Query         psy2757
Match_columns 61
No_of_seqs    30 out of 32
Neff          2.4 
Searched_HMMs 46136
Date          Sat Aug 17 00:25:14 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2757.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2757hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2181|consensus               99.9 2.6E-27 5.7E-32  181.9   3.4   55    2-56     38-96  (415)
  2 PF01803 LIM_bind:  LIM-domain   98.3 1.9E-07 4.2E-12   64.2   1.4   42   16-57      2-48  (240)
  3 PF02755 RPEL:  RPEL repeat;  I  38.9      18  0.0004   18.5   1.0   10   21-30      3-12  (26)
  4 PF07989 Microtub_assoc:  Micro  34.0      32  0.0007   20.9   1.7   17   15-31     20-36  (75)
  5 smart00707 RPEL Repeat in Dros  33.6      24 0.00053   18.3   0.9   11   20-30      2-12  (26)
  6 PF15136 UPF0449:  Uncharacteri  29.7      33 0.00071   22.5   1.2   11   18-28     62-72  (97)
  7 COG1565 Uncharacterized conser  24.0      16 0.00035   28.7  -1.1   48    7-55    103-158 (370)
  8 PF09955 DUF2189:  Predicted in  22.3      45 0.00098   21.6   0.9   22   18-39     20-41  (128)
  9 PF15106 TMEM156:  TMEM156 prot  22.1      50  0.0011   24.8   1.2   14   16-29    195-208 (226)
 10 COG1150 HdrC Heterodisulfide r  21.3      46   0.001   24.1   0.8   33    1-34     51-84  (195)
 11 PF11788 MRP-L46:  39S mitochon  21.1      67  0.0015   19.9   1.5   23    8-30     16-38  (111)
 12 PF04667 Endosulfine:  cAMP-reg  20.9      42 0.00091   21.1   0.5    8   21-28     28-35  (86)

No 1  
>KOG2181|consensus
Probab=99.93  E-value=2.6e-27  Score=181.86  Aligned_cols=55  Identities=31%  Similarity=0.452  Sum_probs=52.4

Q ss_pred             CcccCCCCCCCCCchhHhHHHHHHHhcccC---ccccCcccccccccCc-eeeeeccCC
Q psy2757           2 VGVRRHTPYFGQPDYRVYELNKRLQQRTES---LWSSSPETKVDESMYD-CMLLCDELP   56 (61)
Q Consensus         2 ~~~~rh~py~~qpeyRI~elNkRLq~rte~---lWwDaF~teFFEdda~-~~l~c~Edp   56 (61)
                      +|++||+||++|+||||||||||||+|+|.   +|||||+||||||||+ +++||+||-
T Consensus        38 pg~~rh~~y~s~~e~Ri~emNkRLq~~se~sdN~WWDaFstEFFeDDa~Lt~~fclEdg   96 (415)
T KOG2181|consen   38 PGFQRHGNYVSPLEFRIHEMNKRLQIFSEVSDNQWWDAFSTEFFEDDAKLTFVFCLEDG   96 (415)
T ss_pred             CcccccCCCcCcchhhHHHHHHHHHHhcccchhhhHHhhhhhhhcCCceEEEEEEecCC
Confidence            589999999999999999999999999884   9999999999999999 999999984


No 2  
>PF01803 LIM_bind:  LIM-domain binding protein;  InterPro: IPR002691 The LIM-domain binding protein, binds to the LIM domain IPR001781 from INTERPRO of LIM homeodomain proteins which are transcriptional regulators of development. Nuclear LIM interactor (NLI) / LIM domain-binding protein 1 (LDB1) P70662 from SWISSPROT is located in the nuclei of neuronal cells during development, it is co-expressed with Isl1 in early motor neuron differentiation and has a suggested role in the Isl1 dependent development of motor neurons []. It is suggested that these proteins act synergistically to enhance transcriptional efficiency by acting as co-factors for LIM homeodomain and Otx class transcription factors both of which have essential roles in development []. The Drosophila melanogaster protein Chip O18353 from SWISSPROT is required for segmentation and activity of a remote wing margin enhancer []. Chip is a ubiquitous chromosomal factor required for normal expression of diverse genes at many stages of development []. It is suggested that Chip cooperates with different LIM domain proteins and other factors to structurally support remote enhancer-promoter interactions [].; GO: 0003712 transcription cofactor activity, 0005634 nucleus
Probab=98.33  E-value=1.9e-07  Score=64.20  Aligned_cols=42  Identities=14%  Similarity=0.034  Sum_probs=35.7

