Diaphorina citri psyllid: psy2731

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------
DFEPWLKKYLAEFALQSIDTDNFKAHLTSHFAHKPEINQIEWDLWLNTTGMPPHIPKYSFYQPIKVPSYLVAIVVGNLASYKISERCSVWSEPELVKEAADEFNETEKFLSTAEEICGTYVWGVYDLVMLPPSFPFGGMENPYDTSLQDVCNDLANRWISWNHTKSPPFSKQDLAAFTPGQKIEFLAKSSSYILAGDGSLAAVVAHEISHSWTGNLVTNRNFEHFWLNEGFTMFVERKITGRLRGEAERHFDALSGLKDLKQAAGDGSLAAVVAHEISHSWTGNLVTNRNFEHFWLNEGFTMFVERKITGRLRGEAERHFDALSGLKDLKQAVSSTGPLWDSKRNALDFQKGRHYQCKIERLKCGSAILFIYGYDTSLQDVCNDLANRWISWNHTKETPFSKQDLAAFTPGQKIEFLAILLDKEMYDLPKVKSLQDVYRFNGVRNCEIRFRWLKLCLKARWKEQVPHVIDMVTSQGRMKYVRPLYRELYAWEDTRQTAIDTFKQHRKQMMYVTAYTLAKDLKLGDLDSAEKKAESKG
cccccHHHHHHcccccccccccccEEEEEEEECcccccEEEcccccccccccccccEEEEEcccccccEEEEEEEEEccEEcccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccccccccHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccHHHHHHccc
DFEPWLKKYLAEFALQSIDTDNFKAHLTSHFAHKPEINQIEWDLWLNTTGM*PHIPKYSFYQPIKVPSYLVAIVVGNLASYKISERCSVWSEPELVKEAADEFNETEKFLSTAEEICGTYVWGVYDLVMLPPSFPFGGMENPYDTSLQDVCNDLANRWISWNHTKSPPFSKQDLAAFTPGQKIEFLAKSSSYILAGDGSLAAVVAHEISHSWTGNLVTNRNFEHFWLNEGFTMFVERKITGRLRGEAERHFDALSGLKDLKQAAGDGSLAAVVAHEISHSWTGNLVTNRNFEHFWLNEGFTMFVERKITGRLRGEAERHFDALSGLKDLKQAVSSTGPLWDSKRNALDFQKGRHYQCKIERLKCGSAILFIYGYDTSLQDVCNDLANRWISWNHTKETPFSKQDLAAFTPGQKIEFLAILLDKEMYDLPKVKSLQDVYRFNGVRNCEIRFRWLKLCLKARWKEQVPHVIDMVTSQGRMKYVRPLYRELYAWEDTRQTAIDTFKQHRKQMMYVTAYTLAKDLKL**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DFEPWLKKYLAEFALQSIDTDNFKAHLTSHFAHKPEINQIEWDLWLNTTGMPPHIPKYSFYQPIKVPSYLVAIVVGNLASYKISERCSVWSEPELVKEAADEFNETEKFLSTAEEICGTYVWGVYDLVMLPPSFPFGGMENPYDTSLQDVCNDLANRWISWNHTKSPPFSKQDLAAFTPGQKIEFLAKSSSYILAGDGSLAAVVAHEISHSWTGNLVTNRNFEHFWLNEGFTMFVERKITGRLRGEAERHFDALSGLKDLKQAAGDGSLAAVVAHEISHSWTGNLVTNRNFEHFWLNEGFTMFVERKITGRLRGEAERHFDALSGLKDLKQAVSSTGPLWDSKRNALDFQKGRHYQCKIERLKCGSAILFIYGYDTSLQDVCNDLANRWISWNHTKETPFSKQDLAAFTPGQKIEFLAILLDKEMYDLPKVKSLQDVYRFNGVRNCEIRFRWLKLCLKARWKEQVPHVIDMVTSQGRMKYVRPLYRELYAWEDTRQTAIDTFKQHRKQMMYVTAYTLAKDLKLGDLDSAEKKAESKG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Leukotriene A-4 hydrolase Epoxide hydrolase that catalyzes the final step in the biosynthesis of the proinflammatory mediator leukotriene B4. Has also aminopeptidase activity.confidentP24527
Leukotriene A-4 hydrolase homolog Aminopeptidase that preferentially cleaves tripeptides. Also has low epoxide hydrolase activity (in vitro). Can hydrolyze an epoxide moiety of LTA(4) to form LTB(4) (in vitro).confidentO94544
Leukotriene A-4 hydrolase homolog Aminopeptidase that preferentially cleaves tripeptides. Also has low epoxide hydrolase activity (in vitro). Can hydrolyze an epoxide moiety of LTA(4) to form LTB(4) (in vitro).confidentQ75B10

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XQ0, chain A
Confidence level:very confident
Coverage over the Query: 6-146,177-179,192-523
View the alignment between query and template
View the model in PyMOL
Template: 3SE6, chain A
Confidence level:very confident
Coverage over the Query: 6-166,179,194-375
View the alignment between query and template
View the model in PyMOL
Template: 1GW6, chain A
Confidence level:confident
Coverage over the Query: 58-151,174-180,193-523
View the alignment between query and template
View the model in PyMOL
Template: 3B7S, chain A
Confidence level:probable
Coverage over the Query: 58-142,173-179,192-263
View the alignment between query and template
View the model in PyMOL