGYNEIEGWYPLFKPTD   85 (230)
T ss_pred             EEEEEEEccCceeEEEEEEeccCCCccccccceEEEEEEEeEecCC
Confidence            5666666667664433321           12356678864 4444


No 27 
>PF11803 UXS1_N:  UDP-glucuronate decarboxylase N-terminal;  InterPro: IPR021761  The N terminus of the UDP-glucuronate decarboxylases may be involved in localisation to the perinuclear Golgi membrane. ; GO: 0048040 UDP-glucuronate decarboxylase activity
Probab=44.84  E-value=14  Score=24.08  Aligned_cols=14  Identities=21%  Similarity=0.207  Sum_probs=10.9

Q ss_pred             CchHHHHHHHHHHh
Q psy2711           1 MEKLVFLFAIASLS   14 (114)
Q Consensus         1 M~k~v~~~~l~a~~   14 (114)
                      |||+++.++|++-+
T Consensus        17 ~mkll~~lal~ayi   30 (78)
T PF11803_consen   17 RMKLLLGLALIAYI   30 (78)
T ss_pred             HHHHHHHHHHHHHH
Confidence            78999888887733


No 28 
>PRK15240 resistance to complement killing; Provisional
Probab=42.52  E-value=93  Score=22.96  Aligned_cols=10  Identities=30%  Similarity=0.454  Sum_probs=6.9

Q ss_pred             CchHHHHHHH
Q psy2711           1 MEKLVFLFAI   10 (114)
Q Consensus         1 M~k~v~~~~l   10 (114)
                      |+|.++++++
T Consensus         1 Mkk~~~~~~~   10 (185)
T PRK15240          1 MKKIVLSSLL   10 (185)
T ss_pred             CchhHHHHHH
Confidence            8888765544


No 29 
>PRK15209 long polar fimbrial protein LpfA; Provisional
Probab=42.27  E-value=27  Score=24.93  Aligned_cols=12  Identities=33%  Similarity=0.609  Sum_probs=8.1

Q ss_pred             CchHHHHHHHHH
Q psy2711           1 MEKLVFLFAIAS   12 (114)
Q Consensus         1 M~k~v~~~~l~a   12 (114)
                      |+|.++.+++++
T Consensus         1 Mkk~~~~~~~~~   12 (174)
T PRK15209          1 MKKVVFALSALA   12 (174)
T ss_pred             CchHHHHHHHHH
Confidence            899877665443


No 30 
>PF09403 FadA:  Adhesion protein FadA;  InterPro: IPR018543  FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices. ; PDB: 3ETZ_B 3ETY_A 2GL2_B 3ETX_C 3ETW_A.
Probab=39.90  E-value=9.6  Score=26.92  Aligned_cols=12  Identities=25%  Similarity=0.359  Sum_probs=0.0

Q ss_pred             CchHHHHHHHHH
Q psy2711           1 MEKLVFLFAIAS   12 (114)
Q Consensus         1 M~k~v~~~~l~a   12 (114)
                      |+|++|++.|++
T Consensus         1 MKK~ll~~~lll   12 (126)
T PF09403_consen    1 MKKILLLGMLLL   12 (126)
T ss_dssp             ------------
T ss_pred             ChHHHHHHHHHH
Confidence            889877655443


No 31 
>PRK09810 entericidin A; Provisional
Probab=39.45  E-value=26  Score=20.09  Aligned_cols=8  Identities=38%  Similarity=0.812  Sum_probs=3.2

Q ss_pred             CchHHHHH
Q psy2711           1 MEKLVFLF    8 (114)
Q Consensus         1 M~k~v~~~    8 (114)
                      |+|+++++
T Consensus         2 Mkk~~~l~    9 (41)
T PRK09810          2 MKRLIVLV    9 (41)
T ss_pred             hHHHHHHH
Confidence            34444333


No 32 
>COG5455 Predicted integral membrane protein [Function unknown]
Probab=39.18  E-value=23  Score=25.19  Aligned_cols=15  Identities=27%  Similarity=0.244  Sum_probs=8.6

Q ss_pred             CchHHHHHHHHHHhh
Q psy2711           1 MEKLVFLFAIASLSV   15 (114)
Q Consensus         1 M~k~v~~~~l~a~~a   15 (114)
                      |+|||++++++++++
T Consensus         2 mkrlv~~lla~s~~a   16 (129)
T COG5455           2 MKRLVSALLAVSSVA   16 (129)
T ss_pred             chhHHHHHHHHHHhh
Confidence            666666665555443


No 33 
>PF06316 Ail_Lom:  Enterobacterial Ail/Lom protein;  InterPro: IPR000758 Virulence-related outer membrane proteins are expressed in Gram-negative bacteria and are essential to bacterial survival within macrophages and for eukaryotic cell invasion. Members of this group include: PagC, required by Salmonella typhimurium for survival in macrophages and for virulence in mice [] Rck outer membrane protein of the S. typhimurium virulence plasmid [] Ail, a product of the Yersinia enterocolitica chromosome capable of mediating bacterial adherence to and invasion of epithelial cell lines []  OmpX from Escherichia coli that promotes adhesion to and entry into mammalian cells. It also has a role in the resistance against attack by the human complement system []  a Bacteriophage lambda outer membrane protein, Lom [] The crystal structure of OmpX from E. coli reveals that OmpX consists of an eight-stranded antiparallel all-next-neighbour beta barrel []. The structure shows two girdles of aromatic amino acid residues and a ribbon of nonpolar residues that attach to the membrane interior. The core of the barrel consists of an extended hydrogen-bonding network of highly conserved residues. OmpX thus resembles an inverse micelle. The OmpX structure shows that the membrane-spanning part of the protein is much better conserved than the extracellular loops. Moreover, these loops form a protruding beta sheet, the edge of which presumably binds to external proteins. It is suggested that this type of binding promotes cell adhesion and invasion and helps defend against the complement system. Although OmpX has the same beta-sheet topology as the structurally related outer membrane protein A (OmpA) IPR000498 from INTERPRO, their barrels differ with respect to the shear numbers and internal hydrogen-bonding networks.; GO: 0009279 cell outer membrane
Probab=38.87  E-value=88  Score=23.84  Aligned_cols=14  Identities=14%  Similarity=0.226  Sum_probs=10.0

Q ss_pred             EEeEEEEECCCCcE
Q psy2711          63 RRGAYSYIDPSGQR   76 (114)
Q Consensus        63 v~GsYsy~~pdG~~   76 (114)
                      +.||++|...|+..
T Consensus        65 vItSfSY~~~~~~~   78 (199)
T PF06316_consen   65 VITSFSYASGDDSS   78 (199)
T ss_pred             eeEEEEEeecCCCc
Confidence            67788887777654


No 34 
>PF08139 LPAM_1:  Prokaryotic membrane lipoprotein lipid attachment site;  InterPro: IPR012640  In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognises a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached [,].  This lipid attachment site is found in homologues of the VirB proteins of type IV secretion systems (T4SS). Conjugal transfer across the cell envelope of Gram-negative bacteria is mediated by a supramolecular structure termed mating pair formation (Mpf) complex. Collectively, secretion pathways ancestrally related to bacterial conjugation systems are now known as T4SS. T4SS are involved in the delivery of effector molecules to eukaryotic target cells; each of these systems exports distinct DNA or protein substrates to effect a myriad of changes in host cell physiology during infection [].
Probab=38.52  E-value=24  Score=18.13  Aligned_cols=8  Identities=25%  Similarity=0.604  Sum_probs=3.9

Q ss_pred             chHHHHHH
Q psy2711           2 EKLVFLFA    9 (114)
Q Consensus         2 ~k~v~~~~    9 (114)
                      +|+++.++
T Consensus         8 Kkil~~l~   15 (25)
T PF08139_consen    8 KKILFPLL   15 (25)
T ss_pred             HHHHHHHH
Confidence            55554444


No 35 
>PRK11372 lysozyme inhibitor; Provisional
Probab=38.32  E-value=24  Score=24.12  Aligned_cols=16  Identities=25%  Similarity=0.233  Sum_probs=9.0

Q ss_pred             CchHHHHHHH--HHHhhc
Q psy2711           1 MEKLVFLFAI--ASLSVA   16 (114)
Q Consensus         1 M~k~v~~~~l--~a~~aa   16 (114)
                      |+++++++++  |+.|+.
T Consensus         3 mk~ll~~~~~~lL~gCs~   20 (109)
T PRK11372          3 MKKLLIICLPVLLTGCSA   20 (109)
T ss_pred             hHHHHHHHHHHHHHHhcC
Confidence            6776666553  444543


No 36 
>PF06291 Lambda_Bor:  Bor protein;  InterPro: IPR010438 This family consists of several Bacteriophage lambda Bor and Escherichia coli Iss proteins. Expression of bor significantly increases the survival of the E. coli host cell in animal serum. This property is a well known bacterial virulence determinant indeed, bor and its adjacent sequences are highly homologous to the iss serum resistance locus of the plasmid ColV2-K94, which confers virulence in animals. It has been suggested that lysogeny may generally have a role in bacterial survival in animal hosts, and perhaps in pathogenesis [].
Probab=38.06  E-value=28  Score=23.51  Aligned_cols=10  Identities=40%  Similarity=0.607  Sum_probs=7.2

