BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy2712
         (602 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3I99|A Chain A, The Crystal Structure Of The
           Udp-N-Acetylenolpyruvoylglucosamine Reductase From The
           Vibrio Cholerae O1 Biovar Tor
          Length = 357

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 3/44 (6%)

Query: 284 EGMKMMARWLL---GLKAHKESAQKTFRMLNAVIVNKGDLLQSD 324
           +G+K+ A WL+   GLK H+    K       VIVN GD    D
Sbjct: 271 QGVKVAAGWLIDQAGLKGHQIGGAKVHPKQALVIVNTGDASAQD 314


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.134    0.384 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 18,010,908
Number of Sequences: 62578
Number of extensions: 774739
Number of successful extensions: 1899
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1894
Number of HSP's gapped (non-prelim): 14
length of query: 602
length of database: 14,973,337
effective HSP length: 104
effective length of query: 498
effective length of database: 8,465,225
effective search space: 4215682050
effective search space used: 4215682050
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)