Q ss_pred             hhHhHHHHHHHhcccC----ccccCcccccccccCc-eeeeeccCCC
Q psy2757          16 YRVYELNKRLQQRTES----LWSSSPETKVDESMYD-CMLLCDELPD   57 (61)
Q Consensus        16 yRI~elNkRLq~rte~----lWwDaF~teFFEdda~-~~l~c~Edp~   57 (61)
                      +||+++|++|+++.++    .||+.|+.+||.++|. ...++.++-.
T Consensus         2 lRl~~~~~~l~~~~~~~~~~~yW~~fv~~fF~~~a~lr~~~~~~~~~   48 (240)
T PF01803_consen    2 LRLLEFIERLSNFSPNLNDIEYWQKFVHEFFSPDAVLRISLWNEDGN   48 (240)
T ss_pred             chHHHHHHHHHhhcCCCCcHHHHHHHHHHHcCCCeeEEEEEEcCCCC
Confidence            6999999999999332    9999999999999999 7777776653


No 3  
>PF02755 RPEL:  RPEL repeat;  InterPro: IPR004018 The RPEL repeat is named after four conserved amino acids it contains. The function of the RPEL repeat is unknown however it might be a DNA binding repeat based on the observation that Q9VZY2 from SWISSPROT contains a SAP domain that is also implicated in DNA binding.; PDB: 2YJE_M 2V52_M 2YJF_M 2V51_E.
Probab=38.94  E-value=18  Score=18.46  Aligned_cols=10  Identities=40%  Similarity=0.730  Sum_probs=6.5

Q ss_pred             HHHHHHhccc
Q psy2757          21 LNKRLQQRTE   30 (61)
Q Consensus        21 lNkRLq~rte   30 (61)
                      |+++|++|..
T Consensus         3 L~~kl~~RP~   12 (26)
T PF02755_consen    3 LERKLSQRPT   12 (26)
T ss_dssp             HHHHHHT---
T ss_pred             HHHHHhcCCC
Confidence            8999999965


No 4  
>PF07989 Microtub_assoc:  Microtubule associated;  InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [].
Probab=33.97  E-value=32  Score=20.92  Aligned_cols=17  Identities=35%  Similarity=0.542  Sum_probs=14.1

Q ss_pred             chhHhHHHHHHHhcccC
Q psy2757          15 DYRVYELNKRLQQRTES   31 (61)
Q Consensus        15 eyRI~elNkRLq~rte~   31 (61)
                      -.|||-|..||++.+++
T Consensus        20 KLrI~fLee~l~~~~~~   36 (75)
T PF07989_consen   20 KLRIYFLEERLQKLGPE   36 (75)
T ss_pred             HHHHHHHHHHHHhcccc
Confidence            36999999999987664


No 5  
>smart00707 RPEL Repeat in Drosophila CG10860, human KIAA0680 and C. elegans F26H9.2.
Probab=33.64  E-value=24  Score=18.26  Aligned_cols=11  Identities=45%  Similarity=0.694  Sum_probs=9.0

Q ss_pred             HHHHHHHhccc
Q psy2757          20 ELNKRLQQRTE   30 (61)
Q Consensus        20 elNkRLq~rte   30 (61)
                      -||++|++|..
T Consensus         2 ~L~~kl~~RP~   12 (26)
T smart00707        2 VLNRKLSQRPT   12 (26)
T ss_pred             hHHHHHHcCCC
Confidence            38999999965


No 6  
>PF15136 UPF0449:  Uncharacterised protein family UPF0449
Probab=29.66  E-value=33  Score=22.50  Aligned_cols=11  Identities=45%  Similarity=0.579  Sum_probs=8.7

Q ss_pred             HhHHHHHHHhc
Q psy2757          18 VYELNKRLQQR   28 (61)
Q Consensus        18 I~elNkRLq~r   28 (61)
                      -.+||.|||+=
T Consensus        62 Yv~~NerLqqa   72 (97)
T PF15136_consen   62 YVAMNERLQQA   72 (97)
T ss_pred             HHHHHHHHHHH
Confidence            46899999864


No 7  
>COG1565 Uncharacterized conserved protein [Function unknown]
Probab=24.00  E-value=16  Score=28.71  Aligned_cols=48  Identities=13%  Similarity=0.214  Sum_probs=32.4

Q ss_pred             CCCCCCCCchhHhHHHHHHHhccc--------CccccCcccccccccCceeeeeccC
Q psy2757           7 HTPYFGQPDYRVYELNKRLQQRTE--------SLWSSSPETKVDESMYDCMLLCDEL   55 (61)
Q Consensus         7 h~py~~qpeyRI~elNkRLq~rte--------~lWwDaF~teFFEdda~~~l~c~Ed   55 (61)
                      ++..+.+..|-|.|.+++|++|--        -.=|.++..++++. .+.++||-|.
T Consensus       103 ~P~~~~~~~~~iiE~s~~L~~~Qk~~L~~~~~~~~~~~~~e~~p~~-~~~i~~~NEl  158 (370)
T COG1565         103 YPELYEALSYYIIEPSPELRARQKETLKATEDLIRWVEWVEDLPKK-FPGIVVSNEL  158 (370)
T ss_pred             CHHHHhcceEEEEecCHHHHHHHHHHHhccccchhHHHHHHhcccc-CceEEEechh
Confidence            455778999999999999977632        23455555555555 4566666664