Q ss_pred             CchHHHHHHH
Q psy2711           1 MEKLVFLFAI   10 (114)
Q Consensus         1 M~k~v~~~~l   10 (114)
                      |+|++++++|
T Consensus         1 mKk~ll~~~l   10 (97)
T PF06291_consen    1 MKKLLLAAAL   10 (97)
T ss_pred             CcHHHHHHHH
Confidence            8888776654


No 37 
>COG2821 MltA Membrane-bound lytic murein transglycosylase [Cell envelope biogenesis, outer membrane]
Probab=36.66  E-value=44  Score=27.81  Aligned_cols=27  Identities=30%  Similarity=0.388  Sum_probs=23.1

Q ss_pred             eEEeEEEEECCCCcEEEEEEEcCCCCee
Q psy2711          62 NRRGAYSYIDPSGQRRTITYTAGKNGFQ   89 (114)
Q Consensus        62 ~v~GsYsy~~pdG~~~~V~Y~AD~~Gf~   89 (114)
                      .|+||=...-+||++..+.| |++||+-
T Consensus       192 ~VQGSg~l~~~dG~~~r~~Y-Agkng~p  218 (373)
T COG2821         192 HVQGSGRLDLGDGRLNRFGY-AGKNGHP  218 (373)
T ss_pred             eecccEEEEcCCCCEEEEEE-cccCCCc
Confidence            59999999999999999998 6667653


No 38 
>TIGR02052 MerP mercuric transport protein periplasmic component. This model represents the periplasmic mercury (II) binding protein of the bacterial mercury detoxification system which passes mercuric ion to the MerT transporter for subsequent reduction to Hg(0) by the mercuric reductase MerA. MerP contains a distinctive GMTCXXC motif associated with metal binding. MerP is related to a larger family of metal binding proteins (pfam00403).
Probab=36.00  E-value=30  Score=20.50  Aligned_cols=15  Identities=40%  Similarity=0.512  Sum_probs=10.6

Q ss_pred             CchHHHHHHHHHHhh
Q psy2711           1 MEKLVFLFAIASLSV   15 (114)
Q Consensus         1 M~k~v~~~~l~a~~a   15 (114)
                      |+|++-+++|+....
T Consensus         1 ~~~~~~~~~~~~~~~   15 (92)
T TIGR02052         1 MKKLATLLALFVLTS   15 (92)
T ss_pred             ChhHHHHHHHHHHhc
Confidence            888887777765443


No 39 
>TIGR00156 conserved hypothetical protein TIGR00156. As of the last revision, this family consists only of two proteins from Escherichia coli and one from the related species Haemophilus influenzae.
Probab=35.97  E-value=25  Score=24.82  Aligned_cols=10  Identities=20%  Similarity=0.205  Sum_probs=6.9

Q ss_pred             CchHHHHHHH
Q psy2711           1 MEKLVFLFAI   10 (114)
Q Consensus         1 M~k~v~~~~l   10 (114)
                      |+|++++++|
T Consensus         1 MKK~~~~~~~   10 (126)
T TIGR00156         1 MKFQAIVLAS   10 (126)
T ss_pred             CchHHHHHHH
Confidence            8887765554


No 40 
>PRK10159 outer membrane phosphoporin protein E; Provisional
Probab=35.15  E-value=35  Score=27.38  Aligned_cols=12  Identities=17%  Similarity=0.343  Sum_probs=7.9

Q ss_pred             CchHHHHHHHHH
Q psy2711           1 MEKLVFLFAIAS   12 (114)
Q Consensus         1 M~k~v~~~~l~a   12 (114)
                      |+|.++.+++++
T Consensus         1 Mkk~l~a~~~~a   12 (351)
T PRK10159          1 MKKSTLALVVMG   12 (351)
T ss_pred             CchhhHHHHHHH
Confidence            888776665554


No 41 
>PF12276 DUF3617:  Protein of unknown function (DUF3617);  InterPro: IPR022061  This family of proteins is found in bacteria. Proteins in this family are typically between 155 and 179 amino acids in length. There is a single completely conserved residue C that may be functionally important. 
Probab=34.65  E-value=68  Score=22.38  Aligned_cols=12  Identities=17%  Similarity=0.263  Sum_probs=7.8

Q ss_pred             CchHHHHHHHHH
Q psy2711           1 MEKLVFLFAIAS   12 (114)
Q Consensus         1 M~k~v~~~~l~a   12 (114)
                      |.++++++++++
T Consensus         1 M~~~~~~~~~~~   12 (162)
T PF12276_consen    1 MKRRLLLALALA   12 (162)
T ss_pred             CchHHHHHHHHH
Confidence            777776666544


No 42 
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain. This family contains the N-terminal, non-catalytic, domain of type I, class II extradiol dioxygenases. Dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings. Two major groups of dioxygenases have been identified according to the cleavage site; extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon, whereas intradiol enzymes cleave the aromatic ring between two hydroxyl groups. Extradiol dioxygenases are classified into type I and type II enzymes. Type I extradiol dioxygenases include class I and class II enzymes. These two classes of enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. The extradiol dioxygenases represented in this fa
Probab=34.54  E-value=67  Score=20.09  Aligned_cols=20  Identities=20%  Similarity=0.343  Sum_probs=15.8

Q ss_pred             eEEEEECCCCcEEEEEEEcC
Q psy2711          65 GAYSYIDPSGQRRTITYTAG   84 (114)
Q Consensus        65 GsYsy~~pdG~~~~V~Y~AD   84 (114)
                      -++.+.||||..+++.+..|
T Consensus        97 ~~~~~~DP~G~~ie~~~~~~  116 (117)
T cd07240          97 RGLRFQDPDGHLLELFVEAD  116 (117)
T ss_pred             eEEEEECCCCCEEEEEEccC
Confidence            35678999999999887655


No 43 
>PRK10053 hypothetical protein; Provisional
Probab=34.17  E-value=33  Score=24.34  Aligned_cols=10  Identities=20%  Similarity=0.145  Sum_probs=6.9

Q ss_pred             CchHHHHHHH
Q psy2711           1 MEKLVFLFAI   10 (114)
Q Consensus         1 M~k~v~~~~l   10 (114)
                      |+|+++++++
T Consensus         1 MKK~~~~~~~   10 (130)
T PRK10053          1 MKLQAIALAS   10 (130)
T ss_pred             CcHHHHHHHH
Confidence            8997765554


No 44 
>PF00659 POLO_box:  POLO box duplicated region;  InterPro: IPR000959 A subgroup of serine/threonine protein kinases, Polo or Polo-like kinases play multiple roles during the cell cycle. Polo kinases are required at several key points through mitosis, starting from control of the G2/M transition through phosphorylation of Cdc25C and mitotic cyclins. Polo kinases are characterised by an amino terminal catalytic domain, and a carboxy terminal non-catalytic domain consisting of three blocks of conserved sequences known as polo boxes which form one single functional domain []. The domain is named after its founding member encoded by the polo gene of Drosophila melanogaster []. This domain of around 70 amino acids has been found in species ranging from yeast to mammals. Polo boxes appear to mediate interaction with multiple proteins through protein:protein interactions; some but not all of these proteins are substrates for the kinase domain of the molecule [].  The crystal structure of the polo domain of the murine protein, Sak, is dimeric, consisting of two alpha-helices and two six-stranded beta-sheets []. The topology of one polypeptide subunit of the dimer consists of, from its N- to C terminus, an extended strand segment, five beta-strands, one alpha-helix (A) and a C-terminal beta-strand. Beta-strands from one subunit form a contiguous antiparallel beta-sheet with beta-strands from the second subunit. The two beta-sheets pack with a crossing angle of 110 degrees, orienting the hydrophobic surfaces inward and the hydrophilic surfaces outward. Helix A, which is colinear with beta-strand 6 of the same polypeptide, buries a large portion of the non-overlapping hydrophobic beta-sheet surfaces. Interactions involving helices A comprise a majority of the hydrophobic core structure and also the dimer interface. Point mutations in the Polo box of the budding yeast Cdc5 protein abolish the ability of overexpressed Cdc5 to interact with the spindle poles and to organise cytokinetic structures [].; GO: 0005515 protein binding; PDB: 1MBY_B 3P37_A 3MHN_A 1Q4K_A 3HIK_A 3Q1I_A 3P35_A 3MHQ_A 1UMW_B 3MQ8_B ....
Probab=33.92  E-value=1.1e+02  Score=18.40  Aligned_cols=40  Identities=25%  Similarity=0.422  Sum_probs=23.1

Q ss_pred             ceeeeEecCCCcEEEEeecCCCeE----EeEEEEECCCCcEEEE
Q psy2711          40 QFGSAYTQEDGVQFTEESDQDGNR----RGAYSYIDPSGQRRTI   79 (114)
Q Consensus        40 ~y~f~y~~~dg~~~~E~g~~~g~v----~GsYsy~~pdG~~~~V   79 (114)
                      .|.+.|..+||+.+-.--|....+    .....|++++|+..+.
T Consensus         4 k~gi~~~LSng~vqv~FnD~tkivl~~~~~~v~yi~~~~~~~~~   47 (68)
T PF00659_consen    4 KYGIGYQLSNGTVQVNFNDHTKIVLSPDGRLVTYIDRDGERQTY   47 (68)
T ss_dssp             CSEEEEEETTSEEEEEETTS-EEEEETTCCEEEEE-TTS-EEEE
T ss_pred             ceEEEEEEeCCCEEEEEeCCCEEEECCCCCEEEEECCCCcEEEE
Confidence            367888889988755433322111    1377888888876544


No 45 
>TIGR01643 YD_repeat_2x YD repeat (two copies). This model describes two tandem copies of a 21-residue extracellular repeat found in Gram-negative, Gram-positive, and animal proteins. The repeat is named for a YD dipeptide, the most strongly conserved motif of the repeat. These repeats appear in general to be involved in binding carbohydrate; the chicken teneurin-1 YD-repeat region has been shown to bind heparin.
Probab=32.76  E-value=72  Score=17.03  Aligned_cols=14  Identities=29%  Similarity=0.453  Sum_probs=8.9

Q ss_pred             EEECCCCcEEEEEE
Q psy2711          68 SYIDPSGQRRTITY   81 (114)
Q Consensus        68 sy~~pdG~~~~V~Y   81 (114)
                      +.++|+|...+.+|
T Consensus         9 ~~~~p~G~~~~~~Y   22 (42)
T TIGR01643         9 GSTDADGTTTRYTY   22 (42)
T ss_pred             EEECCCCCEEEEEE
Confidence            35667777666666


No 46 
>PRK10350 hypothetical protein; Provisional
Probab=32.43  E-value=32  Score=24.73  Aligned_cols=13  Identities=31%  Similarity=0.621  Sum_probs=10.1

Q ss_pred             CchHHHHHHHHHH
Q psy2711           1 MEKLVFLFAIASL   13 (114)
Q Consensus         1 M~k~v~~~~l~a~   13 (114)
                      |++|+++.+|+-+
T Consensus         1 MKr~L~~~allP~   13 (145)
T PRK10350          1 MKRLLLLTALLPF   13 (145)
T ss_pred             ChhHHHHHHHhHH
Confidence            8899988887653


No 47 
>PF05423 Mycobact_memb:  Mycobacterium membrane protein;  InterPro: IPR008693 This family contains several membrane proteins from Mycobacterium species [].
Probab=32.19  E-value=1.1e+02  Score=21.72  Aligned_cols=24  Identities=29%  Similarity=0.601  Sum_probs=16.0

Q ss_pred             EEeEEEEECCCCcEEEEEEEcCCCC
Q psy2711          63 RRGAYSYIDPSGQRRTITYTAGKNG   87 (114)
Q Consensus        63 v~GsYsy~~pdG~~~~V~Y~AD~~G   87 (114)
                      .+=.|....+.|...+|+|. |++|
T Consensus        51 k~V~YEV~G~~G~~~~I~Y~-D~~~   74 (140)
T PF05423_consen   51 KTVTYEVTGPPGSTATISYL-DADG   74 (140)
T ss_pred             cEEEEEEEcCCCCeEEEEEE-cCCC
Confidence            34467777777887888886 4444


No 48 
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only]
Probab=31.93  E-value=61  Score=24.89  Aligned_cols=29  Identities=28%  Similarity=0.447  Sum_probs=26.9

Q ss_pred             EeEEEEECCCCcEEEEEEEcCCCCeeecc
Q psy2711          64 RGAYSYIDPSGQRRTITYTAGKNGFQASG   92 (114)
Q Consensus        64 ~GsYsy~~pdG~~~~V~Y~AD~~Gf~~~~   92 (114)
                      +|.+-.-+++|+.+++.+.++.-||.|.+
T Consensus       113 ~g~m~v~~~~G~~~v~~~~~Gd~iyVPp~  141 (209)
T COG2140         113 EGRMLVQKPEGEARVIAVRAGDVIYVPPG  141 (209)
T ss_pred             cEEEEEEcCCCcEEEEEecCCcEEEeCCC
Confidence            58899999999999999999999999976


No 49 
>COG3422 Uncharacterized conserved protein [Function unknown]
Probab=31.40  E-value=65  Score=19.94  Aligned_cols=20  Identities=15%  Similarity=0.305  Sum_probs=16.3

Q ss_pred             eccCCCCceeeeEecCCCcE
Q psy2711          33 RYLSNNGQFGSAYTQEDGVQ   52 (114)
Q Consensus        33 ~~~~~~g~y~f~y~~~dg~~   52 (114)
                      -+.+.+|.|.|.+...||..
T Consensus         7 i~kdk~Ge~rfrlkA~N~ei   26 (59)
T COG3422           7 IYKDKAGEYRFRLKAANGEI   26 (59)
T ss_pred             EEEcCCCcEEEEEEccCccE
Confidence            35678899999999988864


No 50 
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1.13.11.39) 1 from Rhodococcus globerulus P6 (BphC1-RGP6) and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of BphC1-RGP6 and similar proteins. BphC catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). This subfamily of BphCs belongs to the type I extradiol dioxygenase family, which require a metal in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of 2,3-dihydroxybiphenyl 1,2-dioxygenases. For example, three types of BphC enzymes have been found in Rhodococcus globerulus (BphC1-RGP6 - BphC3-RGP6), all three enzymes are type I extradiol dioxygenases. BphC1-RGP6 has an internal duplication, it is a two-domain dioxygenase which forms octamers, and has Fe(II) at the catalytic site. Its N-
Probab=31.15  E-value=74  Score=20.54  Aligned_cols=20  Identities=25%  Similarity=0.615  Sum_probs=16.2

Q ss_pred             eEEEEECCCCcEEEEEEEcC
Q psy2711          65 GAYSYIDPSGQRRTITYTAG   84 (114)
Q Consensus        65 GsYsy~~pdG~~~~V~Y~AD   84 (114)
                      ....+.||||...++.|.-+
T Consensus       100 ~~~~~~DPdG~~iE~~~~~~  119 (120)
T cd07252         100 GLIRFADPDGNRHELFWGPK  119 (120)
T ss_pred             EEEEEECCCCCEEEEEeccc
Confidence            36899999999988877544


No 51 
>PHA02698 hypothetical protein; Provisional
Probab=31.08  E-value=29  Score=22.78  Aligned_cols=25  Identities=28%  Similarity=0.608  Sum_probs=19.5

Q ss_pred             CCeeeccCCCCCCCCCCCCCCCCCC
Q psy2711          86 NGFQASGDDIPVAPPAPPAPAPVAP  110 (114)
Q Consensus        86 ~Gf~~~~~~lP~~pp~p~~~~~~~~  110 (114)
                      .|-|+.|+..|+|-|+|+.-..-+|
T Consensus        19 ddvqvnGDlmPtp~p~peeV~~CsP   43 (89)
T PHA02698         19 DDVQVNGDLMPTPEPTPEEVPQCSP   43 (89)
T ss_pred             hccccCCcccCCCCCChhhhccCCH
Confidence            4778899999999998877655444


No 52 
>KOG4327|consensus
Probab=30.89  E-value=38  Score=26.05  Aligned_cols=16  Identities=38%  Similarity=0.787  Sum_probs=11.2

Q ss_pred             CCCCCCCCCCCCCCCC
Q psy2711          94 DIPVAPPAPPAPAPVA  109 (114)
Q Consensus        94 ~lP~~pp~p~~~~~~~  109 (114)
                      ..|.+||+|+.+.|+.
T Consensus       168 fmpppPP~pp~i~p~~  183 (218)
T KOG4327|consen  168 FMPPPPPMPPPICPDS  183 (218)
T ss_pred             cCCCCCCCCcccCCCC
Confidence            3677777777777764


No 53 
>PF03562 MltA:  MltA specific insert domain;  InterPro: IPR005300 This group of proteins includes MltA; a membrane-bound, murein degrading transglycosylase enzyme which plays an important role in the controlled growth of the stress-bearing sacculus of Escherichia coli [, ].; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds; PDB: 2PI8_D 2AE0_X 2PIC_A 2GAE_A 2PJJ_A 3CZB_A 2G6G_A 2PNW_A 2G5D_A.
Probab=30.69  E-value=33  Score=25.10  Aligned_cols=31  Identities=16%  Similarity=0.311  Sum_probs=22.0

Q ss_pred             eEEeEEEEECCCCcEEEEEEEcC-CCCeeecc
Q psy2711          62 NRRGAYSYIDPSGQRRTITYTAG-KNGFQASG   92 (114)
Q Consensus        62 ~v~GsYsy~~pdG~~~~V~Y~AD-~~Gf~~~~   92 (114)
                      .|+||=....|||+.+.|.|-+. ..-|+..|
T Consensus        83 qIQGSGrl~l~DG~~~rvgYAg~NG~pY~sIG  114 (158)
T PF03562_consen   83 QIQGSGRLRLPDGSTVRVGYAGQNGHPYTSIG  114 (158)
T ss_dssp             HHHSEEEEE-TTSSEEEEEEEEE-SS----HH
T ss_pred             eecCcEEEEcCCCCEEEEEEcccCCCccccHH
Confidence            48899999999999999999775 35677665