No 8  
>PF09955 DUF2189:  Predicted integral membrane protein (DUF2189);  InterPro: IPR018692  This family includes several hypothetical prokaryotic proteins. Some are described as putative cytochrome c oxidases.
Probab=22.31  E-value=45  Score=21.57  Aligned_cols=22  Identities=23%  Similarity=0.573  Sum_probs=17.0

Q ss_pred             HhHHHHHHHhcccCccccCccc
Q psy2757          18 VYELNKRLQQRTESLWSSSPET   39 (61)
Q Consensus        18 I~elNkRLq~rte~lWwDaF~t   39 (61)
                      +||+.||+++-..--|.+++..
T Consensus        20 lYeiSrr~e~G~~~~~~~~l~~   41 (128)
T PF09955_consen   20 LYEISRRRERGEPPSWGDSLSA   41 (128)
T ss_pred             HHHHHHHHhCCCCCCHHHHHhh
Confidence            6999999987655578777765


No 9  
>PF15106 TMEM156:  TMEM156 protein family
Probab=22.08  E-value=50  Score=24.79  Aligned_cols=14  Identities=29%  Similarity=0.615  Sum_probs=12.5

Q ss_pred             hhHhHHHHHHHhcc
Q psy2757          16 YRVYELNKRLQQRT   29 (61)
Q Consensus        16 yRI~elNkRLq~rt   29 (61)
                      |+|+|=|||.|.|-
T Consensus       195 ~KIle~hrrvqkwq  208 (226)
T PF15106_consen  195 YKILEGHRRVQKWQ  208 (226)
T ss_pred             HHHHHhhhhHhHHh
Confidence            89999999999874


No 10 
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion]
Probab=21.31  E-value=46  Score=24.14  Aligned_cols=33  Identities=33%  Similarity=0.442  Sum_probs=24.1

Q ss_pred             CCcccCCCCCCCCCchhHhHHHHH-HHhcccCccc
Q psy2757           1 CVGVRRHTPYFGQPDYRVYELNKR-LQQRTESLWS   34 (61)
Q Consensus         1 ~~~~~rh~py~~qpeyRI~elNkR-Lq~rte~lWw   34 (61)
                      ||+ +|++.|..--=.|..-+|-+ ++..++++|-
T Consensus        51 CPs-~r~t~y~pR~ii~~~~~g~~d~il~~~~lW~   84 (195)
T COG1150          51 CPS-GRFTDYSPRKIIRKARLGLVDLILSSESLWA   84 (195)
T ss_pred             CCC-cccCCCCHHHHHHHHHcccHHHHhcCCccee
Confidence            444 45588877666677777878 8888888884


No 11 
>PF11788 MRP-L46:  39S mitochondrial ribosomal protein L46 ;  InterPro: IPR021757  This is the L46 subunit of the mammalian mitochondrial ribosome, conserved from plants and fungi. 
Probab=21.13  E-value=67  Score=19.87  Aligned_cols=23  Identities=35%  Similarity=0.349  Sum_probs=15.9

Q ss_pred             CCCCCCCchhHhHHHHHHHhccc
Q psy2757           8 TPYFGQPDYRVYELNKRLQQRTE   30 (61)
Q Consensus         8 ~py~~qpeyRI~elNkRLq~rte   30 (61)
                      +|-+++-|-+.|+-+++|++|-+
T Consensus        16 t~~~t~~E~~y~~yq~~L~~rl~   38 (111)
T PF11788_consen   16 TPEPTPFEKAYYEYQKELLRRLE   38 (111)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHh
Confidence            46677788999666666666533


No 12 
>PF04667 Endosulfine:  cAMP-regulated phosphoprotein/endosulfine conserved region;  InterPro: IPR006760 This endosulphine family includes cAMP-regulated phosphoprotein 19 (ARPP-19), alpha endosulphine and protein Igo1.  No function has yet been assigned to ARPP-19 []. Endosulphine is the endogenous ligand for the ATP-dependent potassium channels which occupy a key position in the control of insulin release from the pancreatic beta cell by coupling cell polarity to metabolism []. Igo1 is required for initiation of G0 program. In the absence of stimulatory signals, cells may enter into a reversible quiescence (or G0) state that is typically characterised by low metabolic activity, including low rates of protein synthesis and transcription. Igo proteins associate with the mRNA decapping activator Dhh1, sheltering newly expressed mRNAs from degradation via the 5'-3' mRNA decay pathway, and thereby enabling their proper translation during initiation of the G0 program []. 
Probab=20.94  E-value=42  Score=21.10  Aligned_cols=8  Identities=63%  Similarity=0.978  Sum_probs=6.8

Q ss_pred             HHHHHHhc
Q psy2757          21 LNKRLQQR   28 (61)
Q Consensus        21 lNkRLq~r   28 (61)
                      |.||||+|
T Consensus        28 L~kkl~~r   35 (86)
T PF04667_consen   28 LQKKLQKR   35 (86)
T ss_pred             hhhhhccc
Confidence            88999886


Done!