No 54 
>PF10584 Proteasome_A_N:  Proteasome subunit A N-terminal signature;  InterPro: IPR000426 The proteasome (or macropain) (3.4.25.1 from EC) [, , , , ] is a eukaryotic and archaeal multicatalytic proteinase complex that seems to be involved in an ATP/ubiquitin-dependent nonlysosomal proteolytic pathway. In eukaryotes the proteasome is composed of about 28 distinct subunits which form a highly ordered ring-shaped structure (20S ring) of about 700 kDa. Most proteasome subunits can be classified, on the basis on sequence similarities into two groups, alpha (A) and beta (B). This family contains the alpha subunit sequences which range from 210 to 290 amino acids. These sequences are classified as non-peptidase homologues in MEROPS peptidase family T1 (clan PB(T)). ; GO: 0004175 endopeptidase activity, 0006511 ubiquitin-dependent protein catabolic process, 0019773 proteasome core complex, alpha-subunit complex; PDB: 3H4P_M 1IRU_O 3UN4_U 1FNT_A 3OEV_G 3OEU_U 3SDK_U 3DY3_G 3MG7_G 3L5Q_C ....
Probab=30.68  E-value=1.8  Score=21.97  Aligned_cols=11  Identities=27%  Similarity=0.670  Sum_probs=7.8

Q ss_pred             CCCCcEEEEEE
Q psy2711          71 DPSGQRRTITY   81 (114)
Q Consensus        71 ~pdG~~~~V~Y   81 (114)
                      +|||++..|+|
T Consensus         9 Sp~Grl~QVEY   19 (23)
T PF10584_consen    9 SPDGRLFQVEY   19 (23)
T ss_dssp             BTTSSBHHHHH
T ss_pred             CCCCeEEeeEe
Confidence            58888776665


No 55 
>PRK11528 hypothetical protein; Provisional
Probab=30.27  E-value=40  Score=26.36  Aligned_cols=13  Identities=15%  Similarity=0.319  Sum_probs=8.7

Q ss_pred             CchHHHHHHHHHH
Q psy2711           1 MEKLVFLFAIASL   13 (114)
Q Consensus         1 M~k~v~~~~l~a~   13 (114)
                      |+|.+++++|+++
T Consensus         1 ~~k~llal~l~a~   13 (254)
T PRK11528          1 MRKSLLALTLLAT   13 (254)
T ss_pred             CchHHHHHHHHHH
Confidence            7887777666543


No 56 
>PRK10290 superoxide dismutase; Provisional
Probab=29.94  E-value=1.2e+02  Score=22.43  Aligned_cols=14  Identities=7%  Similarity=0.209  Sum_probs=6.5

Q ss_pred             CchHHHHHHHHHHh
Q psy2711           1 MEKLVFLFAIASLS   14 (114)
Q Consensus         1 M~k~v~~~~l~a~~   14 (114)
                      |.++++++..+.+|
T Consensus         1 ~~~~~~~~~~~~~~   14 (173)
T PRK10290          1 MKRFSLAILALVVC   14 (173)
T ss_pred             CcchHHHHHHHHhh
Confidence            55665444433333


No 57 
>PRK10397 lipoprotein; Provisional
Probab=29.62  E-value=40  Score=24.18  Aligned_cols=14  Identities=36%  Similarity=0.432  Sum_probs=10.0

Q ss_pred             CchHHHHHHHHHHh
Q psy2711           1 MEKLVFLFAIASLS   14 (114)
Q Consensus         1 M~k~v~~~~l~a~~   14 (114)
                      |+|++++.++++.+
T Consensus         1 mKKii~~~a~~~La   14 (137)
T PRK10397          1 MKKLAIAGALMALA   14 (137)
T ss_pred             CchhHHHHHHHHhh
Confidence            88988877765543


No 58 
>PF11106 YjbE:  Exopolysaccharide production protein YjbE
Probab=29.62  E-value=47  Score=21.71  Aligned_cols=8  Identities=25%  Similarity=0.721  Sum_probs=5.7

Q ss_pred             CchHHHHH
Q psy2711           1 MEKLVFLF    8 (114)
Q Consensus         1 M~k~v~~~    8 (114)
                      |||++..+
T Consensus         1 MKK~~~~~    8 (80)
T PF11106_consen    1 MKKIIYGL    8 (80)
T ss_pred             ChhHHHHH
Confidence            88887643


No 59 
>smart00817 Amelin Ameloblastin precursor (Amelin). This family consists of several mammalian Ameloblastin precursor (Amelin) proteins. Matrix proteins of tooth enamel consist mainly of amelogenin but also of non-amelogenin proteins, which, although their volumetric percentage is low, have an important role in enamel mineralisation. One of the non-amelogenin proteins is ameloblastin, also known as amelin and sheathlin. Ameloblastin (AMBN) is one of the enamel sheath proteins which is though to have a role in determining the prismatic structure of growing enamel crystals.
Probab=29.27  E-value=47  Score=27.69  Aligned_cols=16  Identities=25%  Similarity=0.449  Sum_probs=12.3

Q ss_pred             CchHHHHHHHHHHhhc
Q psy2711           1 MEKLVFLFAIASLSVA   16 (114)
Q Consensus         1 M~k~v~~~~l~a~~aa   16 (114)
                      |+.|++++||+.++.|
T Consensus         1 M~~~iL~~cLl~~afA   16 (411)
T smart00817        1 MKDLALVLCLLKTSFA   16 (411)
T ss_pred             CcchhHHHHHHhhhhc
Confidence            7889999998875443


No 60 
>COG2834 LolA Outer membrane lipoprotein-sorting protein [Cell envelope biogenesis, outer membrane]
Probab=29.18  E-value=85  Score=23.30  Aligned_cols=21  Identities=24%  Similarity=0.300  Sum_probs=14.0

Q ss_pred             ECCCCcEEEEEEEcCCCCeee
Q psy2711          70 IDPSGQRRTITYTAGKNGFQA   90 (114)
Q Consensus        70 ~~pdG~~~~V~Y~AD~~Gf~~   90 (114)
                      .+||-...++++..+..+.-+
T Consensus        93 ydp~~~q~~~~~~~~~~~~tp  113 (211)
T COG2834          93 YDPDLEQVTKTWLSEATGNTP  113 (211)
T ss_pred             ECCCCceEEEEecCCCCCCCc
Confidence            467777777777777654444


No 61 
>COG5633 Predicted periplasmic lipoprotein [General function prediction only]
Probab=29.15  E-value=2.1e+02  Score=20.21  Aligned_cols=18  Identities=11%  Similarity=0.172  Sum_probs=12.3

Q ss_pred             CCeEEeEEEEECCCCcEE
Q psy2711          60 DGNRRGAYSYIDPSGQRR   77 (114)
Q Consensus        60 ~g~v~GsYsy~~pdG~~~   77 (114)
                      ...++=.+-|.|.+|-.+
T Consensus        69 pv~v~YrfYWYD~~Gle~   86 (123)
T COG5633          69 PVTVHYRFYWYDAQGLEQ   86 (123)
T ss_pred             ceEEEEEEEEEcCCCcee
Confidence            345667777788888754


No 62 
>PRK13791 lysozyme inhibitor; Provisional
Probab=29.14  E-value=61  Score=22.36  Aligned_cols=8  Identities=13%  Similarity=0.268  Sum_probs=4.1

Q ss_pred             ceeeeEec
Q psy2711          40 QFGSAYTQ   47 (114)
Q Consensus        40 ~y~f~y~~   47 (114)
                      ++.=.|-.
T Consensus        41 ~l~V~y~n   48 (113)
T PRK13791         41 VLEVIYVN   48 (113)
T ss_pred             eEEEEEeC
Confidence            35555554


No 63 
>PF13127 DUF3955:  Protein of unknown function (DUF3955)
Probab=29.07  E-value=33  Score=21.24  Aligned_cols=9  Identities=22%  Similarity=0.479  Sum_probs=4.9

Q ss_pred             CchHHHHHH
Q psy2711           1 MEKLVFLFA    9 (114)
Q Consensus         1 M~k~v~~~~    9 (114)
                      |+|+.+.+.
T Consensus         1 m~~~~l~~~    9 (63)
T PF13127_consen    1 MKKYILSLI    9 (63)
T ss_pred             CcchHHHHH
Confidence            666655444


No 64 
>PHA02097 hypothetical protein
Probab=28.83  E-value=1.1e+02  Score=18.65  Aligned_cols=24  Identities=21%  Similarity=0.200  Sum_probs=18.9

Q ss_pred             EEEECCCCcEEEEEEEcCCCCeee
Q psy2711          67 YSYIDPSGQRRTITYTAGKNGFQA   90 (114)
Q Consensus        67 Ysy~~pdG~~~~V~Y~AD~~Gf~~   90 (114)
                      +.-..|.|.+++|.|+-|..-|..
T Consensus        14 ~amntp~gv~iri~~tf~~~~f~~   37 (59)
T PHA02097         14 SAMNTPGGVIIRIAHTFDVSNFKI   37 (59)
T ss_pred             EEeeCCCcEEEEEEeEEeeccceE
Confidence            456679999999999988666654


No 65 
>PF09244 DUF1964:  Domain of unknown function (DUF1964);  InterPro: IPR015325 This domain is C-terminal to the catalytic sucrose phosphorylase beta/alpha barrel domain. It adopts a beta-sandwich fold, with Greek-key topology and is functionally uncharacterised []. ; PDB: 1R7A_B 2GDU_A 2GDV_A.
Probab=28.20  E-value=69  Score=20.19  Aligned_cols=21  Identities=29%  Similarity=0.471  Sum_probs=13.7

Q ss_pred             eEEEEECCCCcEEEEEEEcCC
Q psy2711          65 GAYSYIDPSGQRRTITYTAGK   85 (114)
Q Consensus        65 GsYsy~~pdG~~~~V~Y~AD~   85 (114)
                      |.|||...++.-++.+|+..+
T Consensus         4 G~FSy~~dgdtSitf~W~g~~   24 (68)
T PF09244_consen    4 GEFSYEADGDTSITFTWTGAT   24 (68)
T ss_dssp             SEEEEEEETTTEEEEEEE-SS
T ss_pred             ceeeEecCCCcEEEEEEeccc
Confidence            667777766677777777653


No 66 
>PF05968 Bacillus_PapR:  Bacillus PapR protein;  InterPro: IPR009239 This family consists of the Bacillus species-specific PapR protein. The papR gene belongs to the PlcR regulon and is located 70 bp downstream from plcR. It encodes a 48-amino-acid peptide. Disruption of the papR gene abolishes expression of the PlcR regulon, resulting in a large decrease in haemolysis and virulence in insect larvae. A processed form of PapR activates the PlcR regulon by allowing PlcR to bind to its DNA target. This activating mechanism is strain specific [].
Probab=28.03  E-value=54  Score=19.35  Aligned_cols=10  Identities=30%  Similarity=0.331  Sum_probs=7.5

Q ss_pred             CchHHHHHHH
Q psy2711           1 MEKLVFLFAI   10 (114)
Q Consensus         1 M~k~v~~~~l   10 (114)
                      |+||++...|
T Consensus         1 mkkll~~sll   10 (48)
T PF05968_consen    1 MKKLLIGSLL   10 (48)
T ss_pred             CchHHHhHHH
Confidence            8888876665


No 67 
>PRK10449 heat-inducible protein; Provisional
Probab=27.90  E-value=46  Score=23.35  Aligned_cols=9  Identities=56%  Similarity=0.671  Sum_probs=6.1

Q ss_pred             CchHHHHHH
Q psy2711           1 MEKLVFLFA    9 (114)
Q Consensus         1 M~k~v~~~~    9 (114)
                      |+|++++++
T Consensus         1 mk~~~~~~~    9 (140)
T PRK10449          1 MKKVVALVA    9 (140)
T ss_pred             ChhHHHHHH
Confidence            888875544


No 68 
>PF10956 DUF2756:  Protein of unknown function (DUF2756);  InterPro: IPR020158 This entry contains proteins with no known function.
Probab=27.80  E-value=37  Score=23.26  Aligned_cols=12  Identities=33%  Similarity=0.587  Sum_probs=8.8

Q ss_pred             CchHHHHHHHHH
Q psy2711           1 MEKLVFLFAIAS   12 (114)
Q Consensus         1 M~k~v~~~~l~a   12 (114)
                      |++++++++|+-
T Consensus         1 MK~ll~laalLP   12 (104)
T PF10956_consen    1 MKRLLILAALLP   12 (104)
T ss_pred             ChHHHHHHHHcc
Confidence            788887777654


No 69 
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of Burkholderia sp. NF100 MhqB and similar proteins. MhqB is a type I extradiol dioxygenase involved in the catabolism of methylhydroquinone, an intermediate in the degradation of fenitrothion. The purified enzyme has shown extradiol ring cleavage activity toward 3-methylcatechol. Fe2+ was suggested as a cofactor, the same as most other enzymes in the family. Burkholderia sp. NF100 MhqB is encoded on the plasmid pNF1. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=27.36  E-value=79  Score=20.07  Aligned_cols=16  Identities=19%  Similarity=0.347  Sum_probs=13.7

Q ss_pred             EEEEECCCCcEEEEEE
Q psy2711          66 AYSYIDPSGQRRTITY   81 (114)
Q Consensus        66 sYsy~~pdG~~~~V~Y   81 (114)
                      ++.+.||||.++++.+
T Consensus        93 ~~~~~DP~Gn~iel~~  108 (112)
T cd08344          93 GVWFRDPDGNLLQVKV  108 (112)
T ss_pred             EEEEECCCCCEEEEec
Confidence            5789999999998874


No 70 
>TIGR03836 termin_org_HMW1 cytadherence high molecular weight protein 1 N-terminal region. This model describes the N-terminal region of the Mycoplasma cytadherence protein HMW1, up to but not including the first EAGR box domain. The apparent orthologs in different Mycoplasma species differ profoundly in archictecture C-terminally to the region described here.
Probab=27.30  E-value=57  Score=21.15  Aligned_cols=20  Identities=25%  Similarity=0.514  Sum_probs=15.3

Q ss_pred             CCCCcEEEEEEEcCCCCeeec
Q psy2711          71 DPSGQRRTITYTAGKNGFQAS   91 (114)
Q Consensus        71 ~pdG~~~~V~Y~AD~~Gf~~~   91 (114)
                      -.||. +.|-|-||.|||-..
T Consensus        29 ~eDg~-ikvAyDaDgNgYYIa   48 (82)
T TIGR03836        29 PEDGS-IKVAYDADGNGYYIA   48 (82)
T ss_pred             CCCCc-EEEEEecCCCEEEEE
Confidence            34665 589999999998764


No 71 
>PRK15184 curli production assembly/transport protein CsgG; Provisional
Probab=26.43  E-value=63  Score=25.85  Aligned_cols=12  Identities=33%  Similarity=0.600  Sum_probs=8.3

Q ss_pred             CchHHHHHHHHH
Q psy2711           1 MEKLVFLFAIAS   12 (114)
Q Consensus         1 M~k~v~~~~l~a   12 (114)
                      |++++++++++.
T Consensus         1 m~~~~~~~~~~~   12 (277)
T PRK15184          1 MQRLFLLVAVML   12 (277)
T ss_pred             CchhHHHHHHHH
Confidence            888777666543


No 72 
>COG3637 Opacity protein and related surface antigens [Cell envelope biogenesis, outer membrane]
Probab=26.14  E-value=49  Score=24.56  Aligned_cols=12  Identities=42%  Similarity=0.484  Sum_probs=7.1

Q ss_pred             CchHHHHHHHHH
Q psy2711           1 MEKLVFLFAIAS   12 (114)
Q Consensus         1 M~k~v~~~~l~a   12 (114)
                      |++++++++|++
T Consensus         1 mk~~l~~a~~~~   12 (199)
T COG3637           1 MKKLLAAAALAA   12 (199)
T ss_pred             ChhHHHHHHHHH
Confidence            677665555544


No 73 
>PF09242 FCSD-flav_bind:  Flavocytochrome c sulphide dehydrogenase, flavin-binding;  InterPro: IPR015323 This entry represents the flavin-binding domain of flavocytochrome c sulphide dehydrogenase (FCSD), enzymes found in sulphur-oxidising bacteria such as the purple phototrophic bacteria Chromatium vinosum [, ]. These enzymes are complexes of flavoprotein and a dihaem cytochrome that carry out hydrogen sulphide-dependent cytochrome C reduction. The dihaem cytochrome folds into two domains, each of which resembles mitochondrial cytochrome c, with the two haem groups bound to the interior of the subunit. The flavoprotein subunit has a glutathione reductase-like fold consisting of a beta(3,4)-alpha(3) core, and an alpha+beta sandwich. The active site of the flavoprotein subunit contains a catalytically important disulphide bridge located above the pyrimidine portion of the flavin ring []. Electrons are transferred from the flavin to one of the haem groups in the cytochrome. This entry represents a flavoprotein domain required for binding to flavin, and subsequent electron transfer. ; PDB: 1FCD_A.
Probab=26.07  E-value=1e+02  Score=19.25  Aligned_cols=27  Identities=15%  Similarity=0.207  Sum_probs=19.3

Q ss_pred             eEEEEECCC-CcEEEEEEEcCCCCeeec
Q psy2711          65 GAYSYIDPS-GQRRTITYTAGKNGFQAS   91 (114)
Q Consensus        65 GsYsy~~pd-G~~~~V~Y~AD~~Gf~~~   91 (114)
                      =.||+++|| |-.+.-.|.-++.++...
T Consensus         9 tCYSlv~p~~aIsVa~vy~~~~~~i~~v   36 (71)
T PF09242_consen    9 TCYSLVAPDYAISVAGVYRYDDGKIVEV   36 (71)
T ss_dssp             EEEEEEETTEEEEEEEEEEE-TTTEEE-
T ss_pred             eEEEEeCCCceEEEEEEEEECCCeEEEe
Confidence            368899888 777777888887776544


No 74 
>PRK11627 hypothetical protein; Provisional
Probab=25.92  E-value=54  Score=24.57  Aligned_cols=8  Identities=25%  Similarity=0.426  Sum_probs=5.2

Q ss_pred             EEeEEEEE
Q psy2711          63 RRGAYSYI   70 (114)
Q Consensus        63 v~GsYsy~   70 (114)
                      .+|.++|.
T Consensus       115 ~~g~~~~~  122 (192)
T PRK11627        115 SEGNVRYN  122 (192)
T ss_pred             ccceeeec
Confidence            35777665


No 75 
>KOG4737|consensus
Probab=25.59  E-value=27  Score=28.22  Aligned_cols=17  Identities=24%  Similarity=0.358  Sum_probs=13.8

Q ss_pred             CchHHHHHHHHHHhhcc
Q psy2711           1 MEKLVFLFAIASLSVAQ   17 (114)
Q Consensus         1 M~k~v~~~~l~a~~aa~   17 (114)
                      |+.|+++.+|+|+|++.
T Consensus         1 m~vfvl~salvAa~~as   17 (326)
T KOG4737|consen    1 MKVFVLVSALVAACAAS   17 (326)
T ss_pred             CeEEeeHHHHHHHHhcc
Confidence            77788888899888764


No 76 
>PRK12698 flgH flagellar basal body L-ring protein; Reviewed
Probab=25.45  E-value=54  Score=25.19  Aligned_cols=9  Identities=22%  Similarity=0.467  Sum_probs=4.8

Q ss_pred             CchHHHHHH
Q psy2711           1 MEKLVFLFA    9 (114)
Q Consensus         1 M~k~v~~~~    9 (114)
                      |||.+++++
T Consensus         1 ~~~~~~~~~    9 (224)
T PRK12698          1 MARYILLAL    9 (224)
T ss_pred             ChhHHHHHH
Confidence            666555444


No 77 
>PRK06724 hypothetical protein; Provisional
Probab=25.41  E-value=96  Score=20.93  Aligned_cols=21  Identities=33%  Similarity=0.722  Sum_probs=15.7

Q ss_pred             EeEEE--EECCCCcEEEEEEEcC
Q psy2711          64 RGAYS--YIDPSGQRRTITYTAG   84 (114)
Q Consensus        64 ~GsYs--y~~pdG~~~~V~Y~AD   84 (114)
                      .|.|+  +.||||..+++.|.++
T Consensus       103 ~g~~~~~f~DPdG~~iEl~~~~~  125 (128)
T PRK06724        103 EGYYTIDFYDPNGFIIEVAYTPN  125 (128)
T ss_pred             CCEEEEEEECCCCCEEEEEeCCC
Confidence            34443  7799999999988754


No 78 
>PF08194 DIM:  DIM protein;  InterPro: IPR013172 Drosophila immune-induced molecules (DIMs) are short proteins induced during the immune response of Drosophila []. This entry includes DIMs 1 to 4 and DIM23.
Probab=25.18  E-value=79  Score=17.66  Aligned_cols=6  Identities=33%  Similarity=0.429  Sum_probs=3.1

Q ss_pred             CchHHH
Q psy2711           1 MEKLVF    6 (114)
Q Consensus         1 M~k~v~    6 (114)
                      |+.|.+
T Consensus         1 Mk~l~~    6 (36)
T PF08194_consen    1 MKCLSL    6 (36)
T ss_pred             CceeHH
Confidence            555544


No 79 
>PRK15346 outer membrane secretin SsaC; Provisional
Probab=25.03  E-value=48  Score=28.11  Aligned_cols=12  Identities=33%  Similarity=0.462  Sum_probs=7.4

Q ss_pred             CchHHHHHHHHH
Q psy2711           1 MEKLVFLFAIAS   12 (114)
Q Consensus         1 M~k~v~~~~l~a   12 (114)
                      |||++++.+|+.
T Consensus         1 ~~~~~~~~~~~~   12 (499)
T PRK15346          1 MKKLLILIFLFL   12 (499)
T ss_pred             CchhHHHHHHHH
Confidence            888766554433


No 80 
>PF05593 RHS_repeat:  RHS Repeat;  InterPro: IPR006530 These sequences contain two tandem copies of a 21-residue extracellular repeat that is found in Gram-negative, Gram-positive, and animal proteins. The repeat is named for a YD dipeptide, the most strongly conserved motif of the repeat. These repeats appear in general to be involved in binding carbohydrate; the chicken teneurin-1 YD-repeat region has been shown to bind heparin [, , ].
Probab=24.88  E-value=1.2e+02  Score=16.22  Aligned_cols=8  Identities=38%  Similarity=0.829  Sum_probs=3.7

Q ss_pred             ECCCCcEE
Q psy2711          70 IDPSGQRR   77 (114)
Q Consensus        70 ~~pdG~~~   77 (114)
                      ++|+|...
T Consensus        11 ~d~~G~~~   18 (38)
T PF05593_consen   11 TDPDGRTT   18 (38)
T ss_pred             EcCCCCEE
Confidence            34555544


No 81 
>cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp. JF8 and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, a key step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). BphC belongs to the type I extradiol dioxygenase family, which requires a metal ion in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of BphCs. This subfamily of BphC is represented by the enzyme purified from the thermophilic biphenyl and naphthalene degrader, Bacillus sp. JF8. The members in this family of BphC enzymes may use either Mn(II) or Fe(II) as cofactors. The enzyme purified from Bacillus sp. JF8 is Mn(II)-dependent, however, the enzyme from Rhodococcus jostii RHAI has Fe(II) bound to it. BphC_JF8 is thermostable and its optimum activity is at 85 degrees C
Probab=24.85  E-value=1e+02  Score=19.73  Aligned_cols=17  Identities=24%  Similarity=0.614  Sum_probs=14.1

Q ss_pred             EEEEECCCCcEEEEEEE
Q psy2711          66 AYSYIDPSGQRRTITYT   82 (114)
Q Consensus        66 sYsy~~pdG~~~~V~Y~   82 (114)
                      ++.+.||||...++.|-
T Consensus       102 ~~~~~DPdG~~iEl~~~  118 (121)
T cd09013         102 AYRFRSPDGHPMELYWE  118 (121)
T ss_pred             eEEEECCCCCEEEEEEe
Confidence            57799999999888763


No 82 
>PF15339 Afaf:  Acrosome formation-associated factor
Probab=24.66  E-value=43  Score=25.27  Aligned_cols=15  Identities=13%  Similarity=0.262  Sum_probs=9.3

Q ss_pred             chHHHHHHHHHHhhc
Q psy2711           2 EKLVFLFAIASLSVA   16 (114)
Q Consensus         2 ~k~v~~~~l~a~~aa   16 (114)
                      |.|+|++.|+++|.|
T Consensus       139 mTl~lfv~Ll~~c~a  153 (200)
T PF15339_consen  139 MTLFLFVILLAFCSA  153 (200)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            455666667776654


No 83 
>PRK10959 outer membrane protein W; Provisional
Probab=24.39  E-value=60  Score=23.99  Aligned_cols=10  Identities=30%  Similarity=0.245  Sum_probs=5.6

Q ss_pred             CchHHHHHHH
Q psy2711           1 MEKLVFLFAI   10 (114)
Q Consensus         1 M~k~v~~~~l   10 (114)
                      |+|+++++++
T Consensus         1 Mk~~~~~~~~   10 (212)
T PRK10959          1 MKKLTVAALA   10 (212)
T ss_pred             CchHHHHHHH
Confidence            7777544333


No 84 
>PF10972 DUF2803:  Protein of unknown function (DUF2803);  InterPro: IPR021241  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=24.38  E-value=99  Score=23.24  Aligned_cols=15  Identities=20%  Similarity=0.370  Sum_probs=10.4

Q ss_pred             CchHHHHHHHHHHhh
Q psy2711           1 MEKLVFLFAIASLSV   15 (114)
Q Consensus         1 M~k~v~~~~l~a~~a   15 (114)
                      |++++++++|+.++.
T Consensus         1 ~~~ll~lll~~~s~~   15 (213)
T PF10972_consen    1 MKALLLLLLLLVSPT   15 (213)
T ss_pred             CHHHHHHHHHHhChh
Confidence            888887777665443


No 85 
>COG4764 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.63  E-value=70  Score=23.97  Aligned_cols=17  Identities=24%  Similarity=0.341  Sum_probs=9.7

Q ss_pred             CchHHHHHHHHH--Hhhcc
Q psy2711           1 MEKLVFLFAIAS--LSVAQ   17 (114)
Q Consensus         1 M~k~v~~~~l~a--~~aa~   17 (114)
                      ||.++++++||+  .|+..
T Consensus         5 ~~r~~~~v~lL~LagCaTa   23 (197)
T COG4764           5 MMRLVFAVVLLALAGCATA   23 (197)
T ss_pred             hHHHHHHHHHHHHhhcccC
Confidence            677766666554  45433


No 86 
>PF04379 DUF525:  Protein of unknown function (DUF525);  InterPro: IPR007474 This domain is found in the bacterial protein ApaG and at the C termini of some F-box proteins (IPR001810 from INTERPRO). F-box proteins contain a carboxy-terminal domain that interacts with protein substrates []. The ApaG domain is ~125 amino acids in length, and is named after the bacterial ApaG protein, of which it forms the core. The Salmonella typhimurium ApaG domain protein, CorD, is involved in Co(2+) resistance and Mg(2+) efflux. Tertiary structures from different ApaG proteins show a fold of several beta-sheets. The ApaG domain may be involved in protein-protein interactions which could be implicated in substrate-specificity [, , ].; PDB: 2F1E_A 1XVS_A 1TZA_A 1XQ4_D.
Probab=23.49  E-value=1.2e+02  Score=19.93  Aligned_cols=14  Identities=29%  Similarity=0.745  Sum_probs=9.5

Q ss_pred             CCeEEeEEEEECCC
Q psy2711          60 DGNRRGAYSYIDPS   73 (114)
Q Consensus        60 ~g~v~GsYsy~~pd   73 (114)
                      .|.++|+|.+++.|
T Consensus        77 ~G~M~G~y~~~~~~   90 (90)
T PF04379_consen   77 SGSMEGSYTMVDED   90 (90)
T ss_dssp             EEEEEEEEEEEET-
T ss_pred             CEEEEEEEEEEECc
Confidence            46778888877655


No 87 
>PRK13682 hypothetical protein; Provisional
Probab=23.26  E-value=71  Score=19.20  Aligned_cols=13  Identities=31%  Similarity=0.542  Sum_probs=9.0

Q ss_pred             CchHHHHHHHHHH
Q psy2711           1 MEKLVFLFAIASL   13 (114)
Q Consensus         1 M~k~v~~~~l~a~   13 (114)
                      |+++.+++.+++.
T Consensus         1 Ml~waliFliiA~   13 (51)
T PRK13682          1 MLKWAIIFLVIAL   13 (51)
T ss_pred             ChhHHHHHHHHHH
Confidence            7788777776553


No 88 
>PF03032 Brevenin:  Brevenin/esculentin/gaegurin/rugosin family;  InterPro: IPR004275 In addition to the highly specific cell-mediated immune system, vertebrates possess an efficient host-defence mechanism against invading microorganisms which involves the synthesis of highly potent antimicrobial peptides with a large spectrum of activity. This entry represents a number of these defence peptides secreted from the skin of amphibians, including the opiate-like dermorphins and deltorphins, and the antimicrobial dermoseptins and temporins.; GO: 0006952 defense response, 0042742 defense response to bacterium, 0005576 extracellular region
Probab=23.01  E-value=66  Score=18.79  Aligned_cols=15  Identities=13%  Similarity=0.195  Sum_probs=8.7

Q ss_pred             CchHHHHHHHHHHhh
Q psy2711           1 MEKLVFLFAIASLSV   15 (114)
Q Consensus         1 M~k~v~~~~l~a~~a   15 (114)
                      |+|-++++.++..++
T Consensus         3 lKKsllLlfflG~IS   17 (46)
T PF03032_consen    3 LKKSLLLLFFLGTIS   17 (46)
T ss_pred             chHHHHHHHHHHHcc
Confidence            677666666554443


No 89 
>PF15016 DUF4520:  Domain of unknown function (DUF4520)
Probab=22.83  E-value=2.3e+02  Score=18.57  Aligned_cols=51  Identities=22%  Similarity=0.279  Sum_probs=33.5

Q ss_pred             eeeeeeeccCCCCceeeeEecCCCcEEEEeec----------CCCeEEeEEEEECCCCcEEEEE
Q psy2711          27 AILSEKRYLSNNGQFGSAYTQEDGVQFTEESD----------QDGNRRGAYSYIDPSGQRRTIT   80 (114)
Q Consensus        27 ~i~~~~~~~~~~g~y~f~y~~~dg~~~~E~g~----------~~g~v~GsYsy~~pdG~~~~V~   80 (114)
                      +++-++...++.|+|.   .-+||..+----|          ..-...|....+.|||+...|.
T Consensus         4 ~vv~~e~~i~~~GrF~---AysDgrVr~~F~Drt~L~l~~~~~~~~~~~~c~l~~pDG~~~~i~   64 (85)
T PF15016_consen    4 PVVLEESSIPGVGRFT---AYSDGRVRVHFDDRTILTLIWNFSSREELGWCKLTFPDGQQVLIQ   64 (85)
T ss_pred             ceeEEEEecCCceEEE---EEcCCeEEEEEcCCCEEEEEeCCCCcccCCEEEEEccCCCEEEEE
Confidence            3445566678888884   3356665443222          1223679999999999998886


No 90 
>PF06788 UPF0257:  Uncharacterised protein family (UPF0257);  InterPro: IPR010646 This is a group of proteins of unknown function.; GO: 0005886 plasma membrane
Probab=22.81  E-value=2.1e+02  Score=22.32  Aligned_cols=28  Identities=21%  Similarity=0.175  Sum_probs=19.1

Q ss_pred             eEEeEEEEECCCCcEEEEEEEcCCCCeee
Q psy2711          62 NRRGAYSYIDPSGQRRTITYTAGKNGFQA   90 (114)
Q Consensus        62 ~v~GsYsy~~pdG~~~~V~Y~AD~~Gf~~   90 (114)
                      .++.+|+|-+ +|.+...++.++++=+..
T Consensus       140 e~~~~Y~Yd~-~g~pl~~t~~~~~k~~~v  167 (236)
T PF06788_consen  140 ETKVTYRYDD-EGFPLGKTTYYDKKVLSV  167 (236)
T ss_pred             CcceEEEECC-CCCccceEEecCCceEEE
Confidence            3556788877 787777777777654543


No 91 
>PF05899 Cupin_3:  Protein of unknown function (DUF861);  InterPro: IPR008579 The function of the proteins in this entry are unknown. They contain the conserved barrel domain of the 'cupin' superfamily and members are specific to plants and bacteria.; PDB: 1RC6_A 3MYX_A 1O5U_A 2K9Z_A 1LKN_A 3ES4_A 1SFN_B 3BCW_A.
Probab=22.72  E-value=1.3e+02  Score=18.48  Aligned_cols=24  Identities=25%  Similarity=0.425  Sum_probs=19.1

Q ss_pred             CeEEeEEEEECCCCcEEEEEEEcCCC
Q psy2711          61 GNRRGAYSYIDPSGQRRTITYTAGKN   86 (114)
Q Consensus        61 g~v~GsYsy~~pdG~~~~V~Y~AD~~   86 (114)
                      -++.|+-..++.||..  +++.|++-
T Consensus        30 ~vleG~v~it~~~G~~--~~~~aGD~   53 (74)
T PF05899_consen   30 YVLEGEVTITDEDGET--VTFKAGDA   53 (74)
T ss_dssp             EEEEEEEEEEETTTEE--EEEETTEE
T ss_pred             EEEEeEEEEEECCCCE--EEEcCCcE
Confidence            3688999999999996  66677653


No 92 
>PF11355 DUF3157:  Protein of unknown function (DUF3157);  InterPro: IPR021501  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=22.61  E-value=1e+02  Score=23.46  Aligned_cols=8  Identities=25%  Similarity=0.393  Sum_probs=6.4

Q ss_pred             ceeeeEec
Q psy2711          40 QFGSAYTQ   47 (114)
Q Consensus        40 ~y~f~y~~   47 (114)
                      .|.|.|-.
T Consensus        37 DFTWeYv~   44 (199)
T PF11355_consen   37 DFTWEYVI   44 (199)
T ss_pred             CceEEEEe
Confidence            59999965


No 93 
>PF09919 DUF2149:  Uncharacterized conserved protein (DUF2149);  InterPro: IPR018676  This family of conserved hypothetical proteins has no known function. 
Probab=22.39  E-value=2.4e+02  Score=18.63  Aligned_cols=19  Identities=26%  Similarity=0.436  Sum_probs=11.3

Q ss_pred             CCeEEeEEEEECCCCcEEEE
Q psy2711          60 DGNRRGAYSYIDPSGQRRTI   79 (114)
Q Consensus        60 ~g~v~GsYsy~~pdG~~~~V   79 (114)
                      .|.-.|. -|..+||+.+-|
T Consensus        72 ~G~~~G~-aYrl~~Gk~I~V   90 (92)
T PF09919_consen   72 SGERLGT-AYRLKDGKLIYV   90 (92)
T ss_pred             CCeECeE-EEEcCCceEEEe
Confidence            3444454 234888988755


No 94 
>cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases. This subfamily contains the N-terminal, non-catalytic, domain of HPCD. HPCD catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate. The aromatic ring of 4-hydroxyphenylacetate is opened by this dioxygenase to yield the 3,4-diol product, 2-hydroxy-5-carboxymethylmuconate semialdehyde. HPCD is a homotetramer and each monomer contains two structurally homologous barrel-shaped domains at the N- and C-terminus. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism. Most extradiol dioxygenases contain Fe(II) in their active site, but HPCD can be activated by either Mn(II) or Fe(II). These enzymes belong to the type I class II family of extradiol dioxygenases. The class III 3,4-dihydroxyphenylacetate 2,3-dioxygenases belong to a differ
Probab=22.29  E-value=1.3e+02  Score=19.13  Aligned_cols=16  Identities=25%  Similarity=0.129  Sum_probs=12.9

Q ss_pred             EEEEECCCCcEEEEEE
Q psy2711          66 AYSYIDPSGQRRTITY   81 (114)
Q Consensus        66 sYsy~~pdG~~~~V~Y   81 (114)
                      +..+.||||..+++.+
T Consensus       102 ~~~~~DPdG~~ve~~~  117 (121)
T cd07266         102 ALRVEDPLGFPIEFYA  117 (121)
T ss_pred             EEEEECCCCCEEEEEe
Confidence            5678899999888765


No 95 
>TIGR00547 lolA periplasmic chaperone LolA. This protein, LolA, is known so far only in the gamma and beta subdivisions of the Proteobacteria. The E. coli major outer lipoprotein (Lpp) of E. coli is released from the inner membrane as a complex with this chaperone in an energy-requiring process, and is then delivered to LolB for insertion into the outer membrane. LolA is involved in the delivery of lipoproteins generally, rather than just Lpp, and is an essential protein in E. coli, unlike Lpp itself.
Probab=22.13  E-value=68  Score=23.99  Aligned_cols=12  Identities=33%  Similarity=0.343  Sum_probs=7.9

Q ss_pred             CchHHHHHHHHH
Q psy2711           1 MEKLVFLFAIAS   12 (114)
Q Consensus         1 M~k~v~~~~l~a   12 (114)
                      |+|+++++||++
T Consensus         1 mkk~~~~~~l~~   12 (204)
T TIGR00547         1 MKKIAIKCAALS   12 (204)
T ss_pred             CchHHHHHHHHH
Confidence            788777655543


No 96 
>TIGR00616 rect recombinase, phage RecT family. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). RecT and homologs are found in prophage regions of bacterial genomes. RecT works with a partner protein, RecE.
Probab=22.09  E-value=1.2e+02  Score=23.64  Aligned_cols=44  Identities=14%  Similarity=0.164  Sum_probs=25.6

Q ss_pred             ceeeeEecCCCcEEEEeecCCCeEEeEEEEE-CCCCcEEEEEEEcC
Q psy2711          40 QFGSAYTQEDGVQFTEESDQDGNRRGAYSYI-DPSGQRRTITYTAG   84 (114)
Q Consensus        40 ~y~f~y~~~dg~~~~E~g~~~g~v~GsYsy~-~pdG~~~~V~Y~AD   84 (114)
                      .|+|++..+....+.+ ....|.+.|.|.+. ..||....+-.+.+
T Consensus       145 ~f~~~~g~~~~~~h~p-~~~~g~iiG~YA~~~l~dG~~~~~~Mt~e  189 (241)
T TIGR00616       145 LFKWEPGLDEKLIHRP-GRESDAPVGYYAVAELKDGGRKFVVMTKA  189 (241)
T ss_pred             eEEeccCCCCccccCC-CCCCCCEEEEEEEEEEcCCCEEEEEeeHH
Confidence            4555554433333222 23446789999954 58888766655544


No 97 
>cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive. This subfamily family contains FosA, a fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-N-acetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. FosA, catalyzes the addition of glutathione to the antibiotic fosfomycin, (1R,2S)-epoxypropylphosphonic acid, making it inactive. FosA is a Mn(II) dependent enzyme. It is evolutionarily related to glyoxalase I and type I extradiol dioxygenases.
Probab=22.07  E-value=1.1e+02  Score=19.60  Aligned_cols=18  Identities=17%  Similarity=0.641  Sum_probs=14.4

Q ss_pred             EEEEECCCCcEEEEEEEc
Q psy2711          66 AYSYIDPSGQRRTITYTA   83 (114)
Q Consensus        66 sYsy~~pdG~~~~V~Y~A   83 (114)
                      +..+.||||..+++.+.+
T Consensus        94 ~~~f~DPdG~~ie~~~~~  111 (121)
T cd07244          94 SFYFLDPDGHKLELHVGS  111 (121)
T ss_pred             EEEEECCCCCEEEEEeCC
Confidence            567899999999888654


No 98 
>PF05643 DUF799:  Putative bacterial lipoprotein (DUF799);  InterPro: IPR008517 This family consists of several bacterial proteins of unknown function. Some of the family members are described as putative lipoproteins.
Probab=21.87  E-value=65  Score=24.82  Aligned_cols=9  Identities=44%  Similarity=0.659  Sum_probs=7.0

Q ss_pred             CchHHHHHH
Q psy2711           1 MEKLVFLFA    9 (114)
Q Consensus         1 M~k~v~~~~    9 (114)
                      |+|++++++
T Consensus         1 mk~l~~~l~    9 (215)
T PF05643_consen    1 MKKLILGLA    9 (215)
T ss_pred             ChhHHHHHH
Confidence            888887665


No 99 
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=21.63  E-value=1.3e+02  Score=18.98  Aligned_cols=15  Identities=27%  Similarity=0.401  Sum_probs=11.6

Q ss_pred             EEEECCCCcEEEEEE
Q psy2711          67 YSYIDPSGQRRTITY   81 (114)
Q Consensus        67 Ysy~~pdG~~~~V~Y   81 (114)
                      ..+.||||..++++.
T Consensus       110 ~~~~DPdG~~iE~~~  124 (125)
T cd08357         110 FFLKDPSGNALEFKA  124 (125)
T ss_pred             EEEECCCCCEEEEee
Confidence            568899998887763


No 100
>PHA02978 hypothetical protein; Provisional
Probab=21.56  E-value=86  Score=21.97  Aligned_cols=19  Identities=26%  Similarity=0.408  Sum_probs=14.4

Q ss_pred             eEEeEEEEECCCCcEEEEE
Q psy2711          62 NRRGAYSYIDPSGQRRTIT   80 (114)
Q Consensus        62 ~v~GsYsy~~pdG~~~~V~   80 (114)
                      ...=.+||.+|||-.+.|+
T Consensus        72 ~iiiy~sy~~~~gisiqvs   90 (135)
T PHA02978         72 EIIIYFSYADPDGISIQVS   90 (135)
T ss_pred             EEEEEEEecCCCceEEEEe
Confidence            3445667899999988875


No 101
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II).  The protein superfamily contains members with or without domain swapping.
Probab=20.73  E-value=1.4e+02  Score=19.14  Aligned_cols=15  Identities=20%  Similarity=0.388  Sum_probs=12.2

Q ss_pred             EEEECCCCcEEEEEE
Q psy2711          67 YSYIDPSGQRRTITY   81 (114)
Q Consensus        67 Ysy~~pdG~~~~V~Y   81 (114)
                      ..+.||||...++.|
T Consensus       109 ~~~~DPdG~~ie~~~  123 (124)
T cd09012         109 RSFADLDGHLWEVLW  123 (124)
T ss_pred             EEEECCCCCEEEEEE
Confidence            348999999988876


No 102
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC). This subfamily contains the N-terminal, non-catalytic, domain of PpCmtC. 2,3-dihydroxy-p-cumate-3,4-dioxygenase (CmtC of Pseudomonas putida F1) is a dioxygenase involved in the eight-step catabolism pathway of p-cymene. CmtC acts upon the reaction intermediate 2,3-dihydroxy-p-cumate, yielding 2-hydroxy-3-carboxy-6-oxo-7-methylocta-2,4-dienoate. The CmtC belongs to the type I family of extradiol dioxygenases. Fe2+ was suggested as a cofactor, same as other enzymes in the family. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=20.60  E-value=1.5e+02  Score=19.24  Aligned_cols=16  Identities=25%  Similarity=0.495  Sum_probs=13.1

Q ss_pred             EEEECCCCcEEEEEEE
Q psy2711          67 YSYIDPSGQRRTITYT   82 (114)
Q Consensus        67 Ysy~~pdG~~~~V~Y~   82 (114)
                      ..+.||||..+++.+.
T Consensus       104 ~~f~DPdG~~iE~~~~  119 (124)
T cd08361         104 IAFRDPSGNSIELVVR  119 (124)
T ss_pred             EEEECcCCCEEEEEEe
Confidence            3689999999988754


No 103
>PF12771 SusD-like_2:  Starch-binding associating with outer membrane; PDB: 3EJN_A 3FDH_A 3MX3_A.
Probab=20.57  E-value=33  Score=28.71  Aligned_cols=10  Identities=20%  Similarity=0.733  Sum_probs=0.0

Q ss_pred             CchHHHHHHH
Q psy2711           1 MEKLVFLFAI   10 (114)
Q Consensus         1 M~k~v~~~~l   10 (114)
                      |||.|++++|
T Consensus         1 MKK~Il~i~l   10 (488)
T PF12771_consen    1 MKKIILIILL   10 (488)
T ss_dssp             ----------
T ss_pred             CcHHHHHHHH
Confidence            8898776554


No 104
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=20.52  E-value=1.1e+02  Score=19.20  Aligned_cols=11  Identities=45%  Similarity=0.851  Sum_probs=8.8

Q ss_pred             EECCCCcEEEE
Q psy2711          69 YIDPSGQRRTI   79 (114)
Q Consensus        69 y~~pdG~~~~V   79 (114)
                      +.||||..+++
T Consensus       114 ~~DPdG~~iE~  124 (125)
T cd07241         114 ILDPEGNRIEI  124 (125)
T ss_pred             EECCCCCEEEe
Confidence            78888887765


No 105
>PF12445 FliC:  Flagellin protein 
Probab=20.51  E-value=1.1e+02  Score=21.66  Aligned_cols=24  Identities=38%  Similarity=0.462  Sum_probs=18.0

Q ss_pred             EEEEECCCCcE-----EEEEEEcCCCCee
Q psy2711          66 AYSYIDPSGQR-----RTITYTAGKNGFQ   89 (114)
Q Consensus        66 sYsy~~pdG~~-----~~V~Y~AD~~Gf~   89 (114)
                      .=.|+|.||.+     ++++|..+++|=.
T Consensus        78 ~~~Yvd~dG~lTt~~~~tt~Y~~~~dGsV  106 (128)
T PF12445_consen   78 ADVYVDDDGALTTTNTYTTTYFVQKDGSV  106 (128)
T ss_pred             cceEEcCCCcEEecCcceEEEEEcCCCCE
Confidence            56788899865     4588998888743


Done!